Citrus Sinensis ID: 039121

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
cccEEHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccEEEccccccccccHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHccccEEEcccccccccccc
cccHEHHHHHHHHHHHHHHHccccccEEccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccEEEHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccEEEEccccccccHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHccccEEccccccEEEEEcc
PRNCLWIPILLCLFNElsfaeaesstillpsqqhnadsvsttfcahcpapdpslnyrpvigilshpgdgasgrlsnatnaSYISASYVKFAesggarviplifnepeEILFEKLELVNGIlytggwaksglyYDIVEKIFKKILEkndagdhfpVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNIniegtlfqrfppellkKLSTDCLVMQNHHVRKLCFMYG
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
***CLWIPILLCLFNELSFAEAESSTILL*********VSTTFCAHCPAPDPSLNYRPVIGILSH***********ATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMY*
*RNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVK*INIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PRNCLWIPILLCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLCFMYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
O65355 347 Gamma-glutamyl hydrolase yes no 0.922 0.616 0.709 2e-87
P93164 342 Gamma-glutamyl hydrolase no no 0.922 0.625 0.589 9e-66
Q54LN4 317 Gamma-glutamyl hydrolase yes no 0.711 0.520 0.312 2e-24
Q54HL4 347 Gamma-glutamyl hydrolase no no 0.719 0.481 0.333 2e-21
Q9Z0L8 317 Gamma-glutamyl hydrolase yes no 0.685 0.501 0.384 5e-21
Q62867 317 Gamma-glutamyl hydrolase yes no 0.672 0.492 0.389 5e-19
Q92820 318 Gamma-glutamyl hydrolase yes no 0.681 0.496 0.350 2e-17
A7YWG4 318 Gamma-glutamyl hydrolase yes no 0.663 0.484 0.374 1e-15
>sp|O65355|GGH_ARATH Gamma-glutamyl hydrolase OS=Arabidopsis thaliana GN=GGH PE=1 SV=2 Back     alignment and function desciption
 Score =  321 bits (823), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 156/220 (70%), Positives = 187/220 (85%), Gaps = 6/220 (2%)

Query: 5   LWIPIL-LCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGIL 63
           +W+P++ L LF + S   A+++TILLPSQ     S S      C APDP+LNYRPVIGIL
Sbjct: 5   VWLPLVALSLFKD-SIIMAKAATILLPSQTGFDISRSPV----CSAPDPNLNYRPVIGIL 59

Query: 64  SHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYT 123
           SHPGDGASGRLSNAT+AS I+ASYVK AESGGARVIPLIFNEPEEILF+KLELVNG++ T
Sbjct: 60  SHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLELVNGVILT 119

Query: 124 GGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRAN 183
           GGWAK GLY++IV+KIF K+LE+NDAG+HFP+YAICLGFELL+MI+S++R+I E  D  N
Sbjct: 120 GGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIFEKMDARN 179

Query: 184 QASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHH 223
            AS+LQFV+N+NI+GT+FQRFPPELLKKL TDCLVMQNH 
Sbjct: 180 SASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNHR 219
Has endopeptidase activity against 4-amino-10-methylpteroyl penta-, tetra-, tri- and di-gamma-L-glutamate substrates and is responsible for the production of folic acid, pteglu from teroylpolyglutamates.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 9
>sp|P93164|GGH_SOYBN Gamma-glutamyl hydrolase OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q54LN4|GGHA_DICDI Gamma-glutamyl hydrolase A OS=Dictyostelium discoideum GN=gghA PE=3 SV=1 Back     alignment and function description
>sp|Q54HL4|GGHB_DICDI Gamma-glutamyl hydrolase B OS=Dictyostelium discoideum GN=gghB PE=3 SV=1 Back     alignment and function description
>sp|Q9Z0L8|GGH_MOUSE Gamma-glutamyl hydrolase OS=Mus musculus GN=Ggh PE=1 SV=2 Back     alignment and function description
>sp|Q62867|GGH_RAT Gamma-glutamyl hydrolase OS=Rattus norvegicus GN=Ggh PE=1 SV=1 Back     alignment and function description
>sp|Q92820|GGH_HUMAN Gamma-glutamyl hydrolase OS=Homo sapiens GN=GGH PE=1 SV=2 Back     alignment and function description
>sp|A7YWG4|GGH_BOVIN Gamma-glutamyl hydrolase OS=Bos taurus GN=GGH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
255567082 388 Gamma-glutamyl hydrolase precursor, puta 0.926 0.554 0.732 1e-89
224104165304 predicted protein [Populus trichocarpa] 0.935 0.713 0.706 1e-87
224117460 367 predicted protein [Populus trichocarpa] 0.935 0.591 0.706 4e-87
334183996 333 gamma-glutamyl hydrolase 2 [Arabidopsis 0.922 0.642 0.709 1e-85
30699349 347 gamma-glutamyl hydrolase 2 [Arabidopsis 0.922 0.616 0.709 1e-85
302142873 514 unnamed protein product [Vitis vinifera] 0.935 0.422 0.701 5e-85
225461732 384 PREDICTED: gamma-glutamyl hydrolase [Vit 0.935 0.565 0.701 9e-85
297789369 347 gamma-glutamyl hydrolase 2 [Arabidopsis 0.913 0.610 0.695 6e-84
3834325327 Strong similarity to gb|AF067141 gamma-g 0.853 0.605 0.742 7e-84
297839741 343 gamma-glutamyl hydrolase 2 [Arabidopsis 0.913 0.618 0.691 4e-83
>gi|255567082|ref|XP_002524523.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] gi|223536197|gb|EEF37850.1| Gamma-glutamyl hydrolase precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 189/228 (82%), Gaps = 13/228 (5%)

Query: 3   NCLWIPILLCLFNELSFAEAESSTI-------LLPSQQHNADSVSTTFCAHCPAPDPSLN 55
           N LWIPIL+ L  ELS A+A  S I       LLPSQ  +           C APDP LN
Sbjct: 43  NYLWIPILISLSKELSLAKASRSNINSNNSNILLPSQLDDEP------VPRCLAPDPKLN 96

Query: 56  YRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLE 115
           YRPVIGI+SHPGDGASGRLSNATNASYI+ASYVKF ES GARVIPLI+NEP +ILFEKL 
Sbjct: 97  YRPVIGIVSHPGDGASGRLSNATNASYIAASYVKFVESAGARVIPLIYNEPPDILFEKLN 156

Query: 116 LVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNI 175
           LVNG+L+TGGWAK+GLYYDIV+ IFKK+L+KNDAG HFP+YAICLGFELL+MI+S+DRNI
Sbjct: 157 LVNGVLFTGGWAKNGLYYDIVKAIFKKVLDKNDAGYHFPLYAICLGFELLTMIISKDRNI 216

Query: 176 LETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHH 223
           LE+F+ A+QASTLQF+ NINIEGT+FQRFPP LLKKLSTDCLVMQNHH
Sbjct: 217 LESFNAADQASTLQFMGNINIEGTVFQRFPPGLLKKLSTDCLVMQNHH 264

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224104165|ref|XP_002333977.1| predicted protein [Populus trichocarpa] gi|222839427|gb|EEE77764.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117460|ref|XP_002331718.1| predicted protein [Populus trichocarpa] gi|222874324|gb|EEF11455.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334183996|ref|NP_001185429.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] gi|332198017|gb|AEE36138.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30699349|ref|NP_565186.2| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] gi|26454629|sp|O65355.2|GGH_ARATH RecName: Full=Gamma-glutamyl hydrolase; AltName: Full=Conjugase; AltName: Full=GH; AltName: Full=Gamma-Glu-X carboxypeptidase; Flags: Precursor gi|17979073|gb|AAL49804.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|20465329|gb|AAM20068.1| putative gamma glutamyl hydrolase [Arabidopsis thaliana] gi|332198016|gb|AEE36137.1| gamma-glutamyl hydrolase 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|302142873|emb|CBI20168.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225461732|ref|XP_002285525.1| PREDICTED: gamma-glutamyl hydrolase [Vitis vinifera] Back     alignment and taxonomy information
>gi|297789369|ref|XP_002862660.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] gi|297308311|gb|EFH38918.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|3834325|gb|AAC83041.1| Strong similarity to gb|AF067141 gamma-glutamyl hydrolase from Arabidopsis thaliana. ESTs gb|R83955, gb|T45062, gb|T22220, gb|AA586207, gb|AI099851 and gb|AI00672 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297839741|ref|XP_002887752.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] gi|297333593|gb|EFH64011.1| gamma-glutamyl hydrolase 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2037603 347 GGH2 "gamma-glutamyl hydrolase 0.918 0.613 0.712 1.4e-80
TAIR|locus:2037583 348 GGH1 "gamma-glutamyl hydrolase 0.922 0.614 0.665 6.5e-74
TAIR|locus:2037573 352 GGH3 "gamma-glutamyl hydrolase 0.939 0.619 0.637 3.6e-73
UNIPROTKB|P93164 342 P93164 "Gamma-glutamyl hydrola 0.879 0.596 0.614 1.2e-60
DICTYBASE|DDB_G0286535 317 gghA "peptidase C26 family pro 0.706 0.517 0.313 5.3e-24
DICTYBASE|DDB_G0289365 347 gghB "peptidase C26 family pro 0.719 0.481 0.350 2.9e-23
ZFIN|ZDB-GENE-040426-2615 312 ggh "gamma-glutamyl hydrolase 0.689 0.512 0.385 4.8e-23
MGI|MGI:1329035 317 Ggh "gamma-glutamyl hydrolase" 0.685 0.501 0.402 7.8e-23
UNIPROTKB|F1NR48 321 GGH "Uncharacterized protein" 0.719 0.520 0.355 4.9e-21
UNIPROTKB|E2QUT9 318 GGH "Uncharacterized protein" 0.706 0.515 0.364 6.3e-21
TAIR|locus:2037603 GGH2 "gamma-glutamyl hydrolase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 809 (289.8 bits), Expect = 1.4e-80, P = 1.4e-80
 Identities = 156/219 (71%), Positives = 187/219 (85%)

Query:     5 LWIPIL-LCLFNELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGIL 63
             +W+P++ L LF + S   A+++TILLPSQ     S S      C APDP+LNYRPVIGIL
Sbjct:     5 VWLPLVALSLFKD-SIIMAKAATILLPSQTGFDISRSPV----CSAPDPNLNYRPVIGIL 59

Query:    64 SHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYT 123
             SHPGDGASGRLSNAT+AS I+ASYVK AESGGARVIPLIFNEPEEILF+KLELVNG++ T
Sbjct:    60 SHPGDGASGRLSNATDASSIAASYVKLAESGGARVIPLIFNEPEEILFQKLELVNGVILT 119

Query:   124 GGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRAN 183
             GGWAK GLY++IV+KIF K+LE+NDAG+HFP+YAICLGFELL+MI+S++R+I E  D  N
Sbjct:   120 GGWAKEGLYFEIVKKIFNKVLERNDAGEHFPIYAICLGFELLTMIISQNRDIFEKMDARN 179

Query:   184 QASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH 222
              AS+LQFV+N+NI+GT+FQRFPPELLKKL TDCLVMQNH
Sbjct:   180 SASSLQFVENVNIQGTIFQRFPPELLKKLGTDCLVMQNH 218
GO:0003824 "catalytic activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006541 "glutamine metabolic process" evidence=IEA
GO:0008242 "omega peptidase activity" evidence=IEA;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0046900 "tetrahydrofolylpolyglutamate metabolic process" evidence=IDA
GO:0006833 "water transport" evidence=RCA
GO:0006970 "response to osmotic stress" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009750 "response to fructose stimulus" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
TAIR|locus:2037583 GGH1 "gamma-glutamyl hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037573 GGH3 "gamma-glutamyl hydrolase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93164 P93164 "Gamma-glutamyl hydrolase" [Glycine max (taxid:3847)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286535 gghA "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289365 gghB "peptidase C26 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2615 ggh "gamma-glutamyl hydrolase (conjugase, folylpolygammaglutamyl hydrolase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1329035 Ggh "gamma-glutamyl hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NR48 GGH "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUT9 GGH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O65355GGH_ARATH3, ., 4, ., 1, 9, ., 90.70900.92240.6167yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.19.90.914
3rd Layer3.4.190.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.904.3.1
hypothetical protein (303 aa)
(Populus trichocarpa)
Predicted Functional Partners:
FPGS4
folylpolyglutamate synthase (EC-6.3.2.17) (525 aa)
     •  0.899
FPGS2
folylpolyglutamate synthase (EC-6.3.2.17) (511 aa)
     •  0.899
FPGS5
folylpolyglutamate synthase (EC-6.3.2.12) (442 aa)
     •  0.899
grail3.16455000101
annotation not avaliable (82 aa)
     •  0.899
DHFR-TS-2
dihydrofolate reductase-thymidylate synthase (EC-1.5.1.3 2.1.1.45) (414 aa)
     •  0.899
FPGS3
folylpolyglutamate synthase (EC-6.3.2.17) (587 aa)
     •  0.899
FPGS1
folylpolyglutamate synthase (EC-6.3.2.17) (588 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd01747 273 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutam 4e-74
pfam07722219 pfam07722, Peptidase_C26, Peptidase C26 2e-40
>gnl|CDD|153218 cd01747, GATase1_Glutamyl_Hydrolase, Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information 
 Score =  225 bits (576), Expect = 4e-74
 Identities = 78/166 (46%), Positives = 103/166 (62%), Gaps = 6/166 (3%)

Query: 60  IGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNG 119
           IGIL+ P DGA    SN T  SYI+ASYVKF ES GARV+P+  NE EE   +  + +NG
Sbjct: 1   IGILTQPVDGAG---SNKTGHSYIAASYVKFLESAGARVVPIWINESEEYYDKLFKSING 57

Query: 120 ILYTGGWA--KSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILE 177
           IL+ GG     +  Y    + I+   LE+NDAGD+FPV+  CLGFELL+ + S +  +LE
Sbjct: 58  ILFPGGAVDIDTSGYARTAKIIYNLALERNDAGDYFPVWGTCLGFELLTYLTSGETLLLE 117

Query: 178 TFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHH 223
             +  N A  L F     ++  LF+RFPP+LLK L+T+ L M NH 
Sbjct: 118 ATEATNSALPLNF-TEDALQSRLFKRFPPDLLKSLATEPLTMNNHR 162

Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase. gamma-Glutamyl Hydrolase catalyzes the cleavage of the gamma-glutamyl chain of folylpoly-gamma-glutamyl substrates and is a central enzyme in folyl and antifolyl poly-gamma-glutamate metabolism. GATase activity involves the removal of the ammonia group from a glutamate molecule and its subsequent transfer to a specific substrate, thus creating a new carbon-nitrogen group on the substrate. gamma-Glutamyl hydrolases belong to the triad family of amidotransferases having a conserved Cys-His-Glu catalytic triad in the glutaminase active site. Length = 273
>gnl|CDD|219535 pfam07722, Peptidase_C26, Peptidase C26 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG1559 340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 100.0
cd01747 273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.97
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.95
COG2071243 Predicted glutamine amidotransferases [General fun 99.92
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.85
PRK06895190 putative anthranilate synthase component II; Provi 99.75
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 99.74
PRK08007187 para-aminobenzoate synthase component II; Provisio 99.73
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 99.73
PRK07765214 para-aminobenzoate synthase component II; Provisio 99.72
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.72
PRK06774191 para-aminobenzoate synthase component II; Provisio 99.72
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 99.72
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.72
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 99.71
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 99.7
PRK05670189 anthranilate synthase component II; Provisional 99.7
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 99.69
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 99.69
PLN02335222 anthranilate synthase 99.68
PRK08857193 para-aminobenzoate synthase component II; Provisio 99.67
PRK05637208 anthranilate synthase component II; Provisional 99.67
CHL00101190 trpG anthranilate synthase component 2 99.66
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 99.66
PRK00758184 GMP synthase subunit A; Validated 99.65
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.65
PRK09065237 glutamine amidotransferase; Provisional 99.63
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.63
PRK12564360 carbamoyl phosphate synthase small subunit; Review 99.63
PLN02347 536 GMP synthetase 99.62
PRK13566720 anthranilate synthase; Provisional 99.6
PRK07567242 glutamine amidotransferase; Provisional 99.59
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.59
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 99.59
PRK00074 511 guaA GMP synthase; Reviewed 99.58
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.57
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.57
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.57
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.56
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.56
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.55
PRK07053234 glutamine amidotransferase; Provisional 99.54
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.54
PRK06490239 glutamine amidotransferase; Provisional 99.52
PRK08250235 glutamine amidotransferase; Provisional 99.51
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 99.5
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.49
PRK05665240 amidotransferase; Provisional 99.49
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.46
PLN02889 918 oxo-acid-lyase/anthranilate synthase 99.43
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.43
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.43
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 99.43
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.41
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.41
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.41
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.39
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 99.38
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.36
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.35
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.34
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.28
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.26
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.19
PRK06186229 hypothetical protein; Validated 99.18
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.14
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.13
PRK05380533 pyrG CTP synthetase; Validated 99.13
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.09
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.08
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 99.07
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.07
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.01
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.0
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.0
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 98.97
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 98.97
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 98.95
PLN02327557 CTP synthase 98.88
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 98.87
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 98.77
PRK05368302 homoserine O-succinyltransferase; Provisional 98.71
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.7
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 98.69
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 98.66
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 98.52
COG0311194 PDX2 Predicted glutamine amidotransferase involved 98.45
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 98.43
KOG2387 585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 98.41
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 98.39
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 98.37
PLN03206 1307 phosphoribosylformylglycinamidine synthase; Provis 98.37
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.26
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.21
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 98.2
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 98.16
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 98.1
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 98.09
PRK00784488 cobyric acid synthase; Provisional 98.06
TIGR01739 1202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 97.92
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 97.92
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 97.89
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 97.88
PHA03366 1304 FGAM-synthase; Provisional 97.87
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 97.65
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 97.61
TIGR00313475 cobQ cobyric acid synthase CobQ. 97.39
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 97.28
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 97.11
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 97.1
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 97.06
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 97.05
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 96.89
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 96.7
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 96.67
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 96.57
PRK04155287 chaperone protein HchA; Provisional 96.57
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 96.55
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 96.51
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 96.3
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 96.16
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 96.1
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 96.09
COG3442250 Predicted glutamine amidotransferase [General func 96.07
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 95.76
PRK11574196 oxidative-stress-resistance chaperone; Provisional 95.26
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 95.15
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 95.01
TIGR02069250 cyanophycinase cyanophycinase. This model describe 94.6
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 94.59
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransfer 94.57
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 94.33
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 94.32
PF03575154 Peptidase_S51: Peptidase family S51; InterPro: IPR 94.32
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 94.21
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 94.16
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 93.87
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 93.81
PRK11249752 katE hydroperoxidase II; Provisional 93.29
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme 92.63
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 92.58
PRK09393 322 ftrA transcriptional activator FtrA; Provisional 92.54
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 91.55
COG3340224 PepE Peptidase E [Amino acid transport and metabol 91.1
PRK03372 306 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 90.51
KOG2764247 consensus Putative transcriptional regulator DJ-1 90.32
PRK04539 296 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 88.12
PRK01215264 competence damage-inducible protein A; Provisional 87.38
PRK01911 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 87.35
TIGR02667163 moaB_proteo molybdenum cofactor biosynthesis prote 87.32
TIGR00177144 molyb_syn molybdenum cofactor synthesis domain. Th 87.03
PRK02649 305 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 86.43
PRK03378 292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 86.37
PF09825 367 BPL_N: Biotin-protein ligase, N terminal; InterPro 84.34
COG0303404 MoeA Molybdopterin biosynthesis enzyme [Coenzyme m 84.23
PRK14077 287 pnk inorganic polyphosphate/ATP-NAD kinase; Provis 84.23
PRK13016 577 dihydroxy-acid dehydratase; Provisional 83.97
PRK10680411 molybdopterin biosynthesis protein MoeA; Provision 83.82
PRK14690419 molybdopterin biosynthesis protein MoeA; Provision 83.68
cd00887394 MoeA MoeA family. Members of this family are invol 83.22
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 82.25
PRK14497 546 putative molybdopterin biosynthesis protein MoeA/u 81.88
PRK02155 291 ppnK NAD(+)/NADH kinase family protein; Provisiona 81.78
COG4917148 EutP Ethanolamine utilization protein [Amino acid 81.73
COG0655207 WrbA Multimeric flavodoxin WrbA [General function 80.62
PRK00911 552 dihydroxy-acid dehydratase; Provisional 80.34
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=9.9e-46  Score=317.86  Aligned_cols=219  Identities=68%  Similarity=1.096  Sum_probs=198.9

Q ss_pred             hHHHHHHHhh-hhhhhhhcccceeccCCCCCCCCccccccccCCCCCCCCCCCCEEEEeCCCCCCCCCCcCCccchhhhH
Q 039121            6 WIPILLCLFN-ELSFAEAESSTILLPSQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYIS   84 (232)
Q Consensus         6 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PvIGI~~~~~~~~~~~~~~~~~~~yi~   84 (232)
                      |++|+-+++. ....+...+.+|+||+|.+.+.||+    +.|++|||++++||||||+++|+++++|++.+++.++||+
T Consensus         4 ~~~~~~l~~~~~S~~~~~~~~~ilLps~~g~e~SRs----pvcsapdpnlnykPvIGIL~hpg~g~~~rl~n~t~~~yIA   79 (340)
T KOG1559|consen    4 FLFFLSLLFFMASPGALLCAESILLPSQAGFELSRS----PVCSAPDPNLNYKPVIGILSHPGDGASGRLKNATGRSYIA   79 (340)
T ss_pred             hHHHHHHHHhccChHHHHHHhheecccccccccccC----ccccCCCCCcccCceeEEeccCCCCccceeccccCcchhH
Confidence            6666666544 3333444448999999999778887    9999999999999999999999999999998999999999


Q ss_pred             HHHHHHHHhCCCeEEEEeCCCChHHHHHhhcCCCEEEECCCCCCCccChhHHHHHHHHHHHhcCCCCCccEeehhHHHHH
Q 039121           85 ASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWAKSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFEL  164 (232)
Q Consensus        85 ~s~v~~l~~~G~~vv~i~~~~~~e~l~~~l~~~dGlIl~GG~~~~~~~~~~~~~~~~~~l~~~~~~~~~PILGIClG~Ql  164 (232)
                      +|||+++|..||+|+++.++.+++.+.++++.++|||+|||+.....|++..+.+++++++++|.++++||+|||+||++
T Consensus        80 ASYVK~aEsgGARViPli~nepEe~lfqklelvNGviftGGwak~~dY~~vvkkifnk~le~nDaGehFPvyg~CLGFE~  159 (340)
T KOG1559|consen   80 ASYVKLAESGGARVIPLIYNEPEEILFQKLELVNGVIFTGGWAKRGDYFEVVKKIFNKVLERNDAGEHFPVYGICLGFEL  159 (340)
T ss_pred             HHHHHHHHcCCceEEEEecCCcHHHHHHHHHHhceeEecCcccccccHHHHHHHHHHHHHhccCCccccchhhhhhhHHH
Confidence            99999999999999999999999999999999999999999998888999999999999999999999999999999999


Q ss_pred             HHHHHcCcccccccccCCCceEeEEEeecCCCCCCCCcCCChhHHhhhcCCccceEeecceeee
Q 039121          165 LSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHHVRKLC  228 (232)
Q Consensus       165 L~~~~GG~~~il~~~~~e~~~~pl~~~~~~~~~s~LF~~lp~~l~~~l~~~~~~y~~Hs~gv~~  228 (232)
                      |.+..+...++++.++..+.+.+++|+.+.+.++++|+++|++++++|+++|+++++|.||+.+
T Consensus       160 lsmiISqnrdile~~d~vd~AssLqF~~nvn~~~t~FQrFPpELLkkL~~dcLvmq~Hk~gisp  223 (340)
T KOG1559|consen  160 LSMIISQNRDILERFDAVDVASSLQFVGNVNIHGTMFQRFPPELLKKLSTDCLVMQNHKFGISP  223 (340)
T ss_pred             HHHHHhcChhHHHhhcccccccceeeecccceeehhHhhCCHHHHHHhccchheeeccccccch
Confidence            9999884447899999999999999998777789999999999999999999999999999865

>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>TIGR02069 cyanophycinase cyanophycinase Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PF03575 Peptidase_S51: Peptidase family S51; InterPro: IPR005320 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>COG3340 PepE Peptidase E [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03372 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>KOG2764 consensus Putative transcriptional regulator DJ-1 [General function prediction only; Defense mechanisms] Back     alignment and domain information
>PRK04539 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK01215 competence damage-inducible protein A; Provisional Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>TIGR02667 moaB_proteo molybdenum cofactor biosynthesis protein B, proteobacterial Back     alignment and domain information
>TIGR00177 molyb_syn molybdenum cofactor synthesis domain Back     alignment and domain information
>PRK02649 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK03378 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>COG0303 MoeA Molybdopterin biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>PRK14077 pnk inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>PRK13016 dihydroxy-acid dehydratase; Provisional Back     alignment and domain information
>PRK10680 molybdopterin biosynthesis protein MoeA; Provisional Back     alignment and domain information
>PRK14690 molybdopterin biosynthesis protein MoeA; Provisional Back     alignment and domain information
>cd00887 MoeA MoeA family Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>PRK14497 putative molybdopterin biosynthesis protein MoeA/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK02155 ppnK NAD(+)/NADH kinase family protein; Provisional Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG0655 WrbA Multimeric flavodoxin WrbA [General function prediction only] Back     alignment and domain information
>PRK00911 dihydroxy-acid dehydratase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1l9x_A 315 Structure Of Gamma-Glutamyl Hydrolase Length = 315 2e-18
>pdb|1L9X|A Chain A, Structure Of Gamma-Glutamyl Hydrolase Length = 315 Back     alignment and structure 
Iteration: 1

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (52%), Gaps = 13/171 (7%)
Query: 57  RPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPE---EILFEK 113
           +P+IGIL         ++       YI+ASYVK+ ES GARV+P+  +  E   EILF+ 
Sbjct: 30  KPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKS 86
Query: 114 LELVNGILYTGGWA--KSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSE 171
              +NGIL+ GG    +   Y  + +  +   ++  D GD+FPV+  CLGFE LS+++S 
Sbjct: 87  ---INGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISG 143
Query: 172 DRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNH 222
           +  +L   D  + A  L F     +   +FQ FP ELL  L+ + L    H
Sbjct: 144 E-CLLTATDTVDVAMPLNFTGG-QLHSRMFQNFPTELLLSLAVEPLTANFH 192

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
1l9x_A 315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 2e-42
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 6e-05
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
 Score =  144 bits (365), Expect = 2e-42
 Identities = 60/195 (30%), Positives = 91/195 (46%), Gaps = 7/195 (3%)

Query: 31  SQQHNADSVSTTFCAHCPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKF 90
           S  H+  S           P      +P+IGIL         ++       YI+ASYVK+
Sbjct: 4   SHHHHHHSSGLVPRGSHMRPHGDTAKKPIIGILMQK---CRNKVMKNYGRYYIAASYVKY 60

Query: 91  AESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWA--KSGLYYDIVEKIFKKILEKND 148
            ES GARV+P+  +  E+      + +NGIL+ GG    +   Y  + +  +   ++  D
Sbjct: 61  LESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFD 120

Query: 149 AGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPEL 208
            GD+FPV+  CLGFE LS+++S    +L   D  + A  L F     +   +FQ FP EL
Sbjct: 121 DGDYFPVWGTCLGFEELSLLIS-GECLLTATDTVDVAMPLNFTGG-QLHSRMFQNFPTEL 178

Query: 209 LKKLSTDCLVMQNHH 223
           L  L+ + L    H 
Sbjct: 179 LLSLAVEPLTANFHK 193
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
1l9x_A 315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.94
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.9
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 99.72
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 99.71
2a9v_A212 GMP synthase; structural genomics, joint center fo 99.71
1i1q_B192 Anthranilate synthase component II; tryptophan bio 99.7
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.69
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 99.68
3m3p_A250 Glutamine amido transferase; structural genomics, 99.67
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 99.66
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.65
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 99.62
3uow_A 556 GMP synthetase; structural genomics consortium, SG 99.6
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 99.6
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.6
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.59
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.53
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.52
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.51
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.5
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.49
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.45
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 99.41
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.37
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.36
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.35
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.34
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.28
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.28
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.21
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.14
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.13
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.11
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.08
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.01
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 98.79
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 98.53
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 98.39
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 97.82
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 97.1
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 97.06
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 97.04
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 96.96
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 96.93
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 96.78
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 96.61
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 96.45
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 96.42
3cne_A175 Putative protease I; structural genomics, PSI-2, M 95.98
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 95.96
3uk7_A 396 Class I glutamine amidotransferase-like domain-CO 95.93
3en0_A291 Cyanophycinase; serine protease, beta peptide spec 95.93
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 95.89
2fex_A188 Conserved hypothetical protein; structural genomic 95.87
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 95.87
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 95.82
3gra_A202 Transcriptional regulator, ARAC family; transcript 95.71
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 95.46
3er6_A209 Putative transcriptional regulator protein; struct 95.29
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 95.12
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI-like 94.89
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 94.88
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 94.79
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 94.38
1u9c_A224 APC35852; structural genomics, protein structure i 94.04
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 92.92
3mgk_A211 Intracellular protease/amidase related enzyme (THI 92.9
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 92.59
3n7t_A247 Macrophage binding protein; seattle structural gen 91.91
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 90.82
4gdh_A194 DJ-1, uncharacterized protein C22E12.03C; unknown 89.31
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 88.07
2pjk_A178 178AA long hypothetical molybdenum cofactor biosyn 86.74
3pzy_A164 MOG; ssgcid, seattle structural genomics center fo 86.3
3kbq_A172 Protein TA0487; structural genomics, CINA, protein 84.53
3h75_A 350 Periplasmic sugar-binding domain protein; protein 84.33
1di6_A195 MOGA, molybdenum cofactor biosynthetic enzyme; MOC 82.94
1jlj_A189 Gephyrin; globular alpha/beta fold, structural pro 81.69
3l6u_A 293 ABC-type sugar transport system periplasmic compo; 81.63
3uug_A 330 Multiple sugar-binding periplasmic receptor CHVE; 81.58
3l49_A 291 ABC sugar (ribose) transporter, periplasmic substr 80.55
1mkz_A172 Molybdenum cofactor biosynthesis protein B; MAD, W 80.37
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 80.31
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
Probab=99.94  E-value=1.2e-26  Score=208.45  Aligned_cols=176  Identities=32%  Similarity=0.516  Sum_probs=126.8

Q ss_pred             CCCCCCCCCCCCEEEEeCCCCCCCCCCcCCccchhhhHHHHHHHHHhCCCeEEEEeCCCChHHHHHhhcCCCEEEECCCC
Q 039121           47 CPAPDPSLNYRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGW  126 (232)
Q Consensus        47 ~~~~~~~~~~~PvIGI~~~~~~~~~~~~~~~~~~~yi~~s~v~~l~~~G~~vv~i~~~~~~e~l~~~l~~~dGlIl~GG~  126 (232)
                      |-.+.+..+.||+|||++.......   ......+|+.++|+++|+++|+.+++++++.+.+++++.++.+||||||||+
T Consensus        20 ~m~~~~~~~~~P~IGI~~~~~~~~~---~~~~~~~~~~~~~~~~l~~~G~~~~vv~~~~~~~~i~~~l~~~dglil~GG~   96 (315)
T 1l9x_A           20 HMRPHGDTAKKPIIGILMQKCRNKV---MKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGS   96 (315)
T ss_dssp             --------CCCCEEEEECEECCSHH---HHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCC
T ss_pred             ccCCCcccCCCCEEEEECCcccccc---cccCcceehHHHHHHHHHHCCCEEEEEecCCCHHHHHHHHhcCCEEEEeCCC
Confidence            4466777788999999998653210   0112356899999999999999999999877677777777889999999997


Q ss_pred             -CCCccCh-hHHHHHHHHHHHhcCCCCCccEeehhHHHHHHHHHHcCcccccccccCCCceEeEEEeecCCCCCCCCcCC
Q 039121          127 -AKSGLYY-DIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRF  204 (232)
Q Consensus       127 -~~~~~~~-~~~~~~~~~~l~~~~~~~~~PILGIClG~QlL~~~~GG~~~il~~~~~e~~~~pl~~~~~~~~~s~LF~~l  204 (232)
                       +.++..+ ...+.+++.+++..+.++++||||||+|||+|+.++||++ .+..+..++...|++.+.... .++||+.+
T Consensus        97 ~~v~p~~~~~~~~~l~~~~~~~~~~g~~~PiLGIC~G~Qll~~a~GG~~-~~~~~~~~g~~~p~~~~~~~~-~s~L~~~~  174 (315)
T 1l9x_A           97 VDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISGEC-LLTATDTVDVAMPLNFTGGQL-HSRMFQNF  174 (315)
T ss_dssp             CCTTTCHHHHHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHHHHSSC-CCEEEEEEEEEECCEECSTTT-TCSTTTTS
T ss_pred             cccChhhhhHHHHHHHHHHHHHHhcCCCceEEEEChHHHHHHHHhCCcc-ccccccccCCCCCeeeccCCC-CChHHHhc
Confidence             5555433 3345667777665434446999999999999999999984 333333334445676654434 68899999


Q ss_pred             ChhHHhhhcCCccceEeecceee
Q 039121          205 PPELLKKLSTDCLVMQNHHVRKL  227 (232)
Q Consensus       205 p~~l~~~l~~~~~~y~~Hs~gv~  227 (232)
                      |+.+.+.+.++..++++|+|++.
T Consensus       175 ~~~~~~~l~~~~~~~~~H~~~V~  197 (315)
T 1l9x_A          175 PTELLLSLAVEPLTANFHKWSLS  197 (315)
T ss_dssp             CHHHHHHHHHSCCEEEEEEEECB
T ss_pred             ChhhhhhccccceEEEhhhhhcC
Confidence            99998888888889999999986
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3en0_A Cyanophycinase; serine protease, beta peptide specific, hydrolase, protease; 1.50A {Synechocystis SP} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>4gdh_A DJ-1, uncharacterized protein C22E12.03C; unknown function, cysteine oxidation; 1.05A {Schizosaccharomyces pombe} PDB: 4ge3_A 4ge0_A Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>3pzy_A MOG; ssgcid, seattle structural genomics center for infectious DI biosynthetic protein; 1.80A {Mycobacterium avium subsp} PDB: 3oi9_A 2g4r_A Back     alignment and structure
>3kbq_A Protein TA0487; structural genomics, CINA, protein structure initiative, MCS midwest center for structural genomics, unknown function; 2.00A {Thermoplasma acidophilum} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1di6_A MOGA, molybdenum cofactor biosynthetic enzyme; MOCO, MOCO biosynthesis, gephyrin function; 1.45A {Escherichia coli} SCOP: c.57.1.1 PDB: 1di7_A Back     alignment and structure
>1jlj_A Gephyrin; globular alpha/beta fold, structural protein; 1.60A {Homo sapiens} SCOP: c.57.1.1 PDB: 1ihc_A Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>1mkz_A Molybdenum cofactor biosynthesis protein B; MAD, WEAK anomalous signal, molybdopterin synthesis, structural genomics, PSI; HET: MSE; 1.60A {Escherichia coli} SCOP: c.57.1.1 PDB: 1r2k_B Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1l9xa_ 288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 3e-22
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 90.0 bits (222), Expect = 3e-22
 Identities = 50/169 (29%), Positives = 78/169 (46%), Gaps = 7/169 (4%)

Query: 57  RPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLEL 116
           +P+IGIL         ++       YI+ASYVK+ ES GARV+P+  +  E+      + 
Sbjct: 3   KPIIGILMQK---CRNKVMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKS 59

Query: 117 VNGILYTGGWA--KSGLYYDIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRN 174
           +NGIL+ GG    +   Y  + +  +   ++  D GD+FPV+  CLGFE   + +     
Sbjct: 60  INGILFPGGSVDLRRSDYAKVAKIFYNLSIQSFDDGDYFPVWGTCLGFEE--LSLLISGE 117

Query: 175 ILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLSTDCLVMQNHH 223
            L T       +         +   +FQ FP ELL  L+ + L    H 
Sbjct: 118 CLLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHK 166

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1l9xa_ 288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.97
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 99.75
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 99.74
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 99.67
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.65
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 99.64
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 99.63
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 99.59
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.54
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.43
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.41
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.37
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.19
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.16
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.15
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.02
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 98.97
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 98.83
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 97.07
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 96.65
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 96.6
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 96.57
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 96.51
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 96.38
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 96.23
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 95.04
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 94.99
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 94.91
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 92.17
d1wu2a3144 MoeA, central domain {Pyrococcus horikoshii, PH164 88.9
d2ftsa3155 Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId 88.79
d1uz5a3148 MoeA, central domain {Archaeon Pyrococcus horikosh 86.97
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 86.18
d1fyea_229 Aspartyl dipeptidase PepE {Salmonella typhimurium 80.99
d1u0ta_ 302 Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycob 80.11
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: gamma-glutamyl hydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.7e-32  Score=241.04  Aligned_cols=167  Identities=34%  Similarity=0.545  Sum_probs=140.2

Q ss_pred             CCCEEEEeCCCCCCCCCCcCCccchhhhHHHHHHHHHhCCCeEEEEeCCCChHHHHHhhcCCCEEEECCCCC-CCc-cCh
Q 039121           56 YRPVIGILSHPGDGASGRLSNATNASYISASYVKFAESGGARVIPLIFNEPEEILFEKLELVNGILYTGGWA-KSG-LYY  133 (232)
Q Consensus        56 ~~PvIGI~~~~~~~~~~~~~~~~~~~yi~~s~v~~l~~~G~~vv~i~~~~~~e~l~~~l~~~dGlIl~GG~~-~~~-~~~  133 (232)
                      .||||||++++.+..   .......+||+++|+++++++|++|++++++.+.++++++++.+||||||||+. .++ .|.
T Consensus         2 ~kPiIGI~~~~~~~~---~~~~~~~~yi~~sYvk~ie~aGa~vvpi~~~~~~~~~~~~l~~idGillpGG~~~~~~~~~~   78 (288)
T d1l9xa_           2 KKPIIGILMQKCRNK---VMKNYGRYYIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILFPGGSVDLRRSDYA   78 (288)
T ss_dssp             CCCEEEEECEECCSH---HHHTTCSEEEEHHHHHHHHHTTCEEEEECSSCCHHHHHHHHHHSSEEEECCCCCCTTTCHHH
T ss_pred             CCCEEEEeCCcccCc---ccccchHHHHHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHhhcCCeEecCCCCCccccccc
Confidence            589999999876532   123346789999999999999999999999999999999999999999999874 444 445


Q ss_pred             hHHHHHHHHHHHhcCCCCCccEeehhHHHHHHHHHHcCcccccccccCCCceEeEEEeecCCCCCCCCcCCChhHHhhhc
Q 039121          134 DIVEKIFKKILEKNDAGDHFPVYAICLGFELLSMIVSEDRNILETFDRANQASTLQFVKNINIEGTLFQRFPPELLKKLS  213 (232)
Q Consensus       134 ~~~~~~~~~~l~~~~~~~~~PILGIClG~QlL~~~~GG~~~il~~~~~e~~~~pl~~~~~~~~~s~LF~~lp~~l~~~l~  213 (232)
                      +..+++++.++++++.++++||||||+|||+|++++||++ .......++...+++++.... .+.+|..++..+.+.+.
T Consensus        79 ~~~r~~~~~~l~~~~~~~~~PilGIC~G~Qll~~~~gG~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~  156 (288)
T d1l9xa_          79 KVAKIFYNLSIQSFDDGDYFPVWGTCLGFEELSLLISGEC-LLTATDTVDVAMPLNFTGGQL-HSRMFQNFPTELLLSLA  156 (288)
T ss_dssp             HHHHHHHHHHHHHHHTTCCCCEEEETHHHHHHHHHHHSSC-CCEEEEEEEEEECCEECSTTT-TCSTTTTSCHHHHHHHH
T ss_pred             ccchHHHHHHHHHHHhhCCCCeEEEcHHHHHHHHHhCCEe-eccccCcCCcceeEEecCCCc-cceeEeecccchhhhcc
Confidence            5678999999999999999999999999999999999984 333344455566777776554 78899999999999999


Q ss_pred             CCccceEeecceee
Q 039121          214 TDCLVMQNHHVRKL  227 (232)
Q Consensus       214 ~~~~~y~~Hs~gv~  227 (232)
                      +++.++++|++++.
T Consensus       157 ~~~~~~~~H~~~v~  170 (288)
T d1l9xa_         157 VEPLTANFHKWSLS  170 (288)
T ss_dssp             HSCCEEEEEEEECB
T ss_pred             CCceEEEecccEEE
Confidence            99999999999985
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wu2a3 c.57.1.2 (A:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} Back     information, alignment and structure
>d2ftsa3 c.57.1.2 (A:499-653) Gephyrin, domain 5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Archaeon Pyrococcus horikoshii, PH0582 [TaxId: 53953]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fyea_ c.23.16.4 (A:) Aspartyl dipeptidase PepE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u0ta_ e.52.1.1 (A:) Inorganic polyphosphate/ATP-NAD kinase PpnK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure