Citrus Sinensis ID: 038708

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MDTKFEALPPLKRFRLMQQQREEQEGGQQHHQQKIQESDESTAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIETKDECIQEQEEIQQEEEEEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTGKYKIVARDDCKK
cccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEccccccEEEcccccccccccccccccccccccEEccccccEEEEcccccccccccHHHHHHcccEEEEEEcccccEEEEEccccccHHHHHHHcccccccHHHHHccc
ccccccccccccEEEEEccHHHHHHccccccccccccccccccccccccccccEEEEEcccccccccccccccccHHHHcccEEccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccEEEEEccccEEEEHHHccccEEEEcccccHHHHHHHccccccccccEEEcccccccccccccccEEEEEEEEEEcEEEEccccEEccEEcccccHHHHHHHHHHHHHccccEEEEcccccEEEEEHHHHHHcccEEEEEEcccccEEEEEccccccccccccccccccccccHHHccc
mdtkfealpplkRFRLMQQQREEQEGGQQHHQQKIqesdestaknlclpakkrkycfyppplpssdspetrtvgagggissfttyslpakkrvwaiqpdllfldlnvewkppsfietKDECIQEQEEIQqeeeeeddgILCAVcqstdgdskdpivfcdgcdlmvhatcygnplvkeipdgdwfcaqclaandenrafscclcpvgggamkptkdgLWAHVVCAVLvpevffedpegregidcskvpktrrekrcyickskrgcsvecsepkcclsfhvtcglsedLCIEyregkkggavvAGFCKDHTEIWKKQQQtgkykivarddckk
mdtkfealpplkrFRLMQQQREEQEGGQQHhqqkiqesdestAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIETKDECIQEQEEIQqeeeeeddGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEvffedpegregidcskvpktrrekrcyickskrgcsvecsepkCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIwkkqqqtgkykivarddckk
MDTKFEALPPLKRFRLMqqqreeqeggqqhhqqkiqeSDESTAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIETKDECiqeqeeiqqeeeeeDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTGKYKIVARDDCKK
**********************************************CLPAKKRKYCFY*****************GGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIET*********************ILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTGKYKIV*******
******A******************************************************************GAGGGISSFTTYSLPAKKRVWAIQPDLLF***********************************GILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKD************************
MDTKFEALPPLKRFRLMQ***********************TAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIETKDECI***************GILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKS********SEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWK******************
****FEALPPLKRFRLMQQQREEQEGGQQHHQQKIQESDESTAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSFIETKDECIQEQEEIQQEEEEEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDH***********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTKFEALPPLKRFRLMQQQREEQEGGQQHHQQKIQESDESTAKNLCLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLFLDLNVEWKPPSxxxxxxxxxxxxxxxxxxxxxEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTGKYKIVARDDCKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
Q6IE81 842 Protein Jade-1 OS=Homo sa yes no 0.543 0.213 0.370 6e-30
Q803A0 829 Protein Jade-1 OS=Danio r no no 0.528 0.211 0.385 1e-29
Q6ZPI0 834 Protein Jade-1 OS=Mus mus yes no 0.543 0.215 0.365 3e-29
Q5E9T7 509 Protein Jade-1 OS=Bos tau yes no 0.543 0.353 0.365 4e-29
P55201 1214 Peregrin OS=Homo sapiens no no 0.498 0.135 0.395 7e-29
Q12311 748 NuA3 HAT complex componen yes no 0.413 0.183 0.412 8e-29
P55197 1027 Protein AF-10 OS=Homo sap no no 0.589 0.189 0.347 2e-28
O54826 1068 Protein AF-10 OS=Mus musc no no 0.589 0.182 0.347 3e-28
Q6GQJ2 827 Protein Jade-1 OS=Xenopus N/A no 0.507 0.203 0.372 8e-28
Q9ULD4 1205 Bromodomain and PHD finge no no 0.504 0.138 0.394 1e-27
>sp|Q6IE81|JADE1_HUMAN Protein Jade-1 OS=Homo sapiens GN=PHF17 PE=1 SV=1 Back     alignment and function desciption
 Score =  131 bits (330), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 98/189 (51%), Gaps = 9/189 (4%)

Query: 134 EEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAAND 193
           E D+ ++C VCQS DG+  + +VFCD C++ VH  CYG   + ++P+G W C  C     
Sbjct: 199 EYDEDVVCDVCQSPDGEDGNEMVFCDKCNICVHQACYG---ILKVPEGSWLCRTCALGVQ 255

Query: 194 ENRAFSCCLCPVGGGAMKPTKDGL-WAHVVCAVLVPEVFFEDPEGREGI-DCSKVPKTRR 251
                 C LCP  GGAMKPT+ G  W HV CA+ +PEV    PE  E I   S +P +R 
Sbjct: 256 PK----CLLCPKKGGAMKPTRSGTKWVHVSCALWIPEVSIGSPEKMEPITKVSHIPSSRW 311

Query: 252 EKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEI 311
              C +C  K G S++CS   C  +FHVTC     L ++    +        +C  H+  
Sbjct: 312 ALVCSLCNEKFGASIQCSVKNCRTAFHVTCAFDRGLEMKTILAENDEVKFKSYCPKHSSH 371

Query: 312 WKKQQQTGK 320
            K ++  GK
Sbjct: 372 RKPEESLGK 380
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Transcriptional coactivator it may also promote acetylation of nucleosomal histone H4 by KAT5. Promotes apoptosis. May act as a renal tumor suppressor.
Homo sapiens (taxid: 9606)
>sp|Q803A0|JADE1_DANRE Protein Jade-1 OS=Danio rerio GN=phf17 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZPI0|JADE1_MOUSE Protein Jade-1 OS=Mus musculus GN=Phf17 PE=1 SV=2 Back     alignment and function description
>sp|Q5E9T7|JADE1_BOVIN Protein Jade-1 OS=Bos taurus GN=PHF17 PE=2 SV=1 Back     alignment and function description
>sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q12311|NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTO1 PE=1 SV=1 Back     alignment and function description
>sp|P55197|AF10_HUMAN Protein AF-10 OS=Homo sapiens GN=MLLT10 PE=1 SV=1 Back     alignment and function description
>sp|O54826|AF10_MOUSE Protein AF-10 OS=Mus musculus GN=Mllt10 PE=1 SV=2 Back     alignment and function description
>sp|Q6GQJ2|JADE1_XENLA Protein Jade-1 OS=Xenopus laevis GN=phf17 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
224061387347 predicted protein [Populus trichocarpa] 0.924 0.881 0.540 3e-99
449456551335 PREDICTED: peregrin-like [Cucumis sativu 0.912 0.901 0.546 6e-99
297834342342 predicted protein [Arabidopsis lyrata su 0.933 0.903 0.524 6e-97
224119018329 predicted protein [Populus trichocarpa] 0.927 0.933 0.546 2e-95
42572435343 RING/FYVE/PHD zinc finger-containing pro 0.870 0.839 0.533 5e-90
225461818347 PREDICTED: peregrin [Vitis vinifera] 0.818 0.780 0.570 1e-87
18400507341 RING/FYVE/PHD zinc finger-containing pro 0.864 0.838 0.527 2e-87
255580857344 mixed-lineage leukemia protein, putative 0.809 0.779 0.546 2e-87
356554736317 PREDICTED: protein Jade-3-like [Glycine 0.788 0.823 0.560 1e-81
356556638317 PREDICTED: PHD finger protein rhinoceros 0.782 0.817 0.560 2e-81
>gi|224061387|ref|XP_002300454.1| predicted protein [Populus trichocarpa] gi|222847712|gb|EEE85259.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 242/372 (65%), Gaps = 66/372 (17%)

Query: 1   MDTKFEALPPLKRFRLMQQQREEQEGGQQHHQQKIQESDESTAKNLCLPAKKRKYCFYPP 60
           MDTKF+ALPPLKR RL+QQ           HQQ   E+ E+    L LPAKKRK    P 
Sbjct: 1   MDTKFQALPPLKRHRLLQQ-----------HQQ---ENKENVPIALQLPAKKRKESRNP- 45

Query: 61  PLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDLLF------LDLNVEWKPPSF 114
            L +  +P+  T  A         Y LP KKRVWA+ PDL+        +LNVE+ P SF
Sbjct: 46  -LLADAAPQVTTTAA---------YCLPTKKRVWALHPDLVSGKPLSPFNLNVEYNPHSF 95

Query: 115 IET-----------KDECIQEQEEIQQEEEEE---------------DDGILCAVCQSTD 148
            E             D  I +  EI  E  +E               DDGILCA+C+STD
Sbjct: 96  NEEIKANEENKKTPLDIIIDKSIEILDENNQEECKEEEEKEEEEEEEDDGILCAICRSTD 155

Query: 149 GDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAAND-----ENRAFSCCLC 203
           GD  DPIVFCDGCDLMVH TCYGNPL+K +PDGDWFC QCLA+       +  + SCC C
Sbjct: 156 GDPTDPIVFCDGCDLMVHTTCYGNPLIKGVPDGDWFCIQCLASKSYRSESKQSSLSCCFC 215

Query: 204 PVGGGAMKPTK----DGLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICK 259
           P  GGA+KPT     DG WAHVVCA+L+PEVFF+DP+GREGI+CSKVPK R E +CY+CK
Sbjct: 216 PTKGGALKPTTTKGVDGSWAHVVCALLIPEVFFDDPDGREGINCSKVPKRRWEGKCYVCK 275

Query: 260 SKRGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTG 319
           S+ GC +ECSEPKC L+FHVTCGL+EDLCIE++EGKK   +VAGFCK HTE+W KQQQ+G
Sbjct: 276 SRTGCVIECSEPKCPLAFHVTCGLNEDLCIEFKEGKKRETIVAGFCKSHTELWDKQQQSG 335

Query: 320 KYKIVARDDCKK 331
           K+KIVAR++ +K
Sbjct: 336 KFKIVAREEHRK 347

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449456551|ref|XP_004146012.1| PREDICTED: peregrin-like [Cucumis sativus] gi|449525830|ref|XP_004169919.1| PREDICTED: peregrin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297834342|ref|XP_002885053.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330893|gb|EFH61312.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224119018|ref|XP_002331305.1| predicted protein [Populus trichocarpa] gi|222873888|gb|EEF11019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|42572435|ref|NP_974313.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|9294395|dbj|BAB02405.1| unnamed protein product [Arabidopsis thaliana] gi|225898643|dbj|BAH30452.1| hypothetical protein [Arabidopsis thaliana] gi|332642041|gb|AEE75562.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225461818|ref|XP_002283700.1| PREDICTED: peregrin [Vitis vinifera] Back     alignment and taxonomy information
>gi|18400507|ref|NP_566491.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] gi|21618148|gb|AAM67198.1| similar to zinc-finger protein [Arabidopsis thaliana] gi|332642040|gb|AEE75561.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255580857|ref|XP_002531248.1| mixed-lineage leukemia protein, putative [Ricinus communis] gi|223529167|gb|EEF31145.1| mixed-lineage leukemia protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356554736|ref|XP_003545699.1| PREDICTED: protein Jade-3-like [Glycine max] Back     alignment and taxonomy information
>gi|356556638|ref|XP_003546630.1| PREDICTED: PHD finger protein rhinoceros-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2089606343 AT3G14740 [Arabidopsis thalian 0.960 0.927 0.471 3.9e-83
ZFIN|ZDB-GENE-040426-731 1258 brpf1 "bromodomain and PHD fin 0.480 0.126 0.391 2.1e-32
ASPGD|ASPL0000000577 1173 AN6675 [Emericella nidulans (t 0.537 0.151 0.378 2.5e-32
ZFIN|ZDB-GENE-030131-5648 829 phf17 "PHD finger protein 17" 0.558 0.223 0.371 3.3e-32
UNIPROTKB|Q5E9T7 509 PHF17 "Protein Jade-1" [Bos ta 0.537 0.349 0.368 8.1e-32
UNIPROTKB|Q6IE81 842 PHF17 "Protein Jade-1" [Homo s 0.537 0.211 0.374 1.2e-31
CGD|CAL0003263 759 orf19.5910 [Candida albicans ( 0.495 0.216 0.367 2.4e-31
ZFIN|ZDB-GENE-120215-66 795 si:ch73-202g8.3 "si:ch73-202g8 0.534 0.222 0.349 2.7e-31
RGD|1306920 832 Phf17 "PHD finger protein 17" 0.537 0.213 0.368 3.1e-31
UNIPROTKB|F1RRB5 842 PHF17 "Uncharacterized protein 0.537 0.211 0.368 3.1e-31
TAIR|locus:2089606 AT3G14740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 833 (298.3 bits), Expect = 3.9e-83, P = 3.9e-83
 Identities = 168/356 (47%), Positives = 217/356 (60%)

Query:     1 MDTKFEALPPLKRFRLMXXXXXXXXXX--------------XXXXXXXXXXSDESTAKNL 46
             MD +++ LPPLKR RL+                                   D+  A+N 
Sbjct:     1 MDAQYQDLPPLKRLRLLQRDLEAAQQHQLPNQPEMKSLQLPAKKRKQTRVDYDDDDAENS 60

Query:    47 -----CLPAKKRKYCFYPPPLPSSDSPETRTVGAGGGISSFTTYSLPAKKRVWAIQPDL- 100
                  CLPAKKR +   P  L            +GGG + F+ + L  + + +  +  + 
Sbjct:    61 NPTYHCLPAKKRIWAIDPDLL------------SGGG-NPFSPFDLNVEYKPYVEEKSIE 107

Query:   101 ----LFLDLNVEWKPPSFIETKDECXXXXXXXXXXXXXXD-DGILCAVCQSTDGDSKDPI 155
                 L ++ ++E +     E  D                D DGI+CAVCQSTDGD  +PI
Sbjct:   108 KKSTLNVESSLEVEEDDDKENIDPLGKGKALDLSDREVEDEDGIMCAVCQSTDGDPLNPI 167

Query:   156 VFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKD 215
             VFCDGCDLMVHA+CYGNPLVK IP+GDWFC QCL++ +  + FSCCLC   GGAMKPT D
Sbjct:   168 VFCDGCDLMVHASCYGNPLVKAIPEGDWFCRQCLSSKNREKIFSCCLCTTKGGAMKPTND 227

Query:   216 GLWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSKRGCSVECSEPKCCL 275
             G WAH+ CA+ VPEV+FEDPEGREGI CS+V   R + RCY+CK +RGC +ECSE +C L
Sbjct:   228 GRWAHITCALFVPEVYFEDPEGREGICCSEVLSKRWKDRCYLCKVRRGCVIECSEMRCKL 287

Query:   276 SFHVTCGLSEDLCIEYREGKKGGAVVAGFCKDHTEIWKKQQQTGKYKIVARDDCKK 331
             +FHVTCGL EDLCIEYREGKK G +V GFC +HT++W++QQ++GKYKIVAR++ KK
Sbjct:   288 AFHVTCGLKEDLCIEYREGKKSGGIVVGFCNEHTKLWERQQESGKYKIVAREEDKK 343
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-040426-731 brpf1 "bromodomain and PHD finger containing, 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ASPGD|ASPL0000000577 AN6675 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5648 phf17 "PHD finger protein 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9T7 PHF17 "Protein Jade-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q6IE81 PHF17 "Protein Jade-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
CGD|CAL0003263 orf19.5910 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-66 si:ch73-202g8.3 "si:ch73-202g8.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1306920 Phf17 "PHD finger protein 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRB5 PHF17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pm.C_LG_I001209
hypothetical protein (347 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
COG5141 669 COG5141, COG5141, PHD zinc finger-containing prote 2e-35
pfam13832109 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like doma 1e-30
pfam1377189 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domai 6e-17
pfam0062851 pfam00628, PHD, PHD-finger 3e-07
smart0024947 smart00249, PHD, PHD zinc finger 3e-07
pfam1383133 pfam13831, PHD_2, PHD-finger 1e-06
>gnl|CDD|227470 COG5141, COG5141, PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information 
 Score =  135 bits (342), Expect = 2e-35
 Identities = 65/184 (35%), Positives = 92/184 (50%), Gaps = 10/184 (5%)

Query: 131 EEEEEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLA 190
           E  +E D I C  C ST  ++ + IVFCDGC++ VH +CYG   ++ +P+G W C +C+ 
Sbjct: 187 EPSDEFDDI-CTKCTSTHNENSNAIVFCDGCEICVHQSCYG---IQFLPEGFWLCRKCIY 242

Query: 191 ANDENRAFSCCLCPVGGGAMKPTKDGLWAHVVCAVLVPEVFFEDPEGREGID-CSKVPKT 249
              E +   C  CP   GA K T DG W HV+CA+  PE+ F     ++ ID  + V  +
Sbjct: 243 G--EYQIRCCSFCPSSDGAFKQTSDGRWGHVICAMFNPELSFGHLLSKDPIDNIASVSSS 300

Query: 250 RREKRCYICKSKRGCSVECSEPKCCLSFHVTCGLSE---DLCIEYREGKKGGAVVAGFCK 306
           R +  C ICK   G  ++CS   C  ++HVTC       DL I    G          C+
Sbjct: 301 RWKLGCLICKEFGGTCIQCSYFNCTRAYHVTCARRAGYFDLNIYSHNGISYCIDHEPLCR 360

Query: 307 DHTE 310
            H  
Sbjct: 361 KHYP 364

Length = 669
>gnl|CDD|206003 pfam13832, zf-HC5HC2H_2, PHD-zinc-finger like domain Back     alignment and domain information
>gnl|CDD|222368 pfam13771, zf-HC5HC2H, PHD-like zinc-binding domain Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|222406 pfam13831, PHD_2, PHD-finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
KOG0956 900 consensus PHD finger protein AF10 [General functio 100.0
KOG0954 893 consensus PHD finger protein [General function pre 100.0
COG5141 669 PHD zinc finger-containing protein [General functi 100.0
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 100.0
KOG0957 707 consensus PHD finger protein [General function pre 99.95
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 99.93
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 99.67
KOG0825 1134 consensus PHD Zn-finger protein [General function 99.26
KOG1080 1005 consensus Histone H3 (Lys4) methyltransferase comp 98.82
KOG1244336 consensus Predicted transcription factor Requiem/N 98.7
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 98.68
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.63
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.39
KOG1512381 consensus PHD Zn-finger protein [General function 98.33
KOG4299 613 consensus PHD Zn-finger protein [General function 97.95
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.67
KOG1973274 consensus Chromatin remodeling protein, contains P 97.54
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 97.5
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.2
KOG0383 696 consensus Predicted helicase [General function pre 97.08
KOG1084375 consensus Transcription factor TCF20 [Transcriptio 97.0
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 96.99
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 96.88
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 96.64
KOG0957707 consensus PHD finger protein [General function pre 96.44
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.41
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 95.02
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 93.69
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.49
KOG1244336 consensus Predicted transcription factor Requiem/N 93.13
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 93.02
KOG0383 696 consensus Predicted helicase [General function pre 89.44
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 89.3
KOG1973274 consensus Chromatin remodeling protein, contains P 84.55
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-37  Score=307.37  Aligned_cols=172  Identities=39%  Similarity=0.838  Sum_probs=156.9

Q ss_pred             ccccccccccCCCCCCeEEccC--CCcccccccccCCCCCCCCCCcEeCcccccccccccccccccccCCCCCCcccccc
Q 038708          139 ILCAVCQSTDGDSKDPIVFCDG--CDLMVHATCYGNPLVKEIPDGDWFCAQCLAANDENRAFSCCLCPVGGGAMKPTKDG  216 (331)
Q Consensus       139 ~~C~vC~~~~~~~~~~ll~Cd~--C~~~~H~~C~g~p~~~~ip~~~W~C~~C~~~~~~~~~~~C~lC~~~gGalk~t~~~  216 (331)
                      .-|.||.+..++.+|.|++||+  |-++||+.|||+   .+||.|.|||..|.... +.-++.|.|||.++||||+|+++
T Consensus         6 GGCCVCSDErGWaeNPLVYCDG~nCsVAVHQaCYGI---vqVPtGpWfCrKCesqe-raarvrCeLCP~kdGALKkTDn~   81 (900)
T KOG0956|consen    6 GGCCVCSDERGWAENPLVYCDGHNCSVAVHQACYGI---VQVPTGPWFCRKCESQE-RAARVRCELCPHKDGALKKTDNG   81 (900)
T ss_pred             cceeeecCcCCCccCceeeecCCCceeeeehhccee---EecCCCchhhhhhhhhh-hhccceeecccCcccceecccCC
Confidence            4699999988999999999998  999999999995   67999999999998762 34678999999999999999999


Q ss_pred             ccceeeccccCCeeEEeCCCCCccccccCccccccCccccccCCC-------CCCeeEeCCCCCCceEeccccccCCceE
Q 038708          217 LWAHVVCAVLVPEVFFEDPEGREGIDCSKVPKTRREKRCYICKSK-------RGCSVECSEPKCCLSFHVTCGLSEDLCI  289 (331)
Q Consensus       217 ~wvH~~Cal~~pe~~f~~~~~~~~v~~~~i~~~~~~~~C~iC~~~-------~G~~i~C~~~~C~~~fHv~CA~~~g~~~  289 (331)
                      -|+||+|||++|||.|.|...|++|-+..||.+|++..|+||...       .|+||+|...+|.+.|||+||+.+|+..
T Consensus        82 GWAHVVCALYIPEVrFgNV~TMEPIiLq~VP~dRfnKtCYIC~E~GrpnkA~~GACMtCNKs~CkqaFHVTCAQ~~GLLC  161 (900)
T KOG0956|consen   82 GWAHVVCALYIPEVRFGNVHTMEPIILQDVPHDRFNKTCYICNEEGRPNKAAKGACMTCNKSGCKQAFHVTCAQRAGLLC  161 (900)
T ss_pred             CceEEEEEeeccceeecccccccceeeccCchhhhcceeeeecccCCccccccccceecccccchhhhhhhHhhhhccce
Confidence            999999999999999999999999999999999999999999975       5999999999999999999999999987


Q ss_pred             EeecCCCCCceEEEcCCCcccchhh
Q 038708          290 EYREGKKGGAVVAGFCKDHTEIWKK  314 (331)
Q Consensus       290 ~~~~~~~~~~~~~~~C~~H~~~~~~  314 (331)
                      +......+++.|-.||+.|....++
T Consensus       162 EE~gn~~dNVKYCGYCk~HfsKlkk  186 (900)
T KOG0956|consen  162 EEEGNISDNVKYCGYCKYHFSKLKK  186 (900)
T ss_pred             eccccccccceechhHHHHHHHhhc
Confidence            7654455678899999999876554

>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1080 consensus Histone H3 (Lys4) methyltransferase complex, subunit SET1 and related methyltransferases [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1084 consensus Transcription factor TCF20 [Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
2ku3_A71 Solution Structure Of Brd1 Phd1 Finger Length = 71 6e-07
2l43_A88 Structural Basis For Histone Code Recognition By Br 6e-07
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 4e-05
>pdb|2KU3|A Chain A, Solution Structure Of Brd1 Phd1 Finger Length = 71 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 3/56 (5%)
Query: 136 DDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAA 191
           D+  +C++C   +  + + I+FCD C+L VH  CYG P    IP+G W C  CL +
Sbjct: 14  DEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYGVPY---IPEGQWLCRHCLQS 66
>pdb|2L43|A Chain A, Structural Basis For Histone Code Recognition By Brpf2-Phd1 Finger Length = 88 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 2e-15
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 3e-15
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 5e-14
2yt5_A66 Metal-response element-binding transcription facto 6e-13
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 8e-09
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 6e-08
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 4e-07
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 7e-07
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 1e-06
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-06
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-06
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 1e-06
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 4e-06
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 4e-06
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 4e-06
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 7e-06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-04
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 7e-06
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 9e-06
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 1e-05
1wee_A72 PHD finger family protein; structural genomics, PH 2e-05
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 3e-05
1wem_A76 Death associated transcription factor 1; structura 2e-04
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 6e-04
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
 Score = 68.8 bits (168), Expect = 2e-15
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%)

Query: 130 QEEEEEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCL 189
             +   D+  +C++C   +  + + I+FCD C+L VH  CYG   V  IP+G W C  CL
Sbjct: 8   HMQSLIDEDAVCSICMDGESQNSNVILFCDMCNLAVHQECYG---VPYIPEGQWLCRHCL 64

Query: 190 A 190
            
Sbjct: 65  Q 65
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 99.47
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.36
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.36
2yt5_A66 Metal-response element-binding transcription facto 99.35
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.28
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.28
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.27
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.25
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.24
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.23
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.23
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.22
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.22
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.2
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.18
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.15
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.13
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.12
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.12
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.03
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.02
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.98
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.97
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.91
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.9
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.85
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.84
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.82
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.8
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.78
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.76
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.74
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.73
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.7
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.67
1weu_A91 Inhibitor of growth family, member 4; structural g 98.61
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.4
1wee_A72 PHD finger family protein; structural genomics, PH 98.29
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.29
1x4i_A70 Inhibitor of growth protein 3; structural genomics 98.27
1we9_A64 PHD finger family protein; structural genomics, PH 98.25
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 98.17
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.08
1wew_A78 DNA-binding family protein; structural genomics, P 98.07
1wem_A76 Death associated transcription factor 1; structura 98.01
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.0
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.89
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.89
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.84
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.76
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.75
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.7
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.82
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.54
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.52
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.5
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 95.89
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 95.36
1we9_A64 PHD finger family protein; structural genomics, PH 94.26
1wew_A78 DNA-binding family protein; structural genomics, P 94.24
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 94.04
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 93.47
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 93.45
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 92.83
1wee_A72 PHD finger family protein; structural genomics, PH 92.79
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 92.69
3o70_A68 PHD finger protein 13; PHF13, structural genomics 92.63
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 92.21
1wem_A76 Death associated transcription factor 1; structura 92.18
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 92.04
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 91.94
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 91.67
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 91.23
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 91.13
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 91.09
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 91.09
2k16_A75 Transcription initiation factor TFIID subunit 3; p 91.02
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 90.89
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 90.63
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 90.62
1weu_A91 Inhibitor of growth family, member 4; structural g 90.47
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 90.31
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 90.11
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 88.58
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 88.4
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 88.02
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 87.85
2yt5_A66 Metal-response element-binding transcription facto 86.61
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 86.51
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 86.38
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 86.34
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 86.02
2ect_A78 Ring finger protein 126; metal binding protein, st 85.68
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 85.52
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 84.23
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 83.33
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 82.58
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 82.42
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 82.19
1x4i_A70 Inhibitor of growth protein 3; structural genomics 81.64
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 81.4
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 80.92
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 80.28
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 80.23
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
Probab=99.47  E-value=1.8e-14  Score=111.39  Aligned_cols=66  Identities=32%  Similarity=0.720  Sum_probs=55.9

Q ss_pred             CccccccCccccccCCC-CCCeeEeCCCCCCceEeccccccCCceEEeecCCC-------CCceEEEcCCCccc
Q 038708          245 KVPKTRREKRCYICKSK-RGCSVECSEPKCCLSFHVTCGLSEDLCIEYREGKK-------GGAVVAGFCKDHTE  310 (331)
Q Consensus       245 ~i~~~~~~~~C~iC~~~-~G~~i~C~~~~C~~~fHv~CA~~~g~~~~~~~~~~-------~~~~~~~~C~~H~~  310 (331)
                      .||+.||+++|++|+.+ .|++|+|+..+|.++|||+||+.+|+.+++.....       +...+.+||++|++
T Consensus        10 NIp~~R~~l~C~iC~~~~~GAciqC~~~~C~~~fHv~CA~~aGl~~~~~~~~~~~~~~~~~~v~~~~yC~~HsP   83 (87)
T 2lq6_A           10 NIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTP   83 (87)
T ss_dssp             CCCCCCCCCCBTTTTBCCSSCEEECSCTTTCCEEEHHHHHHHTCCEEEEEEEECTTTSCEEEEEEEECCGGGSS
T ss_pred             CCChHHhcCCCcCCCCCCCcEeEecCCCCCCCcCcHHHHHHCCCceEeecccccccCCccccceECeECcCCCC
Confidence            57889999999999987 49999999999999999999999999988753211       12357899999997
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 331
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-10
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 4e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 3e-07
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 3e-07
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 2e-06
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 2e-06
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 7e-05
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 0.003
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: PHD finger protein 22
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 54.1 bits (129), Expect = 3e-10
 Identities = 15/70 (21%), Positives = 27/70 (38%), Gaps = 3/70 (4%)

Query: 130 QEEEEEDDGILCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPL---VKEIPDGDWFCA 186
            ++   + G+ C VC+     S + +V C  C  + H  C+   +       P   W+CA
Sbjct: 8   ADDFAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCA 67

Query: 187 QCLAANDENR 196
           +C        
Sbjct: 68  RCTRQMKRMA 77
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.12
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.06
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.99
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.98
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.59
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 98.53
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.53
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.52
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.18
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.12
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.94
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 93.62
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.71
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 92.37
d1wema_76 Death associated transcription factor 1, Datf1 (DI 92.35
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 92.25
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 91.85
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 91.75
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 91.57
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 89.48
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 87.57
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 86.67
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 86.49
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 84.94
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 84.83
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 82.5
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.12  E-value=9.8e-12  Score=84.66  Aligned_cols=49  Identities=37%  Similarity=0.973  Sum_probs=43.3

Q ss_pred             cccccccccCCCCCCeEEccCCCcccccccccCCCCCCCCCCcEeCcccccc
Q 038708          140 LCAVCQSTDGDSKDPIVFCDGCDLMVHATCYGNPLVKEIPDGDWFCAQCLAA  191 (331)
Q Consensus       140 ~C~vC~~~~~~~~~~ll~Cd~C~~~~H~~C~g~p~~~~ip~~~W~C~~C~~~  191 (331)
                      .|.||+..+  +++.||+||+|+..||.+|++||+ ..+|.++|+|+.|+..
T Consensus         2 ~C~vC~~~~--~~~~~i~Cd~C~~~~H~~C~~p~~-~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKG--EDDKLILCDECNKAFHLFCLRPAL-YEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSS--CCSCCEECTTTCCEECHHHHCTTC-CSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCC--CCCCEEEcCCCCCCCCCCCCCCCC-CcCCCCCEECcCCcCc
Confidence            589999865  568899999999999999999985 7899999999999753
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure