Citrus Sinensis ID: 039054

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYTGLAVGILG
ccccHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHcc
ccccHHHHHHccccccccccHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHHccc
METKFREIeehgnnknvgiSFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLqalspssytgLAVGILG
METKFReieehgnnknvgisfNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFlqalspssytglavgilg
METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYTGLAVGILG
***************NVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQAL****YTGLAV****
***********************VIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYTG**VGILG
********EEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYTGLAVGILG
****************VGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSY*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYTGLAVGILG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q05047 524 Secologanin synthase OS=C N/A no 0.829 0.129 0.647 1e-20
B9X287 542 Cytochrome P450 734A6 OS= no no 0.573 0.086 0.553 7e-12
Q9SHG5 519 Cytochrome P450 72C1 OS=A no no 0.743 0.117 0.492 8e-12
Q69XM6 538 Cytochrome P450 734A4 OS= no no 0.768 0.117 0.397 4e-11
Q6Z6D6 557 Cytochrome P450 734A2 OS= no no 0.621 0.091 0.509 4e-11
O48786 520 Cytochrome P450 734A1 OS= no no 0.597 0.094 0.510 2e-10
Q8LIF2 537 Cytochrome P450 734A5 OS= no no 0.560 0.085 0.5 1e-08
P51871 537 Cytochrome P450 4F6 OS=Ra yes no 0.682 0.104 0.35 0.0001
Q3MID2 524 Leukotriene-B(4) omega-hy no no 0.682 0.106 0.35 0.0003
P51870 526 Cytochrome P450 4F5 OS=Ra no no 0.682 0.106 0.333 0.0003
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 55/68 (80%)

Query: 1   METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERA 60
           +E+  +EI++ GN K+ G+S NDVIE+CK FYFAGQETT VLL WT +LLSKH +WQERA
Sbjct: 299 LESNIQEIQKQGNKKDGGMSINDVIEECKLFYFAGQETTGVLLTWTTILLSKHPEWQERA 358

Query: 61  RKEFLQAL 68
           R+E LQA 
Sbjct: 359 REEVLQAF 366
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|P51871|CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 Back     alignment and function description
>sp|Q3MID2|CP4F3_RAT Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 Back     alignment and function description
>sp|P51870|CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
356542278 290 PREDICTED: LOW QUALITY PROTEIN: secologa 0.939 0.265 0.607 3e-21
84514139 518 cytochrome P450 monooxygenase CYP72A59 [ 0.829 0.131 0.676 4e-21
371940448 518 cytochrome P450 monooxygenase [Medicago 0.829 0.131 0.676 5e-21
359494404 518 PREDICTED: secologanin synthase-like [Vi 0.817 0.129 0.686 6e-21
147795635 518 hypothetical protein VITISV_015554 [Viti 0.829 0.131 0.676 8e-21
359494402 564 PREDICTED: secologanin synthase-like [Vi 0.817 0.118 0.686 2e-20
296082838 417 unnamed protein product [Vitis vinifera] 0.817 0.160 0.686 3e-20
371940464 522 cytochrome P450 monooxygenase [Glycyrrhi 0.817 0.128 0.671 3e-20
359494406 516 PREDICTED: LOW QUALITY PROTEIN: secologa 0.829 0.131 0.676 3e-20
225464373 515 PREDICTED: secologanin synthase isoform 0.829 0.132 0.676 3e-20
>gi|356542278|ref|XP_003539596.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Glycine max] Back     alignment and taxonomy information
 Score =  105 bits (262), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 48/79 (60%), Positives = 63/79 (79%), Gaps = 2/79 (2%)

Query: 1   METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERA 60
           +E+  +EI+EHGNNKNVG++ NDV+E+CK FYFAGQETTSVLL WTM+LLS++ DWQ RA
Sbjct: 121 LESNHKEIQEHGNNKNVGMNLNDVMEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQARA 180

Query: 61  RKEFLQALS--PSSYTGLA 77
           R+E LQ       ++ GL+
Sbjct: 181 REEVLQVFGKQAPNFDGLS 199

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|84514139|gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula] Back     alignment and taxonomy information
>gi|371940448|dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359494404|ref|XP_003634773.1| PREDICTED: secologanin synthase-like [Vitis vinifera] gi|296082831|emb|CBI22132.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795635|emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494402|ref|XP_002269594.2| PREDICTED: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082838|emb|CBI22139.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|371940464|dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis] Back     alignment and taxonomy information
>gi|359494406|ref|XP_003634774.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464373|ref|XP_002265455.1| PREDICTED: secologanin synthase isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
TAIR|locus:2089526 512 CYP72A7 ""cytochrome P450, fam 0.731 0.117 0.609 7.2e-15
TAIR|locus:2089546 508 CYP72A9 ""cytochrome P450, fam 0.646 0.104 0.641 1.5e-14
TAIR|locus:2089521 512 CYP72A15 ""cytochrome P450, fa 0.731 0.117 0.606 2e-14
TAIR|locus:2089586 512 CYP72A11 ""cytochrome P450, fa 0.670 0.107 0.654 2.5e-14
TAIR|locus:2089561 514 CYP72A10 ""cytochrome P450, fa 0.670 0.107 0.672 4.2e-14
TAIR|locus:2089596 512 CYP72A13 ""cytochrome P450, fa 0.670 0.107 0.636 5.3e-14
TAIR|locus:2089621 512 CYP72A14 ""cytochrome P450, fa 0.670 0.107 0.636 1.1e-13
TAIR|locus:2089531 515 CYP72A8 ""cytochrome P450, fam 0.731 0.116 0.516 3.1e-13
UNIPROTKB|B9X287 542 CYP734A6 "Cytochrome P450 734A 0.573 0.086 0.553 1e-10
TAIR|locus:2041399 572 CYP709B2 ""cytochrome P450, fa 0.621 0.089 0.529 1.8e-10
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 7.2e-15, P = 7.2e-15
 Identities = 39/64 (60%), Positives = 48/64 (75%)

Query:     9 EEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQAL 68
             E  GN    G+S  DV+++CK FYFAGQETTSVLL WTM+LLS HQDWQ RAR+E +Q L
Sbjct:   300 ESQGN----GMSVEDVMKECKLFYFAGQETTSVLLVWTMVLLSHHQDWQARAREEVMQVL 355

Query:    69 SPSS 72
               ++
Sbjct:   356 GENN 359
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B9X287 CYP734A6 "Cytochrome P450 734A6" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2041399 CYP709B2 ""cytochrome P450, family 709, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00005885001
SubName- Full=Chromosome undetermined scaffold_160, whole genome shotgun sequence; (374 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 6e-14
pfam00067 461 pfam00067, p450, Cytochrome P450 1e-08
COG2124 411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-05
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-04
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 0.004
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score = 64.5 bits (157), Expect = 6e-14
 Identities = 22/57 (38%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 7   EIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKE 63
           E+E+  +N    ++   ++++CK F+FAG ETT++LL WT++LL+ +  WQ++ R E
Sbjct: 301 EMEKKRSNGF-NLNLQLIMDECKTFFFAGHETTALLLTWTLMLLASNPTWQDKVRAE 356

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
KOG0156 489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.62
KOG0158 499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.48
PLN02971 543 tryptophan N-hydroxylase 99.45
PLN02290 516 cytokinin trans-hydroxylase 99.37
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.36
PLN00168 519 Cytochrome P450; Provisional 99.35
PLN02394 503 trans-cinnamate 4-monooxygenase 99.35
PLN03234 499 cytochrome P450 83B1; Provisional 99.33
KOG0157 497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 99.33
PLN02183 516 ferulate 5-hydroxylase 99.32
PLN02966 502 cytochrome P450 83A1 99.31
PLN02655 466 ent-kaurene oxidase 99.3
PLN02500 490 cytochrome P450 90B1 99.3
PLN03018 534 homomethionine N-hydroxylase 99.3
PLN03112 514 cytochrome P450 family protein; Provisional 99.29
PLN02738 633 carotene beta-ring hydroxylase 99.29
PLN02774 463 brassinosteroid-6-oxidase 99.26
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.26
PLN02302 490 ent-kaurenoic acid oxidase 99.26
PLN02687 517 flavonoid 3'-monooxygenase 99.25
PF00067 463 p450: Cytochrome P450 p450 superfamily signature b 99.23
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.23
PLN02936 489 epsilon-ring hydroxylase 99.22
PTZ00404 482 cytochrome P450; Provisional 99.18
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.18
KOG0159 519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.15
KOG0684 486 consensus Cytochrome P450 [Secondary metabolites b 99.12
PLN03141 452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.11
COG2124 411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.1
PLN02196 463 abscisic acid 8'-hydroxylase 99.04
PLN02987 472 Cytochrome P450, family 90, subfamily A 98.99
PLN02648 480 allene oxide synthase 98.59
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.62  E-value=3.3e-15  Score=94.37  Aligned_cols=76  Identities=14%  Similarity=0.298  Sum_probs=64.5

Q ss_pred             ChhHHHHHHhhcCCCCCCCCHHHHHHHHHHHhHhchhhHHHHHHHHHHHHhhCHHHHHHHHHHHHHhcCCCC-CCcchhh
Q 039054            1 METKFREIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSS-YTGLAVG   79 (82)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~l~~aG~~~~~~~l~~~~~~l~~~p~~~~~~~~Ei~~~~~~~~-~~~~~~~   79 (82)
                      +|++|+.+.+...+.   +++++++..+..+++||.+|++.++.|++.++.+||++++|+|+||++++|..+ ++..+..
T Consensus       267 vD~lL~~~~~~~~~~---~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~  343 (489)
T KOG0156|consen  267 VDALLKLMKEEKAEG---LTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLP  343 (489)
T ss_pred             HHHHHHhhcccccCC---CCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhc
Confidence            366666666544332   999999999999999999999999999999999999999999999999999887 5555443

>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-19
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-18
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-18
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 5e-13
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-11
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-11
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-11
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-11
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 6e-10
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-10
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-09
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 1e-09
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-09
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-09
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 4e-09
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-09
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-08
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-08
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-08
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-08
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-08
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 4e-08
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 5e-08
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-07
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 9e-07
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-06
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-06
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-05
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 6e-04
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
 Score = 78.8 bits (195), Expect = 3e-19
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 9   EEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQAL 68
            E G      +   ++  +   F  AG ETTS LL++ +  L K+    ++A +E  + L
Sbjct: 243 PETGE----PLDDENIRYQIITFLIAGHETTSGLLSFALYFLVKNPHVLQKAAEEAARVL 298
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.47
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.46
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.45
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.45
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.45
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.44
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.43
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.43
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.42
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.42
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.4
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.38
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.38
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.38
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.37
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.33
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.32
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.32
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.31
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.3
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.28
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.21
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.17
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.11
1cpt_A 428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.11
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.07
3lxh_A 421 Cytochrome P450; heme, iron, metal-binding, monoox 99.06
3oft_A 396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.05
2jjn_A 411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.05
3ejb_B 404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.05
2xkr_A 398 CYP142, putative cytochrome P450 142; oxidoreducta 99.04
2cd8_A 436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.04
2wm5_A 435 CYP124, putative cytochrome P450 124; metal-bindin 99.04
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.03
4fb2_A 398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.02
3oo3_A 384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.02
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.02
3ivy_A 433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.02
3aba_A 403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.02
1odo_A 408 Putative cytochrome P450 154A1; P450 monooxygenase 99.01
1n97_A 389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.01
2z3t_A 425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.0
2y5n_A 417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.0
1z8o_A 404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.0
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 98.99
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 98.99
3tkt_A 450 Cytochrome P450; aromatic hydrocarbon binding of P 98.99
2zbx_A 412 Cytochrome P450-SU1; beta prism, heme, iron, metal 98.98
3buj_A 397 CALO2; heme, iron, metal-binding, monooxygenase, o 98.98
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 98.97
2uuq_A 414 CYP130, cytochrome P450 130; iron, heme, monooxyge 98.97
3tyw_A 417 Putative cytochrome P450; P450 monooxygenase, oxid 98.96
3r9b_A 418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 98.94
1s1f_A 406 Putative cytochrome P450; cytochrome P450 oxidored 98.93
2zwu_A 415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 98.93
1gwi_A 411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 98.93
3nc3_A 441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 98.92
2z36_A 413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 98.92
1ued_A 406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 98.92
2xbk_A 404 PIMD protein; epoxidation, oxidoreductase; HET: HE 98.92
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 98.92
3mgx_A 415 Putative P450 monooxygenase; cytochrome P450 oxida 98.9
1jfb_A 404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 98.89
2wiy_A 394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 98.88
2dkk_A 411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 98.87
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 98.87
3rwl_A 426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 98.86
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 98.86
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 98.84
3abb_A 408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 98.82
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 98.8
4dnj_A 412 Putative cytochrome P450; oxidoreductase; HET: HEM 98.8
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 98.73
4dxy_A 417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 98.72
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 98.63
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 98.6
2yjn_B 381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 97.91
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=99.47  E-value=5.9e-13  Score=81.84  Aligned_cols=67  Identities=24%  Similarity=0.343  Sum_probs=58.1

Q ss_pred             HHhhcCCCCCCCCHHHHHHHHHHHhHhchhhHHHHHHHHHHHHhhCHHHHHHHHHHHHHhcCCCCCC
Q 039054            8 IEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYT   74 (82)
Q Consensus         8 ~~~~~~~~~~~~~~~~i~~~~~~l~~aG~~~~~~~l~~~~~~l~~~p~~~~~~~~Ei~~~~~~~~~~   74 (82)
                      ......+....++++++...+..+++||++|++.+++|++++|+.||++++|+++|++.+++..+.+
T Consensus       257 ~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~  323 (479)
T 3tbg_A          257 MEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRP  323 (479)
T ss_dssp             HHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCC
T ss_pred             hhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhcccc
Confidence            3333444556789999999999999999999999999999999999999999999999998766543
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.3
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.27
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.23
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.22
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.06
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.05
d1n97a_ 385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 98.8
d1n40a_ 395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 98.7
d1z8oa1 402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 98.66
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 98.47
d1q5da_ 401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 98.3
d1ueda_ 403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 98.29
d1jfba_ 399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 98.22
d1re9a_ 404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 98.0
d1gwia_ 403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 97.87
d1cpta_ 428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 97.6
d1ue8a_ 367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 97.44
d1io7a_ 366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 97.43
d1s1fa_ 399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 97.34
d1odoa_ 401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 96.81
d1lfka_ 394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 96.38
d1mo6a260 RecA protein, C-terminal domain {Mycobacterium tub 80.35
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Vitamin D 25-hydroxylase Cyp2R1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.30  E-value=2.3e-11  Score=72.34  Aligned_cols=69  Identities=23%  Similarity=0.399  Sum_probs=59.1

Q ss_pred             HHHHhhcCCCCCCCCHHHHHHHHHHHhHhchhhHHHHHHHHHHHHhhCHHHHHHHHHHHHHhcCCCCCC
Q 039054            6 REIEEHGNNKNVGISFNDVIEKCKQFYFAGQETTSVLLNWTMLLLSKHQDWQERARKEFLQALSPSSYT   74 (82)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~i~~~~~~l~~aG~~~~~~~l~~~~~~l~~~p~~~~~~~~Ei~~~~~~~~~~   74 (82)
                      ..+.+........++++++...+..++++|++|++.+++|.+++++.||++++++++||+.+++..+.+
T Consensus       243 ~~~~~~~~~~~~~~s~~~i~~~~~~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~  311 (463)
T d3czha1         243 DEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP  311 (463)
T ss_dssp             HHHHHTTTCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCC
T ss_pred             hhhhhhcccccchhHHHHHHHHHHHHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCC
Confidence            334444445566789999999999999999999999999999999999999999999999999865543
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1mo6a2 d.48.1.1 (A:270-329) RecA protein, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure