Citrus Sinensis ID: 038790

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYLSSSSDRDSWWLR
ccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccEEEEcccccccccccEEccccccccEEEEEccccccccccHHHHccccccccccccccccccccccccccccEEEEcccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccEEEEEEccccccEEEEEEcccEHHHHcccHHHHHHcccccHHHHHHHHccccEcccccEEEEEccccccccccccccEEcc
MLSYIVSVSTHLKWACKFLIQnslfghrigmhgvpaeiGEELLTvgryernndneAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGlfrrvtcplcRDFLDSRRAVVENGIEILVFKRFCYlssssdrdswwlr
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKrfcylssssdrdswwlr
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVclceieegeeirelrCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYlssssdrdswwlr
***YIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYLS***********
MLSYIVSVSTHLKWACKFLI*************************GRYERN*DNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFL*****************************SWWLR
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYLSS**********
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYLS***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSYIVSVSTHLKWACKFLIQNSLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIEILVFKRFCYLSSSSDRDSWWLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q0V9R0954 E3 ubiquitin-protein liga yes no 0.352 0.051 0.470 5e-10
Q66J97967 E3 ubiquitin-protein liga N/A no 0.352 0.050 0.470 5e-10
Q6NRV8959 E3 ubiquitin-protein liga N/A no 0.352 0.051 0.470 5e-10
Q90ZT7923 E3 ubiquitin-protein liga N/A no 0.352 0.053 0.470 5e-10
Q5R476986 E3 ubiquitin-protein liga yes no 0.309 0.043 0.511 1e-09
Q99ML9989 E3 ubiquitin-protein liga yes no 0.309 0.043 0.511 1e-09
Q6ZNA4994 E3 ubiquitin-protein liga yes no 0.309 0.043 0.511 1e-09
Q8NC42400 E3 ubiquitin-protein liga no no 0.712 0.247 0.373 2e-09
Q93Z92390 E3 ubiquitin-protein liga no no 0.539 0.192 0.415 3e-09
Q9ZU51147 Probable E3 ubiquitin-pro no no 0.395 0.374 0.464 3e-09
>sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 Back     alignment and function desciption
 Score = 62.8 bits (151), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 36/51 (70%), Gaps = 2/51 (3%)

Query: 58  ECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSR 108
           +C +CL  +EEGE++R L C H+FH+VC+DQW  L     CP+CR  +D++
Sbjct: 901 KCTICLSILEEGEDVRRLPCMHLFHQVCVDQW--LITNKKCPICRVDIDTQ 949
Acts in the nodal-related pathway of mesoderm patterning during embryonic development. Enhances signaling of the subset of TGF-beta factors responsible for the formation of dorso-anterior tissues of Spemann's organizer. May act as an E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes and then transfers it to substrates.
Xenopus tropicalis (taxid: 8364)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 Back     alignment and function description
>sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 Back     alignment and function description
>sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 Back     alignment and function description
>sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 Back     alignment and function description
>sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 Back     alignment and function description
>sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 Back     alignment and function description
>sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
147860139 322 hypothetical protein VITISV_039591 [Viti 0.949 0.409 0.549 3e-29
297737915173 unnamed protein product [Vitis vinifera] 0.971 0.780 0.535 8e-29
357486703135 RING finger protein [Medicago truncatula 0.956 0.985 0.471 1e-27
359473022172 PREDICTED: RING-H2 finger protein ATL47- 0.949 0.767 0.5 2e-26
357486705137 E3 ubiquitin-protein ligase [Medicago tr 0.956 0.970 0.464 2e-26
357486701153 E3 ubiquitin-protein ligase [Medicago tr 0.956 0.869 0.457 3e-26
255546935137 conserved hypothetical protein [Ricinus 0.978 0.992 0.45 1e-25
297737919174 unnamed protein product [Vitis vinifera] 0.971 0.775 0.5 5e-25
388514843136 unknown [Medicago truncatula] 0.942 0.963 0.438 5e-25
147860138 350 hypothetical protein VITISV_039590 [Viti 0.949 0.377 0.514 1e-24
>gi|147860139|emb|CAN82925.1| hypothetical protein VITISV_039591 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 95/142 (66%), Gaps = 10/142 (7%)

Query: 1   MLSYIVSVSTHLKWACKFLIQN-SLFGHRIGMHGVPAEIGEELLTVGRYERNNDNEAVE- 58
           M++YIV   TH KWA  FL    S   + +GM     E GEE L +G Y+    +E  E 
Sbjct: 188 MVNYIVLPITHFKWAWSFLFHRFSFASYTLGM----LENGEEELRIGHYKVKLGSEESEE 243

Query: 59  -CAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAVVENGIE 117
            CAVCLC+IEEG+EI +LRCDH+FH+VCLD+WV  ++R TCPLCRD L   RAV E G E
Sbjct: 244 ECAVCLCKIEEGDEISDLRCDHLFHKVCLDRWVQ-YKRSTCPLCRDSLAPCRAVAELGQE 302

Query: 118 ILVFKRFCYLSSSSDRDSWWLR 139
           +LVF RFC   SS DR+SWWLR
Sbjct: 303 VLVF-RFCSF-SSGDRNSWWLR 322

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737915|emb|CBI27116.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486703|ref|XP_003613639.1| RING finger protein [Medicago truncatula] gi|355514974|gb|AES96597.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|359473022|ref|XP_003631232.1| PREDICTED: RING-H2 finger protein ATL47-like [Vitis vinifera] gi|297737916|emb|CBI27117.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357486705|ref|XP_003613640.1| E3 ubiquitin-protein ligase [Medicago truncatula] gi|355514975|gb|AES96598.1| E3 ubiquitin-protein ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357486701|ref|XP_003613638.1| E3 ubiquitin-protein ligase [Medicago truncatula] gi|355514973|gb|AES96596.1| E3 ubiquitin-protein ligase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255546935|ref|XP_002514525.1| conserved hypothetical protein [Ricinus communis] gi|223546129|gb|EEF47631.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297737919|emb|CBI27120.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388514843|gb|AFK45483.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147860138|emb|CAN82924.1| hypothetical protein VITISV_039590 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
UNIPROTKB|F8WCD0398 RNF149 "E3 ubiquitin-protein l 0.762 0.266 0.344 1.4e-08
UNIPROTKB|Q8NC42400 RNF149 "E3 ubiquitin-protein l 0.762 0.265 0.344 1.4e-08
UNIPROTKB|F1PRN3238 RNF149 "Uncharacterized protei 0.762 0.445 0.336 2.3e-08
UNIPROTKB|F1P4V3419 RNF149 "Uncharacterized protei 0.762 0.252 0.327 5.5e-08
UNIPROTKB|F1STG1392 LOC100519085 "Uncharacterized 0.812 0.288 0.320 1.3e-07
MGI|MGI:2677438394 Rnf149 "ring finger protein 14 0.762 0.269 0.327 1.3e-07
RGD|1308460394 Rnf149 "ring finger protein 14 0.762 0.269 0.327 1.3e-07
UNIPROTKB|E1BHK5393 RNF149 "Uncharacterized protei 0.762 0.269 0.318 2.8e-07
TAIR|locus:2195498166 AT1G63840 [Arabidopsis thalian 0.482 0.403 0.382 4.8e-07
TAIR|locus:2177931176 AT5G41400 [Arabidopsis thalian 0.273 0.215 0.487 2.1e-06
UNIPROTKB|F8WCD0 RNF149 "E3 ubiquitin-protein ligase RNF149" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 1.4e-08, P = 1.4e-08
 Identities = 40/116 (34%), Positives = 57/116 (49%)

Query:     2 LSYIVSVSTHLKWACKFLIQNSLF-GHRIGMHGVPAE----IGEELL-TVGRYERNNDNE 55
             +++I  +   L W   + IQ  L+ G +IG      E    IG+ LL TV   E+  D +
Sbjct:   206 IAFITMMIISLAWLIFYYIQRFLYTGSQIGSQSHRKETKKVIGQLLLHTVKHGEKGIDVD 265

Query:    56 AVECAVXXXXXXXXXXXXXXXCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRAV 111
             A  CAV               C HIFHR+C+D W+ L  R TCP+C+  LD  +A+
Sbjct:   266 AENCAVCIENFKVKDIIRILPCKHIFHRICIDPWL-LDHR-TCPMCK--LDVIKAL 317
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|Q8NC42 RNF149 "E3 ubiquitin-protein ligase RNF149" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRN3 RNF149 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P4V3 RNF149 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1STG1 LOC100519085 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2677438 Rnf149 "ring finger protein 149" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308460 Rnf149 "ring finger protein 149" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHK5 RNF149 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2195498 AT1G63840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177931 AT5G41400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00101265
hypothetical protein (133 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-11
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-09
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-07
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 1e-05
smart0018440 smart00184, RING, Ring finger 8e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-04
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 0.003
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 54.3 bits (131), Expect = 3e-11
 Identities = 25/45 (55%), Positives = 30/45 (66%), Gaps = 2/45 (4%)

Query: 58  ECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCR 102
           EC +CL E E GEE+  L C H+FH+ CLD+W  L    TCPLCR
Sbjct: 2   ECPICLDEFEPGEEVVVLPCGHVFHKECLDKW--LRSSNTCPLCR 44

Length = 46
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.79
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.67
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.51
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.49
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.46
PHA02929238 N1R/p28-like protein; Provisional 99.44
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.38
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 99.35
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.32
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.23
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.22
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.21
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.19
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.16
PHA02926242 zinc finger-like protein; Provisional 99.13
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 99.1
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.07
PF1463444 zf-RING_5: zinc-RING finger domain 99.05
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.03
KOG149384 consensus Anaphase-promoting complex (APC), subuni 99.02
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.0
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.96
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.89
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.87
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.86
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.79
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.72
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.67
COG52191525 Uncharacterized conserved protein, contains RING Z 98.59
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.57
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.51
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.49
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.45
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.44
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.41
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.4
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.32
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.28
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.16
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.03
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.99
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.98
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.94
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.88
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.88
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.88
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.77
PHA02825162 LAP/PHD finger-like protein; Provisional 97.75
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.69
KOG1941518 consensus Acetylcholine receptor-associated protei 97.63
PHA02862156 5L protein; Provisional 97.62
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 97.58
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 97.49
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.46
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.38
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 97.34
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.32
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.26
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.01
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.98
KOG2660 331 consensus Locus-specific chromosome binding protei 96.98
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.89
PF04641260 Rtf2: Rtf2 RING-finger 96.84
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.81
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.77
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.69
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.64
KOG4739 233 consensus Uncharacterized protein involved in syna 96.58
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 96.57
COG5152259 Uncharacterized conserved protein, contains RING a 96.52
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.46
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.35
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.25
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.17
PHA03096284 p28-like protein; Provisional 95.73
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.72
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.58
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.52
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 95.4
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.99
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 94.9
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 94.9
KOG1609 323 consensus Protein involved in mRNA turnover and st 94.82
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.82
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.61
KOG1940276 consensus Zn-finger protein [General function pred 94.6
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 94.58
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.25
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.15
COG5222427 Uncharacterized conserved protein, contains RING Z 93.68
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 93.67
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.64
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.31
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 92.62
KOG03091081 consensus Conserved WD40 repeat-containing protein 92.38
KOG0298 1394 consensus DEAD box-containing helicase-like transc 91.51
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 91.24
KOG3053 293 consensus Uncharacterized conserved protein [Funct 90.86
KOG3899381 consensus Uncharacterized conserved protein [Funct 90.69
KOG3113 293 consensus Uncharacterized conserved protein [Funct 90.46
KOG3002 299 consensus Zn finger protein [General function pred 90.4
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 89.98
KOG4367 699 consensus Predicted Zn-finger protein [Function un 89.77
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.38
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 89.06
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 88.86
KOG4718235 consensus Non-SMC (structural maintenance of chrom 87.56
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 86.74
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.27
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 85.6
KOG3005276 consensus GIY-YIG type nuclease [General function 84.33
KOG1829580 consensus Uncharacterized conserved protein, conta 84.08
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 84.04
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 82.74
KOG0825 1134 consensus PHD Zn-finger protein [General function 80.71
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.79  E-value=2e-19  Score=138.79  Aligned_cols=85  Identities=24%  Similarity=0.547  Sum_probs=61.4

Q ss_pred             CCCCChhhhhhhhhccccccCCCCCCcccccccccccCCCeeEEcCCCCcccHHHHHHHHccCCcccccccccccccCcc
Q 038790           31 MHGVPAEIGEELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRRA  110 (139)
Q Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~l~C~H~fh~~Ci~~Wl~~~~~~~CP~Cr~~~~~~~~  110 (139)
                      ...........++...+...........|+||+|+|..|+++++|||+|.||..||++||.+ .+..||+||+.......
T Consensus       204 ~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~-~r~~CPvCK~di~~~~~  282 (348)
T KOG4628|consen  204 RNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQ-TRTFCPVCKRDIRTDSG  282 (348)
T ss_pred             hhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhh-cCccCCCCCCcCCCCCC
Confidence            33444444555555555544333333699999999999999999999999999999999982 34669999998765555


Q ss_pred             cccCCc
Q 038790          111 VVENGI  116 (139)
Q Consensus       111 ~~~~~~  116 (139)
                      .....+
T Consensus       283 ~~~~~e  288 (348)
T KOG4628|consen  283 SEPVSE  288 (348)
T ss_pred             CCCccC
Confidence            444333

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3005 consensus GIY-YIG type nuclease [General function prediction only] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-18
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-18
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 4e-18
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-17
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-17
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 5e-12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 5e-10
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-09
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 4e-08
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 5e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 6e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-06
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 4e-06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-06
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 6e-06
3nw0_A238 Non-structural maintenance of chromosomes element 1e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 2e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 7e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-04
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-04
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 4e-04
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-04
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 8e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 8e-04
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
 Score = 73.2 bits (180), Expect = 2e-18
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 49  ERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCR 102
           E   ++   +C +CL  +EEGE++R L C H+FH+VC+DQW  L     CP+CR
Sbjct: 7   EGTEEDTEEKCTICLSILEEGEDVRRLPCMHLFHQVCVDQW--LITNKKCPICR 58
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.74
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.74
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.68
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.67
2ect_A78 Ring finger protein 126; metal binding protein, st 99.67
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.66
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.64
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.61
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.59
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.57
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.57
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.55
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.54
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.54
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.54
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.52
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.51
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.47
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.46
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.45
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.43
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.42
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.41
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.41
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.39
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.39
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.39
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.38
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.37
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.37
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.37
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.36
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.36
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.34
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.32
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.31
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.3
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.29
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.27
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.27
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.25
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.24
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.24
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.21
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.19
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.18
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.17
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.16
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.14
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.12
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.1
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.09
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.08
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.04
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.03
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 99.01
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.0
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.95
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.93
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.9
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.89
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.89
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.83
2ea5_A68 Cell growth regulator with ring finger domain prot 98.69
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.67
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.65
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.62
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.59
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.42
3nw0_A238 Non-structural maintenance of chromosomes element 98.36
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 96.54
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.93
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.18
1we9_A64 PHD finger family protein; structural genomics, PH 92.75
2k16_A75 Transcription initiation factor TFIID subunit 3; p 92.52
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 90.85
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 90.8
2yt5_A66 Metal-response element-binding transcription facto 90.64
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 89.69
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 89.53
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 89.17
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 89.17
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 88.85
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 88.8
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 88.65
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 87.78
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 86.25
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 86.04
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 85.48
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 85.37
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 84.78
1wee_A72 PHD finger family protein; structural genomics, PH 84.55
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 84.44
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 84.38
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.18
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 83.52
1wem_A76 Death associated transcription factor 1; structura 82.95
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 82.84
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 82.66
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 81.72
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 81.47
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 80.79
2d8v_A67 Zinc finger FYVE domain-containing protein 19; zfy 80.69
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 80.18
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=7.4e-19  Score=108.05  Aligned_cols=67  Identities=33%  Similarity=0.766  Sum_probs=55.1

Q ss_pred             hhhhccccccCCCCCCcccccccccccCCCeeEEcCCCCcccHHHHHHHHccCCcccccccccccccCc
Q 038790           41 ELLTVGRYERNNDNEAVECAVCLCEIEEGEEIRELRCDHIFHRVCLDQWVGLFRRVTCPLCRDFLDSRR  109 (139)
Q Consensus        41 ~~~~~~~~~~~~~~~~~~C~ICl~~~~~~~~~~~l~C~H~fh~~Ci~~Wl~~~~~~~CP~Cr~~~~~~~  109 (139)
                      .++...........++..|+||++++..++.++.++|+|.||..||..|++  .+.+||+||+++.+..
T Consensus         8 ~lp~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~w~~--~~~~CP~Cr~~~~~~~   74 (75)
T 1x4j_A            8 QLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK--ANRTCPICRADSGPSS   74 (75)
T ss_dssp             SCCCEEBCSSSCSSSCCEETTTTEECCBTCEEEEETTTEEEETTHHHHHHH--HCSSCTTTCCCCCCCC
T ss_pred             hCCcEEecCccccCCCCCCeECCcccCCCCeEEEECCCCHhHHHHHHHHHH--cCCcCcCcCCcCCCCC
Confidence            344444444445567889999999999888888999999999999999998  7889999999887754
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2d8v_A Zinc finger FYVE domain-containing protein 19; zfyve19, ZF- B_BOX, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.43.1.1 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 7e-12
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 8e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 8e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 2e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-06
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-06
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 5e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 6e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 54.5 bits (131), Expect = 7e-12
 Identities = 29/49 (59%), Positives = 33/49 (67%), Gaps = 3/49 (6%)

Query: 55  EAVECAVCLCEIEEGEEIREL-RCDHIFHRVCLDQWVGLFRRVTCPLCR 102
           + VECAVCL E+E+GEE R L RC H FH  C+D W  L    TCPLCR
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMW--LGSHSTCPLCR 50
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.76
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.64
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.62
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.59
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.59
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.57
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.52
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.42
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.37
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.37
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.33
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.29
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.24
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.24
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.21
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.94
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.9
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 95.79
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.54
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.45
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 91.99
d1wema_76 Death associated transcription factor 1, Datf1 (DI 91.46
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.0
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 90.43
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 89.88
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 86.49
d2co8a236 Nedd9 interacting protein with calponin homology, 85.56
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 85.23
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 82.89
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 82.36
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 80.93
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 80.44
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.76  E-value=1.6e-19  Score=103.61  Aligned_cols=51  Identities=57%  Similarity=1.162  Sum_probs=45.3

Q ss_pred             CCCcccccccccccCCCeeEEc-CCCCcccHHHHHHHHccCCcccccccccccc
Q 038790           54 NEAVECAVCLCEIEEGEEIREL-RCDHIFHRVCLDQWVGLFRRVTCPLCRDFLD  106 (139)
Q Consensus        54 ~~~~~C~ICl~~~~~~~~~~~l-~C~H~fh~~Ci~~Wl~~~~~~~CP~Cr~~~~  106 (139)
                      +++.+|+||+++|..++.+..+ +|+|.||..||..|++  .+.+||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~--~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLG--SHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTT--TCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHH--hCCcCCCCCCEeE
Confidence            4567899999999998888777 6999999999999998  8899999999763
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure