Citrus Sinensis ID: 039046

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MHVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNFN
ccccccEEEEEcEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccccccccccccEEEEEcccccEEEEEccc
ccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcEccEEcccccEEEEccEccccccccHHHHccccEcccccEccccccc
MHVGARWIFVISEsewlaaggdrllmNVDNARTYNNNLIQHvkegspkkpgkpiETFIFAIFDENDKQGVEIERhwglfapdkqpkyqvnfn
MHVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQhvkegspkkpgKPIETFIFAIFDENDKQGVEIERHWglfapdkqpkyqvnfn
MHVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNFN
***GARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHV***********IETFIFAIFDENDKQGVEIERHWGLFA************
**VGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDK**VEIERHWGLFAPDKQPKYQVNFN
MHVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNFN
****ARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNFN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPDKQPKYQVNFN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query92 2.2.26 [Sep-21-2011]
P52408350 Glucan endo-1,3-beta-gluc N/A no 0.934 0.245 0.595 7e-26
P36401339 Glucan endo-1,3-beta-gluc N/A no 0.945 0.256 0.584 3e-24
Q03773347 Glucan endo-1,3-beta-gluc no no 0.869 0.230 0.583 4e-23
P49237335 Glucan endo-1,3-beta-gluc N/A no 0.869 0.238 0.590 1e-22
P33157339 Glucan endo-1,3-beta-gluc no no 0.869 0.235 0.590 3e-22
P15797371 Glucan endo-1,3-beta-gluc N/A no 0.913 0.226 0.602 8e-22
P23546370 Glucan endo-1,3-beta-gluc N/A no 0.913 0.227 0.602 8e-22
P27666370 Glucan endo-1,3-beta-gluc N/A no 0.913 0.227 0.602 1e-21
P23431365 Glucan endo-1,3-beta-gluc N/A no 0.913 0.230 0.590 3e-21
P52400337 Glucan endo-1,3-beta-gluc N/A no 0.858 0.234 0.614 5e-21
>sp|P52408|E13B_PRUPE Glucan endo-1,3-beta-glucosidase, basic isoform OS=Prunus persica GN=GNS1 PE=3 SV=1 Back     alignment and function desciption
 Score =  115 bits (288), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 53/89 (59%), Positives = 69/89 (77%), Gaps = 3/89 (3%)

Query: 4   GARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFD 63
           G     VISE+ W +A G      +DNART+ +NLIQHVKEG+P++PG+PIET+IFA+FD
Sbjct: 265 GGSLKVVISETGWPSAAGTA--TTIDNARTFISNLIQHVKEGTPRRPGRPIETYIFAMFD 322

Query: 64  ENDKQGVEIERHWGLFAPDKQPKYQVNFN 92
           EN K   E+E+HWGLF+P KQPKYQ++FN
Sbjct: 323 ENRKTP-ELEKHWGLFSPTKQPKYQISFN 350
Is thought to be an important plant defense-related product against fungal pathogens.
Prunus persica (taxid: 3760)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 3EC: 9
>sp|P36401|E13H_TOBAC Glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q' OS=Nicotiana tabacum PE=1 SV=1 Back     alignment and function description
>sp|Q03773|E13A_SOYBN Glucan endo-1,3-beta-glucosidase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|P49237|E13B_MAIZE Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P33157|E13A_ARATH Glucan endo-1,3-beta-glucosidase, acidic isoform OS=Arabidopsis thaliana GN=BG2 PE=1 SV=2 Back     alignment and function description
>sp|P15797|E13B_TOBAC Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Nicotiana tabacum PE=1 SV=2 Back     alignment and function description
>sp|P23546|E13E_TOBAC Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GGIB50 OS=Nicotiana tabacum PE=1 SV=1 Back     alignment and function description
>sp|P27666|E13F_TOBAC Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform GLB OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P23431|E13B_NICPL Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform OS=Nicotiana plumbaginifolia GN=GN2 PE=3 SV=1 Back     alignment and function description
>sp|P52400|E131_SOLTU Glucan endo-1,3-beta-glucosidase, basic isoform 1 (Fragment) OS=Solanum tuberosum GN=GLUB1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
2274915 336 beta-1,3-glucanase [Citrus sinensis] 0.967 0.264 0.752 2e-33
147667132 337 beta-1,3-glucanase [Citrus unshiu] 0.956 0.261 0.752 2e-31
63333659 336 beta-1,3-glucanase class III [Citrus cle 0.956 0.261 0.722 8e-30
117938450 309 beta-1,3-glucanase [Manihot esculenta] 0.945 0.281 0.651 2e-26
313600351 346 beta-1,3-glucanase [Malus hupehensis] 0.869 0.231 0.674 5e-26
256372804 346 beta-1,3-glucanase [Malus hupehensis] 0.869 0.231 0.662 7e-26
188011481 345 beta-1,3-glucanase [Vitis riparia] 0.869 0.231 0.662 2e-25
225441373 340 PREDICTED: glucan endo-1,3-beta-glucosid 0.934 0.252 0.606 6e-25
16903144 343 beta-1,3-glucanase [Prunus persica] 0.869 0.233 0.662 7e-25
163914215 345 beta 1-3 glucanase [Vitis hybrid cultiva 0.869 0.231 0.650 7e-25
>gi|2274915|emb|CAA03908.1| beta-1,3-glucanase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 73/89 (82%)

Query: 4   GARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFD 63
           G     VISES W  AGGD  L NVDNARTYNNNLIQHVK GSPKKPG+PIET+IFA+FD
Sbjct: 248 GGSLDIVISESGWPTAGGDGALTNVDNARTYNNNLIQHVKRGSPKKPGRPIETYIFAMFD 307

Query: 64  ENDKQGVEIERHWGLFAPDKQPKYQVNFN 92
           EN K G EIERHWGLFAP +QP+YQ+NFN
Sbjct: 308 ENGKTGPEIERHWGLFAPTRQPRYQINFN 336

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147667132|gb|ABQ45848.1| beta-1,3-glucanase [Citrus unshiu] Back     alignment and taxonomy information
>gi|63333659|gb|AAY40462.1| beta-1,3-glucanase class III [Citrus clementina x Citrus reticulata] Back     alignment and taxonomy information
>gi|117938450|gb|ABK58141.1| beta-1,3-glucanase [Manihot esculenta] Back     alignment and taxonomy information
>gi|313600351|gb|ADR71671.1| beta-1,3-glucanase [Malus hupehensis] Back     alignment and taxonomy information
>gi|256372804|gb|ACU78080.1| beta-1,3-glucanase [Malus hupehensis] Back     alignment and taxonomy information
>gi|188011481|gb|ACD45060.1| beta-1,3-glucanase [Vitis riparia] Back     alignment and taxonomy information
>gi|225441373|ref|XP_002277446.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera] Back     alignment and taxonomy information
>gi|16903144|gb|AAL30426.1|AF435089_1 beta-1,3-glucanase [Prunus persica] Back     alignment and taxonomy information
>gi|163914215|dbj|BAF95876.1| beta 1-3 glucanase [Vitis hybrid cultivar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
TAIR|locus:2082518341 BG3 ""beta-1,3-glucanase 3"" [ 0.880 0.237 0.650 2e-24
TAIR|locus:2082568340 BG1 ""beta-1,3-glucanase 1"" [ 0.934 0.252 0.550 7.8e-23
TAIR|locus:2082543339 BGL2 ""beta-1,3-glucanase 2"" 0.869 0.235 0.590 5.5e-22
TAIR|locus:2130329344 AT4G16260 [Arabidopsis thalian 0.869 0.232 0.482 7.3e-17
TAIR|locus:2164991 506 AT5G56590 [Arabidopsis thalian 0.891 0.162 0.418 1.6e-15
TAIR|locus:2129376 478 MEE48 "maternal effect embryo 0.880 0.169 0.453 2.2e-14
TAIR|locus:2139519 504 AT4G34480 [Arabidopsis thalian 0.869 0.158 0.445 1.1e-13
TAIR|locus:2042604 503 AT2G16230 [Arabidopsis thalian 0.869 0.159 0.421 4.8e-13
TAIR|locus:2095228 476 AT3G23770 [Arabidopsis thalian 0.891 0.172 0.425 1.2e-12
TAIR|locus:2065403 501 AT2G01630 [Arabidopsis thalian 0.847 0.155 0.432 1.3e-12
TAIR|locus:2082518 BG3 ""beta-1,3-glucanase 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 279 (103.3 bits), Expect = 2.0e-24, P = 2.0e-24
 Identities = 54/83 (65%), Positives = 62/83 (74%)

Query:    10 VISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQG 69
             V+SES W  AGG      VDNARTY NNLIQ VK GSP++PG+  ET+IFA+FDEN KQG
Sbjct:   261 VVSESGWPTAGG--AATGVDNARTYVNNLIQTVKNGSPRRPGRATETYIFAMFDENSKQG 318

Query:    70 VEIERHWGLFAPDKQPKYQVNFN 92
              E E+ WGLF P+ QPKY VNFN
Sbjct:   319 PETEKFWGLFLPNLQPKYVVNFN 341
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0008810 "cellulase activity" evidence=TAS
GO:0009617 "response to bacterium" evidence=IEP
GO:0048046 "apoplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009814 "defense response, incompatible interaction" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0045088 "regulation of innate immune response" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
TAIR|locus:2082568 BG1 ""beta-1,3-glucanase 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082543 BGL2 ""beta-1,3-glucanase 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130329 AT4G16260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164991 AT5G56590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129376 MEE48 "maternal effect embryo arrest 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139519 AT4G34480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042604 AT2G16230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095228 AT3G23770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065403 AT2G01630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025340001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (340 aa)
(Vitis vinifera)
Predicted Functional Partners:
Oxc
SubName- Full=Chromosome undetermined scaffold_167, whole genome shotgun sequence; (525 aa)
      • 0.481
Chi4D
SubName- Full=Class IV chitinase (Chromosome chr5 scaffold_72, whole genome shotgun sequence); (264 aa)
      • 0.480
PR-4a
SubName- Full=Chromosome chr14 scaffold_190, whole genome shotgun sequence; (143 aa)
      • 0.480
GSVIVG00036466001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (527 aa)
      • 0.480
Chi4C
SubName- Full=Putative uncharacterized protein (Chromosome chr5 scaffold_72, whole genome shotg [...] (267 aa)
      • 0.480
GSVIVG00034623001
SubName- Full=Putative uncharacterized protein (Chromosome chr5 scaffold_72, whole genome shotg [...] (269 aa)
      • 0.480
GSVIVG00029889001
SubName- Full=Chromosome undetermined scaffold_51, whole genome shotgun sequence; (236 aa)
      • 0.480
GSVIVG00001107001
SubName- Full=Chromosome chr2 scaffold_112, whole genome shotgun sequence; (69 aa)
      • 0.480

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
pfam00332310 pfam00332, Glyco_hydro_17, Glycosyl hydrolases fam 3e-39
>gnl|CDD|215863 pfam00332, Glyco_hydro_17, Glycosyl hydrolases family 17 Back     alignment and domain information 
 Score =  131 bits (332), Expect = 3e-39
 Identities = 48/89 (53%), Positives = 65/89 (73%), Gaps = 3/89 (3%)

Query: 4   GARWI-FVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIF 62
           G   +  V+SES W + GG      ++NARTYN NLI HVK+G+PK+PG  IET++FA+F
Sbjct: 224 GGPSVEVVVSESGWPSDGG--FAATIENARTYNQNLINHVKKGTPKRPGWAIETYVFAMF 281

Query: 63  DENDKQGVEIERHWGLFAPDKQPKYQVNF 91
           DEN K G  +E+H+GLF P+KQPKY ++F
Sbjct: 282 DENQKPGESVEKHFGLFYPNKQPKYPIDF 310

Length = 310

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
PF00332310 Glyco_hydro_17: Glycosyl hydrolases family 17; Int 100.0
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 99.85
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 97.11
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 96.8
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 96.52
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 96.02
PRK10150604 beta-D-glucuronidase; Provisional 95.5
TIGR03356427 BGL beta-galactosidase. 95.06
PRK13511469 6-phospho-beta-galactosidase; Provisional 93.71
PLN02814504 beta-glucosidase 93.06
PLN02998497 beta-glucosidase 92.84
PLN02849503 beta-glucosidase 91.76
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 89.87
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 89.4
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 88.24
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 87.08
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 86.34
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 85.95
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 82.47
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 81.79
>PF00332 Glyco_hydro_17: Glycosyl hydrolases family 17; InterPro: IPR000490 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=100.00  E-value=2.6e-34  Score=216.60  Aligned_cols=88  Identities=47%  Similarity=0.854  Sum_probs=66.1

Q ss_pred             CCCCCceEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHHhcCCCCCCCCCceEEEEeeecCCCCCCCCCCCceEeecC
Q 039046            2 HVGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAP   81 (92)
Q Consensus         2 ~~~~~~~vvItEtGWPs~G~~~~~as~~na~~y~~~~~~~~~~gtp~~~~~~~~~y~F~~fDe~~k~~~~~E~~wGlf~~   81 (92)
                      .|+++++|+||||||||+|+.+  |+.+||+.|++++++++.+|||+||+..+++||||||||+||++..+|+|||||++
T Consensus       223 ~g~~~~~vvv~ETGWPs~G~~~--a~~~nA~~~~~nl~~~~~~gt~~~~~~~~~~y~F~~FdE~~K~~~~~E~~wGlf~~  300 (310)
T PF00332_consen  223 LGFPNVPVVVGETGWPSAGDPG--ATPENAQAYNQNLIKHVLKGTPLRPGNGIDVYIFEAFDENWKPGPEVERHWGLFYP  300 (310)
T ss_dssp             TT-TT--EEEEEE---SSSSTT--CSHHHHHHHHHHHHHHCCGBBSSSBSS---EEES-SB--TTSSSSGGGGG--SB-T
T ss_pred             hCCCCceeEEeccccccCCCCC--CCcchhHHHHHHHHHHHhCCCcccCCCCCeEEEEEEecCcCCCCCcccceeeeECC
Confidence            5889999999999999999955  89999999999999999999999999999999999999999998889999999999


Q ss_pred             CCCeeeeecc
Q 039046           82 DKQPKYQVNF   91 (92)
Q Consensus        82 d~~~ky~l~~   91 (92)
                      |++|||+|+|
T Consensus       301 d~~~ky~~~f  310 (310)
T PF00332_consen  301 DGTPKYDLDF  310 (310)
T ss_dssp             TSSBSS----
T ss_pred             CCCeecCCCC
Confidence            9999999987

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 17 GH17 from CAZY comprises enzymes with several known activities; endo-1,3-beta-glucosidase (3.2.1.39 from EC); lichenase (3.2.1.73 from EC); exo-1,3-glucanase (3.2.1.58 from EC). Currently these enzymes have only been found in plants and in fungi. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1AQ0_B 1GHR_A 1GHS_B 2CYG_A 3UR8_A 3UR7_B 3EM5_C 3F55_D.
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
3ur7_A323 Higher-density Crystal Structure Of Potato Endo-1,3 9e-22
4gzi_A323 Active-site Mutant Of Potato Endo-1,3-beta-glucanas 4e-21
3em5_A316 Crystal Structure Of A Native Endo Beta-1,3-Glucana 7e-21
2cyg_A312 Crystal Structure At 1.45- Resolution Of The Major 8e-19
1ghs_A306 The Three-Dimensional Structures Of Two Plant Beta- 7e-18
1aq0_A306 Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space G 5e-16
>pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase Length = 323 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 4/85 (4%)
Query: 10  VISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEG--SPKKPGKPIETFIFAIFDENDK 67
           ++SES W + G       + NARTY  NLI HVK G  +PKKPGK IET++FA+FDEN+K
Sbjct: 233 IVSESGWPSEG--HPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEK 290
Query: 68  QGVEIERHWGLFAPDKQPKYQVNFN 92
           +G   E+H+GLF PD++PKYQ+NFN
Sbjct: 291 KGEASEKHFGLFNPDQRPKYQLNFN 315
>pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose Length = 323 Back     alignment and structure
>pdb|3EM5|A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis Length = 316 Back     alignment and structure
>pdb|2CYG|A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome Length = 312 Back     alignment and structure
>pdb|1GHS|A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities Length = 306 Back     alignment and structure
>pdb|1AQ0|A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 3e-28
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 4e-28
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 2e-27
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 1e-26
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 2e-26
1qzv_F 154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-05
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} PDB: 3f55_A* Length = 316 Back     alignment and structure
 Score =  102 bits (255), Expect = 3e-28
 Identities = 46/84 (54%), Positives = 61/84 (72%), Gaps = 3/84 (3%)

Query: 9   FVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQ 68
            V+SES W +AG        DN RTY +NLIQHVK G+PK+P + IET++FA+FDEN KQ
Sbjct: 236 VVVSESGWPSAGAFA--ATFDNGRTYLSNLIQHVKRGTPKRPKRAIETYLFAMFDENKKQ 293

Query: 69  GVEIERHWGLFAPDKQPKYQVNFN 92
             E+E+H+GLF P+K  KY +NF+
Sbjct: 294 P-EVEKHFGLFFPNKWQKYNLNFS 316
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Length = 306 Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Length = 312 Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Length = 323 Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Length = 306 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 100.0
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 100.0
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 100.0
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 100.0
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 100.0
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.78
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 98.67
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 98.3
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.14
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 97.54
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 97.54
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 97.17
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 96.92
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 96.49
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 96.41
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 96.36
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 96.18
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 95.72
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 95.71
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 95.68
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 95.62
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 95.49
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 95.15
3cmg_A 667 Putative beta-galactosidase; structural genomics, 95.11
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 95.04
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 95.0
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 94.86
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 94.79
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 94.7
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 94.68
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 94.57
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 94.32
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 94.31
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 94.28
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 94.16
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 94.08
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 93.91
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 93.86
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 93.85
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 93.7
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 93.27
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 93.08
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 92.42
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 92.32
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 92.08
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 92.07
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 92.04
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 91.81
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 91.07
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 91.06
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 90.83
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 90.71
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 90.51
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 90.5
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 90.46
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 90.02
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 89.99
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 89.94
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 89.85
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 89.66
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 89.37
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 89.29
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 89.02
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 88.85
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 88.85
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 88.62
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 88.4
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 88.24
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 88.18
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 88.17
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 87.8
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 87.78
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 87.33
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 87.17
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 86.42
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 86.3
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 85.79
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 85.57
3fn9_A 692 Putative beta-galactosidase; structural genomics, 85.02
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 83.57
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 82.43
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 81.85
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 81.01
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 80.92
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
Probab=100.00  E-value=1.9e-36  Score=226.90  Aligned_cols=86  Identities=50%  Similarity=0.842  Sum_probs=82.3

Q ss_pred             CCCCceEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHHhcCCCCCCCCCceEEEEeeecCCCCCCCCCCCceEeecCC
Q 039046            3 VGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPD   82 (92)
Q Consensus         3 ~~~~~~vvItEtGWPs~G~~~~~as~~na~~y~~~~~~~~~~gtp~~~~~~~~~y~F~~fDe~~k~~~~~E~~wGlf~~d   82 (92)
                      |+++++|+|+||||||+|+.  .||++||++|++++++++++|||+||+ .+++|||+||||+||++++.|+|||||++|
T Consensus       221 g~~~~~ivVsEtGWPS~G~~--~as~~na~~y~~~li~~~~~GTP~rp~-~~~~yiF~lfdE~~K~~~~~E~~wGlf~~d  297 (306)
T 1ghs_A          221 GAPAVKVVVSESGWPSAGGF--AASAGNARTYNQGLINHVGGGTPKKRE-ALETYIFAMFNENQKTGDATERSFGLFNPD  297 (306)
T ss_dssp             TCTTCCEEEEEECCCSSSST--TCCHHHHHHHHHHHHTTGGGCCSSCCS-CCCEEEECSBCCTTCCSSGGGGGCCSBCTT
T ss_pred             CCCCCeEEEeeccCCCCCCC--CCCHHHHHHHHHHHHHhcccCCCCCCC-CceEEEEEEECCCCCCCCCCCCeeeeECCC
Confidence            68999999999999999985  499999999999999999899999998 999999999999999988999999999999


Q ss_pred             CCeeeeecc
Q 039046           83 KQPKYQVNF   91 (92)
Q Consensus        83 ~~~ky~l~~   91 (92)
                      ++|||+|+|
T Consensus       298 ~~~ky~l~~  306 (306)
T 1ghs_A          298 KSPAYNIQF  306 (306)
T ss_dssp             SCBSSCCCC
T ss_pred             CCEecCcCC
Confidence            999999986
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 92
d2cyga1312 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana ( 8e-32
d1ghsa_306 c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu 2e-30
d1aq0a_306 c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeu 7e-30
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Length = 312 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Plant beta-glucanases
species: Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]

 Score =  110 bits (277), Expect = 8e-32
 Identities = 44/83 (53%), Positives = 61/83 (73%), Gaps = 2/83 (2%)

Query: 9   FVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQ 68
            V+SES W +AGG     +  NA+TYN NLI+HV  G+P++PGK IE +IF +F+EN K 
Sbjct: 232 VVVSESGWPSAGGGAEA-STSNAQTYNQNLIRHVGGGTPRRPGKEIEAYIFEMFNENQKA 290

Query: 69  GVEIERHWGLFAPDKQPKYQVNF 91
           G  IE+++GLF P+KQP YQ++F
Sbjct: 291 G-GIEQNFGLFYPNKQPVYQISF 312
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Length = 306 Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Length = 306 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 100.0
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 100.0
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 100.0
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.01
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 97.93
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 97.75
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 97.73
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 97.59
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 96.96
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 96.89
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 96.78
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 96.76
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 96.27
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 96.0
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 95.86
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 95.84
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 95.68
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 95.66
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 95.5
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 94.87
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 94.65
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 94.61
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 94.6
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 94.16
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 93.98
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 92.61
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 91.52
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 91.44
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 89.28
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 88.46
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 87.82
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 81.69
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 81.5
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 81.17
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Plant beta-glucanases
species: Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]

Probab=100.00  E-value=1.2e-37  Score=230.34  Aligned_cols=86  Identities=50%  Similarity=0.844  Sum_probs=82.4

Q ss_pred             CCCCceEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHHhcCCCCCCCCCceEEEEeeecCCCCCCCCCCCceEeecCC
Q 039046            3 VGARWIFVISESEWLAAGGDRLLMNVDNARTYNNNLIQHVKEGSPKKPGKPIETFIFAIFDENDKQGVEIERHWGLFAPD   82 (92)
Q Consensus         3 ~~~~~~vvItEtGWPs~G~~~~~as~~na~~y~~~~~~~~~~gtp~~~~~~~~~y~F~~fDe~~k~~~~~E~~wGlf~~d   82 (92)
                      |+++++|||+||||||+|+.+  ||++||++|++++++++++|||+|+. .+++|+||||||+||+++++|+|||||++|
T Consensus       221 ~~~~k~ivI~ETGWPS~G~~~--as~~na~~y~~~l~~~~~~gt~~r~~-~i~~f~FeaFDE~wK~~~~~E~~wGlf~~d  297 (306)
T d1ghsa_         221 GAPAVKVVVSESGWPSAGGFA--ASAGNARTYNQGLINHVGGGTPKKRE-ALETYIFAMFNENQKTGDATERSFGLFNPD  297 (306)
T ss_dssp             TCTTCCEEEEEECCCSSSSTT--CCHHHHHHHHHHHHTTGGGCCSSCCS-CCCEEEECSBCCTTCCSSGGGGGCCSBCTT
T ss_pred             CCCCCceEEcccccccCCCCC--CCHHHHHHHHHHHHHHHhcCCCCCCC-CceEEEEeeeCcCCCCCCCccCccccCCCC
Confidence            689999999999999999866  99999999999999999999999986 899999999999999988999999999999


Q ss_pred             CCeeeeecc
Q 039046           83 KQPKYQVNF   91 (92)
Q Consensus        83 ~~~ky~l~~   91 (92)
                      ++|||+|+|
T Consensus       298 ~~~ky~~~f  306 (306)
T d1ghsa_         298 KSPAYNIQF  306 (306)
T ss_dssp             SCBSSCCCC
T ss_pred             CCEecCCCC
Confidence            999999987
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure