Citrus Sinensis ID: 038927

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MAFTKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDPNIVNISYPVYVERVVDRLKYNVTLEFYCGCAGGPRPS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccccccccHHHHHHHHccccEEEccEEEEEEcccccEEEEEcHHHHHcccccccccccccccccEEEEcccccEEEEccccccccccEEEEEEcccccccccccccccccccccccccccEEHHHHHccccccEEHHHHcccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEccccccEEccccccccHHHHHHHHcccEEEEccEEEEEEccccccEEEEcHHHHHHccccccccEEEcccccEEEEccccEEEEEccccccccccEEEEEEEccccccccccccccccccccccccccEEEEEEEEHEEEEEEHHHccccccccccc
MAFTKMIQAAFLLLMATAVLRVdgiidqekvvslegvgfskthkvewrkpnpeegmdvdYYKKWassrnfttgdtILFEYTNRTDNVKLVQRREFEscnrrtrpikafntgshsihlkfrshyfrsdfpghyeagqklevvttdgslprtptnlphlhvdpnivnisypVYVERVVDRLKYNVTLefycgcaggprps
MAFTKMIQAAFLLLMATAVLRVDGIIDQEkvvslegvgfskthkvewrkpnpeegmdVDYYKKWASSRNFTTGDTILfeytnrtdnvklvqrrefescnrrtrpikafntgshsihLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPtnlphlhvdpnivNISYPVYVERVVDRLKYNVTLEfycgcaggprps
MAFTKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDPNIVNISYPVYVERVVDRLKYNVTLEFYCGCAGGPRPS
***TKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRK*****GMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDPNIVNISYPVYVERVVDRLKYNVTLEFYCGCA******
*************LMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEV******************************YVERVVDRLKYNVTLEFYCGCAGGP***
MAFTKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDPNIVNISYPVYVERVVDRLKYNVTLEFYCGCAGGPRPS
**FTKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDG********************ISYPVYVERVVDRLKYNVTLEFYCGCAG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFTKMIQAAFLLLMATAVLRVDGIIDQEKVVSLEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKFRSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDPNIVNISYPVYVERVVDRLKYNVTLEFYCGCAGGPRPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query198 2.2.26 [Sep-21-2011]
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.429 0.787 0.425 2e-12
P00302107 Stellacyanin OS=Toxicoden N/A no 0.434 0.803 0.409 2e-11
P93328180 Early nodulin-16 OS=Medic N/A no 0.474 0.522 0.306 2e-07
Q41001189 Blue copper protein OS=Pi N/A no 0.398 0.417 0.345 2e-07
P0030396 Basic blue protein OS=Cuc N/A no 0.393 0.812 0.329 9e-07
P93329268 Early nodulin-20 OS=Medic N/A no 0.464 0.343 0.302 2e-06
Q9SK27182 Early nodulin-like protei no no 0.409 0.445 0.349 3e-06
Q9T076 349 Early nodulin-like protei no no 0.671 0.381 0.281 4e-06
Q07488196 Blue copper protein OS=Ar no no 0.449 0.454 0.291 9e-06
Q02917187 Early nodulin-55-2 OS=Gly no no 0.580 0.614 0.318 1e-05
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 2/87 (2%)

Query: 61  YKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKF- 119
           Y KWASS  F  GD++LF Y N+  NV  V + +F+SCN  + P  ++ +G+ SI LK  
Sbjct: 20  YAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCN-SSSPAASYTSGADSIPLKRP 78

Query: 120 RSHYFRSDFPGHYEAGQKLEVVTTDGS 146
            + YF    PGH + GQK+E+    GS
Sbjct: 79  GTFYFLCGIPGHCQLGQKVEIKVDPGS 105

Cucurbita pepo (taxid: 3663)
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|P93329|NO20_MEDTR Early nodulin-20 OS=Medicago truncatula GN=ENOD20 PE=3 SV=1 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q02917|NO552_SOYBN Early nodulin-55-2 OS=Glycine max GN=ENOD55-2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
357480825182 Early nodulin-like protein [Medicago tru 0.505 0.549 0.392 6e-14
224161493147 predicted protein [Populus trichocarpa] 0.484 0.653 0.387 4e-13
224064047126 predicted protein [Populus trichocarpa] 0.484 0.761 0.387 5e-13
224055243143 predicted protein [Populus trichocarpa] 0.404 0.559 0.421 4e-12
297817658174 hypothetical protein ARALYDRAFT_907902 [ 0.404 0.459 0.475 4e-12
224089310107 predicted protein [Populus trichocarpa] 0.414 0.766 0.404 5e-12
224063999143 predicted protein [Populus trichocarpa] 0.444 0.615 0.395 5e-12
225437012240 PREDICTED: early nodulin-like protein 1 0.398 0.329 0.444 5e-12
224064007143 predicted protein [Populus trichocarpa] 0.404 0.559 0.421 6e-12
357444289185 Blue copper protein [Medicago truncatula 0.398 0.427 0.432 6e-12
>gi|357480825|ref|XP_003610698.1| Early nodulin-like protein [Medicago truncatula] gi|355512033|gb|AES93656.1| Early nodulin-like protein [Medicago truncatula] gi|388518523|gb|AFK47323.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 61  YKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHL-KF 119
           YKKWA+++NF  GDTI+FEY ++  NV  V    ++SCN  + P+  F+TG  SI +  +
Sbjct: 42  YKKWAATKNFQIGDTIVFEYNSQFHNVMRVTHAMYKSCN-GSSPLTTFSTGKDSIKITNY 100

Query: 120 RSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTPTNLPHLHVDP 161
             H+F    PGH +AGQK+++   + S    PT  P     P
Sbjct: 101 GHHFFLCGIPGHCQAGQKVDINVLNVSASAAPTKSPSALASP 142

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224161493|ref|XP_002338337.1| predicted protein [Populus trichocarpa] gi|222871932|gb|EEF09063.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064047|ref|XP_002301365.1| predicted protein [Populus trichocarpa] gi|222843091|gb|EEE80638.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224055243|ref|XP_002298440.1| predicted protein [Populus trichocarpa] gi|222845698|gb|EEE83245.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297817658|ref|XP_002876712.1| hypothetical protein ARALYDRAFT_907902 [Arabidopsis lyrata subsp. lyrata] gi|297322550|gb|EFH52971.1| hypothetical protein ARALYDRAFT_907902 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224089310|ref|XP_002308685.1| predicted protein [Populus trichocarpa] gi|222854661|gb|EEE92208.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224063999|ref|XP_002301341.1| predicted protein [Populus trichocarpa] gi|222843067|gb|EEE80614.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225437012|ref|XP_002272612.1| PREDICTED: early nodulin-like protein 1 [Vitis vinifera] gi|296085195|emb|CBI28690.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224064007|ref|XP_002301345.1| predicted protein [Populus trichocarpa] gi|222843071|gb|EEE80618.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357444289|ref|XP_003592422.1| Blue copper protein [Medicago truncatula] gi|355481470|gb|AES62673.1| Blue copper protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query198
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.414 0.438 0.458 2.1e-13
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.606 0.582 0.373 1.2e-12
TAIR|locus:2174428182 ENODL10 "early nodulin-like pr 0.696 0.758 0.296 2.8e-11
TAIR|locus:1009023108369 AT1G45063 [Arabidopsis thalian 0.464 0.249 0.406 8e-11
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.595 0.59 0.315 4.1e-10
TAIR|locus:2154679 370 ENODL1 "early nodulin-like pro 0.530 0.283 0.336 1e-09
TAIR|locus:4010713954145 ENODL21 "early nodulin-like pr 0.545 0.744 0.316 7.6e-09
TAIR|locus:2118691190 ENODL12 "early nodulin-like pr 0.388 0.405 0.341 1.1e-08
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.459 0.514 0.329 1.2e-08
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.454 0.494 0.346 1.3e-08
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 2.1e-13, P = 2.1e-13
 Identities = 39/85 (45%), Positives = 51/85 (60%)

Query:    57 DVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIH 116
             +VDY K WAS++ F  GDT+LFEY  +  NV  V    + SCN  ++PI  F TG+ SI 
Sbjct:    37 NVDY-KLWASTKTFHIGDTVLFEYNPQFHNVMRVTHPMYRSCNT-SKPISTFTTGNDSIT 94

Query:   117 LKFRSH-YFRSDFPGHYEAGQKLEV 140
             L    H +F    PGH  AGQKL++
Sbjct:    95 LTNHGHHFFFCGVPGHCLAGQKLDL 119
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0042546 "cell wall biogenesis" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174428 ENODL10 "early nodulin-like protein 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023108 AT1G45063 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154679 ENODL1 "early nodulin-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713954 ENODL21 "early nodulin-like protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118691 ENODL12 "early nodulin-like protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 6e-19
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 77.0 bits (190), Expect = 6e-19
 Identities = 32/80 (40%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 58  VDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHL 117
              Y  WAS + F  GDT++F Y     NV  V + ++ESCN  ++PI+ + TG+  I L
Sbjct: 6   NADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCN-TSKPIRTYTTGNDIIPL 64

Query: 118 -KFRSHYFRSDFPGHYEAGQ 136
            K   HYF    PGH + GQ
Sbjct: 65  TKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 198
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.19
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.11
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.9
COG3794128 PetE Plastocyanin [Energy production and conversio 97.71
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.69
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.54
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.24
TIGR0265783 amicyanin amicyanin. Members of this family are am 96.2
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.5
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 94.88
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 93.29
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 91.05
COG4454158 Uncharacterized copper-binding protein [Inorganic 91.04
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 89.7
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 82.41
PLN02604 566 oxidoreductase 81.84
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.2e-42  Score=281.95  Aligned_cols=108  Identities=21%  Similarity=0.419  Sum_probs=99.4

Q ss_pred             eeeeEEEecCCCCCCCCCCCCCCCcchhhccccCCceEeCCEEEEEEcCCCCceEEEcccccccccCCCCCccccCCCCe
Q 038927           34 LEGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSH  113 (198)
Q Consensus        34 ~~a~~~~VGg~~GW~~p~~~~~~~~~YYt~WAs~~~F~VGDtLvF~Y~~~~HsV~~V~~~~Y~~C~~~s~pi~~~~sG~~  113 (198)
                      +.+++|+|||+.||+.       +.|| ++||++++|+|||+|+|+|++++|||+||+|++|++|+. ++|+..+++|++
T Consensus        18 ~~a~~~~VGd~~GW~~-------~~~Y-~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~-~~pi~~~tsG~d   88 (167)
T PLN03148         18 TTATDHIVGANKGWNP-------GINY-TLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTT-EGAAGNWTSGKD   88 (167)
T ss_pred             ccceEEEeCCCCCcCC-------CCCh-hHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccC-CCCcceecCCCc
Confidence            5789999999999985       3676 999999999999999999999999999999999999999 999999999999


Q ss_pred             EEEeCC-ccEEEEcCCCCCCCCCCeEEEEecCCCCCCCC
Q 038927          114 SIHLKF-RSHYFRSDFPGHYEAGQKLEVVTTDGSLPRTP  151 (198)
Q Consensus       114 ~v~L~~-G~~YFICgv~~HC~~GmKl~I~V~~~~~Papp  151 (198)
                      .|+|++ |+|||||+ .+||++||||+|+|.+.+||+||
T Consensus        89 ~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~~~pp~~  126 (167)
T PLN03148         89 FIPLNKAKRYYFICG-NGQCFNGMKVTILVHPLPPPPSH  126 (167)
T ss_pred             EEEecCCccEEEEcC-CCccccCCEEEEEEcCCCCCCCC
Confidence            999999 99999999 69999999999999876544433

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 2e-13
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 7e-08
1f56_A91 Spinach Plantacyanin Length = 91 2e-06
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 7e-06
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/87 (42%), Positives = 52/87 (59%), Gaps = 2/87 (2%)
Query: 61  YKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHLKF- 119
           Y KWASS  F  GD++LF Y N+  NV  V + +F+SCN  + P  ++ +G+ SI LK  
Sbjct: 21  YAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCN-SSSPAASYTSGADSIPLKRP 79
Query: 120 RSHYFRSDFPGHYEAGQKLEVVTTDGS 146
            + YF    PGH + GQK+E+    GS
Sbjct: 80  GTFYFLCGIPGHCQLGQKVEIKVDPGS 106
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query198
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 3e-21
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 4e-21
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 9e-20
1jer_A138 Cucumber stellacyanin; electron transport, copper, 2e-19
2cbp_A96 Cucumber basic protein; electron transport, phytoc 3e-19
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
 Score = 83.4 bits (206), Expect = 3e-21
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 12/118 (10%)

Query: 41  KTHKV----EWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFE 96
           + + V    EW++P+     D  +Y  WA+ + F  GD + F++     +V +V +  F+
Sbjct: 2   EDYDVGGDMEWKRPS-----DPKFYITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFD 56

Query: 97  SCNRRTRPIKAFNTGSHSIHL-KFRSHYFRSDFPGHYEAGQKLEV-VTTDGSLPRTPT 152
           +C  +  PI    T    I L      Y+      H   GQKL + V   G      T
Sbjct: 57  NCK-KENPISHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINVVGAGGAGGGAT 113
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.17
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.96
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.96
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.66
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.66
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.65
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.62
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.61
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.57
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.49
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.49
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.46
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.45
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.43
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.43
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.43
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.29
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.7
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.7
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.69
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.67
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.66
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.59
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.55
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.5
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.35
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.34
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.16
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.11
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.83
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.8
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.34
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 95.99
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 95.65
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 95.25
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 94.31
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 94.26
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 94.16
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 92.51
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 92.06
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 86.82
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 81.88
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=2.6e-41  Score=270.37  Aligned_cols=107  Identities=22%  Similarity=0.439  Sum_probs=99.6

Q ss_pred             eeeEEEecCCCCCCCCCCCCCCCcchhhccccCCceEeCCEEEEEEcCCCCceEEE-cccccccccCCCCCccccCCCCe
Q 038927           35 EGVGFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLV-QRREFESCNRRTRPIKAFNTGSH  113 (198)
Q Consensus        35 ~a~~~~VGg~~GW~~p~~~~~~~~~YYt~WAs~~~F~VGDtLvF~Y~~~~HsV~~V-~~~~Y~~C~~~s~pi~~~~sG~~  113 (198)
                      +|++|+|||+.||+++++    ..+| ++||++++|+|||+|+|+|.++.|+|+|| +|++|+.|+. ++++..+++|++
T Consensus         2 ~a~~~~VGg~~GW~~~~~----~~~Y-~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~-s~p~~~~~~G~~   75 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSS----PNFY-SQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNF-VNSDNDVERTSP   75 (138)
T ss_dssp             CCCEEETTGGGCSSCCSS----TTHH-HHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCC-TTSCCCCCCCSC
T ss_pred             CceEEEECCcCcCcCCCC----ccch-hhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCC-CCccccccCCCe
Confidence            578999999999999753    3566 99999999999999999999999999999 9999999999 999999999999


Q ss_pred             EEEe-CC-ccEEEEcCCCCCCCCCCeEEEEecCCCC
Q 038927          114 SIHL-KF-RSHYFRSDFPGHYEAGQKLEVVTTDGSL  147 (198)
Q Consensus       114 ~v~L-~~-G~~YFICgv~~HC~~GmKl~I~V~~~~~  147 (198)
                      .|+| ++ |++||||++++||++||||+|+|.+..+
T Consensus        76 ~v~L~~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~  111 (138)
T 1jer_A           76 VIERLDELGMHYFVCTVGTHCSNGQKLSINVVAANA  111 (138)
T ss_dssp             EEEECCSSEEEEEECCSTTTGGGTCEEEEEEECCC-
T ss_pred             EEEeccCCcCEEEEcCCCCccccCCEEEEEEcCCCC
Confidence            9999 99 9999999999999999999999998774
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 198
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 8e-21
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 3e-20
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 8e-17
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 4e-15
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

 Score = 80.7 bits (199), Expect = 8e-21
 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 2/89 (2%)

Query: 53  EEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGS 112
             G   +    W   + F  GD +LF Y     NV +V +  F +CN      K + +G 
Sbjct: 8   SGGWTFNTES-WPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCN-TPAGAKVYTSGR 65

Query: 113 HSIHLKFRSHYFRSDFPGHYEAGQKLEVV 141
             I L     YF  +FPGH ++G K+ V 
Sbjct: 66  DQIKLPKGQSYFICNFPGHCQSGMKIAVN 94
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query198
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.72
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.7
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.65
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.6
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.53
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.48
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.45
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.43
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.38
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.34
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.32
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.24
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.24
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.19
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.99
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.84
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.32
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.09
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.02
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 96.67
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 96.28
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.13
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.03
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 95.25
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 94.06
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 91.89
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 91.3
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 90.86
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 89.89
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 87.65
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 85.67
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 83.37
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

Probab=100.00  E-value=1.9e-38  Score=238.39  Aligned_cols=95  Identities=28%  Similarity=0.593  Sum_probs=90.6

Q ss_pred             EEEecCCCCCCCCCCCCCCCcchhhccccCCceEeCCEEEEEEcCCCCceEEEcccccccccCCCCCccccCCCCeEEEe
Q 038927           38 GFSKTHKVEWRKPNPEEGMDVDYYKKWASSRNFTTGDTILFEYTNRTDNVKLVQRREFESCNRRTRPIKAFNTGSHSIHL  117 (198)
Q Consensus        38 ~~~VGg~~GW~~p~~~~~~~~~YYt~WAs~~~F~VGDtLvF~Y~~~~HsV~~V~~~~Y~~C~~~s~pi~~~~sG~~~v~L  117 (198)
                      .|+|||+.||+++         | ++||++++|++||+|+|+|+++.|+|+||+|++|++|+. ++|+..+++|++.|+|
T Consensus         2 ~y~VGg~~GW~~~---------y-~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V~~~~Y~~C~~-~~~~~~~~~G~~~v~L   70 (96)
T d2cbpa_           2 VYVVGGSGGWTFN---------T-ESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNT-PAGAKVYTSGRDQIKL   70 (96)
T ss_dssp             EEETTGGGCSCSS---------C-TTTTTTCCBCTTCEEEEECCTTTCCEEEECHHHHHHTCC-CTTCEEECSSEEEEEC
T ss_pred             EEEcCCCCCCCcC---------H-HHHhCCCcEecCCEEEEecCCCCceEEEEChHHcCccCC-CCCcccccCCCeEEEe
Confidence            6999999999873         4 999999999999999999999999999999999999999 9999999999999999


Q ss_pred             CCccEEEEcCCCCCCCCCCeEEEEec
Q 038927          118 KFRSHYFRSDFPGHYEAGQKLEVVTT  143 (198)
Q Consensus       118 ~~G~~YFICgv~~HC~~GmKl~I~V~  143 (198)
                      ++|++||||++++||++||||+|+|.
T Consensus        71 ~~G~~YFic~~~~hC~~G~Kl~V~Vl   96 (96)
T d2cbpa_          71 PKGQSYFICNFPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             CSEEEEEECCSTTTGGGTCEEEEEEC
T ss_pred             CCCCCEEEeCCCCcCcCCCEEEEEEC
Confidence            77999999999999999999999984
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure