Citrus Sinensis ID: 039126


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQSNVNRDVREPT
cccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccccHHHHHcccccccEEEEcccccccHHHHHHHHHHcHHcEEcccccccccccEEEcccccccccccccccccccc
ccccccccccccccHHHHEEEccccccHHHccccccccHcccEEEccccccHccccccccccccHEEEcccccccccccccHHHHHHHHEEEccccccccEccccccHHHHHEEcccccHHHcccccccHcHHEEEccccccEEccccHHHcccccEEEccccccHHccccHHHHHHHccEEEccccccHccccHHHHHcccccccEEcccccccccEccccccccHHcccccEEEEccccccccHHHHHHHHHHccccEEccccccccHcccccEEEccccccccccccccccc
whgcpfkslssiirpknlvspeiprnSIKQLWKVVQRLVNLKsinlnhsehlteipslslatnleslNFQRYTSLLETHSSIRHLNKFVARNLKhcrsltnlstsiHLESLKKLILSGCSNLMSFPELFYNIKelsldgtainelpSSIEYLSKLVILNlgnssrleglpskicklkslqhlnlsccsnlesfpnelrnlfpcdlydieaHWCSSLETLSGLSIIFTKIsrntqsfdFINCFKLHQNVVQGIINNAqlklqlptsnlkTQAIIIIVLKYNnsaqsnvnrdvrept
whgcpfkslssiirpknlvspeiprNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLkynnsaqsnvnrdvrept
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQSNVNRDVREPT
*****************LV**EIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYN***************
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQS*VN****EP*
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQSNVNRDVREPT
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQSNVN*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFINCFKLHQNVVQGIINNAQLKLQLPTSNLKTQAIIIIVLKYNNSAQSNVNRDVREPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q9SZ67 1895 Probable WRKY transcripti no no 0.677 0.105 0.447 2e-32
O23530 1301 Protein SUPPRESSOR OF npr no no 0.644 0.146 0.418 3e-28
O82500 1095 Putative disease resistan no no 0.816 0.220 0.327 2e-25
Q40392 1144 TMV resistance protein N N/A no 0.684 0.176 0.357 5e-25
Q9FL92 1372 Probable WRKY transcripti no no 0.762 0.163 0.287 8e-17
Q9FH83 1288 Probable WRKY transcripti no no 0.650 0.149 0.302 5e-14
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.762 0.139 0.258 2e-13
P23799630 Putative adenylate cyclas N/A no 0.837 0.392 0.246 4e-07
P26337630 Putative adenylate cyclas N/A no 0.837 0.392 0.246 9e-07
P0CB16 1201 Putative disease resistan no no 0.403 0.099 0.292 4e-06
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function desciption
 Score =  139 bits (350), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 93/208 (44%), Positives = 124/208 (59%), Gaps = 8/208 (3%)

Query: 1    WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQR--------LVNLKSINLNHSEHL 52
            W   P  SL     P+NLV   +P +  K+LWK  +         L  LK + L++S+ L
Sbjct: 1212 WEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQL 1271

Query: 53   TEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLK 112
            T+IP LS ATNLE ++ +   SLL    SI +L K V  NLK C  L N+ + + LESL+
Sbjct: 1272 TKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLE 1331

Query: 113  KLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSK 172
             L LSGCS L +FPE+  N+KEL + GT I E+PSSI+ L  L  L+L NS  L+ LP+ 
Sbjct: 1332 VLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTS 1391

Query: 173  ICKLKSLQHLNLSCCSNLESFPNELRNL 200
            I KLK L+ LNLS C +LE FP+  R +
Sbjct: 1392 IYKLKHLETLNLSGCISLERFPDSSRRM 1419




Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. May act also as a disease resistance protein with a serine/threonine-protein kinase activity.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
359496026 1250 PREDICTED: TMV resistance protein N-like 0.677 0.16 0.502 2e-40
297804200 1046 predicted protein [Arabidopsis lyrata su 0.888 0.250 0.375 3e-38
225460354 1174 PREDICTED: TMV resistance protein N-like 0.677 0.170 0.463 9e-38
296089535 688 unnamed protein product [Vitis vinifera] 0.677 0.290 0.463 1e-37
297744796 596 unnamed protein product [Vitis vinifera] 0.677 0.335 0.463 1e-37
359493487 1162 PREDICTED: TMV resistance protein N-like 0.677 0.172 0.467 3e-37
296089531 696 unnamed protein product [Vitis vinifera] 0.677 0.287 0.463 3e-37
359493483 1274 PREDICTED: TMV resistance protein N-like 0.677 0.156 0.472 6e-37
147768286 1206 hypothetical protein VITISV_033530 [Viti 0.677 0.165 0.453 3e-36
451798988 1219 TMV resistance protein N-like protein 6 0.677 0.164 0.463 1e-35
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/203 (50%), Positives = 128/203 (63%), Gaps = 3/203 (1%)

Query: 1   WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSL 60
           WH  P KSL S   PKNLV   +    +++LWK V+ +  L+ I+L+HS++L   P  S 
Sbjct: 612 WHRYPLKSLPSNFHPKNLVELNLCCCYVEELWKGVKHMEKLECIDLSHSQYLVRTPDFSG 671

Query: 61  ATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCS 120
             NLE L F+  T L E H S+  L+K +  NLK C++L    +SI LESLK LILSGCS
Sbjct: 672 IPNLERLIFEGCTDLREVHQSLGVLSKLIFLNLKDCKNLQCFPSSIELESLKVLILSGCS 731

Query: 121 NLMSFPELFYNI---KELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLK 177
            L +FPE+  N+   +EL LDGTAI ELP S+E+L+ LV+LNL N  RL  LPS IC LK
Sbjct: 732 KLDNFPEILENMEGLRELFLDGTAIKELPLSVEHLNGLVLLNLRNCERLITLPSSICNLK 791

Query: 178 SLQHLNLSCCSNLESFPNELRNL 200
           SL  L LS CS LE  P  L NL
Sbjct: 792 SLSTLTLSGCSQLEKLPENLGNL 814




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297804200|ref|XP_002869984.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297315820|gb|EFH46243.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089535|emb|CBI39354.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744796|emb|CBI38064.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089531|emb|CBI39350.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|147768286|emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2118116 1895 WRKY19 [Arabidopsis thaliana ( 0.783 0.121 0.423 2.8e-36
TAIR|locus:2155322 1170 LAZ5 "LAZARUS 5" [Arabidopsis 0.884 0.223 0.367 1.4e-34
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.657 0.159 0.432 4e-34
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.749 0.170 0.390 1.1e-32
TAIR|locus:2153072 1229 AT5G51630 [Arabidopsis thalian 0.654 0.157 0.409 5.6e-32
TAIR|locus:2122965 1210 AT4G19510 [Arabidopsis thalian 0.654 0.159 0.412 7.6e-32
TAIR|locus:2170333 1197 CSA1 "constitutive shade-avoid 0.955 0.235 0.333 3.8e-31
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.830 0.229 0.339 2.2e-30
TAIR|locus:2130270 1449 RPP5 "RECOGNITION OF PERONOSPO 0.732 0.149 0.377 6.8e-30
TAIR|locus:2153363 1261 AT5G45200 [Arabidopsis thalian 0.674 0.157 0.4 7.9e-30
TAIR|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 406 (148.0 bits), Expect = 2.8e-36, P = 2.8e-36
 Identities = 105/248 (42%), Positives = 141/248 (56%)

Query:     1 WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWK--------VVQRLVNLKSINLNHSEHL 52
             W   P  SL     P+NLV   +P +  K+LWK            L  LK + L++S+ L
Sbjct:  1212 WEYYPLSSLPKSFNPENLVELNLPSSCAKKLWKGKKARFCTTNSSLEKLKKMRLSYSDQL 1271

Query:    53 TEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLK 112
             T+IP LS ATNLE ++ +   SLL    SI +L K V  NLK C  L N+ + + LESL+
Sbjct:  1272 TKIPRLSSATNLEHIDLEGCNSLLSLSQSISYLKKLVFLNLKGCSKLENIPSMVDLESLE 1331

Query:   113 KLILSGCSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSK 172
              L LSGCS L +FPE+  N+KEL + GT I E+PSSI+ L  L  L+L NS  L+ LP+ 
Sbjct:  1332 VLNLSGCSKLGNFPEISPNVKELYMGGTMIQEIPSSIKNLVLLEKLDLENSRHLKNLPTS 1391

Query:   173 ICKLKSLQHLNLSCCSNLESFPNELRNLFPC----DLY--DIEAHWCSSLETLSGLS-II 225
             I KLK L+ LNLS C +LE FP+  R +  C    DL   DI+    SS+  L+ L  ++
Sbjct:  1392 IYKLKHLETLNLSGCISLERFPDSSRRM-KCLRFLDLSRTDIK-ELPSSISYLTALDELL 1449

Query:   226 FTKISRNT 233
             F    RN+
Sbjct:  1450 FVDSRRNS 1457




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0006952 "defense response" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0009556 "microsporogenesis" evidence=RCA
GO:0052543 "callose deposition in cell wall" evidence=RCA
TAIR|locus:2155322 LAZ5 "LAZARUS 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130270 RPP5 "RECOGNITION OF PERONOSPORA PARASITICA 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-39
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-23
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  145 bits (368), Expect = 3e-39
 Identities = 93/253 (36%), Positives = 134/253 (52%), Gaps = 33/253 (13%)

Query: 1   WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSL 60
           W   P + + S  RP+NLV  ++  + +++LW  V  L  L++I+L  S++L EIP LS+
Sbjct: 596 WDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSM 655

Query: 61  ATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCS 120
           ATNLE+L     +SL+E  SSI++LNK    ++  C +L  L T I+L+SL +L LSGCS
Sbjct: 656 ATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCS 715

Query: 121 NLMSFPELFYNIKELSLDGTAINELPSS--IEYLSKLVI--------------------- 157
            L SFP++  NI  L LD TAI E PS+  +E L +L++                     
Sbjct: 716 RLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTM 775

Query: 158 -------LNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEA 210
                  L L +   L  LPS I  L  L+HL +  C NLE+ P  + NL    L  ++ 
Sbjct: 776 LSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLE--SLESLDL 832

Query: 211 HWCSSLETLSGLS 223
             CS L T   +S
Sbjct: 833 SGCSRLRTFPDIS 845


syringae 6; Provisional. Length = 1153

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.89
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.74
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.6
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.56
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.43
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.41
KOG4237498 consensus Extracellular matrix protein slit, conta 99.29
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.94
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.92
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.91
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.79
PLN03150623 hypothetical protein; Provisional 98.78
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.77
PRK15386 426 type III secretion protein GogB; Provisional 98.73
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
PLN03150623 hypothetical protein; Provisional 98.6
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.59
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.51
KOG4341483 consensus F-box protein containing LRR [General fu 98.49
PRK15386 426 type III secretion protein GogB; Provisional 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.38
KOG4341483 consensus F-box protein containing LRR [General fu 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.09
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.96
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.6
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.53
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.47
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.41
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.19
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.14
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.12
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.55
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.42
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.25
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.04
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.38
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.25
smart0037026 LRR Leucine-rich repeats, outliers. 91.12
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.12
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.6
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.41
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.93  E-value=6.2e-25  Score=219.21  Aligned_cols=146  Identities=45%  Similarity=0.725  Sum_probs=130.5

Q ss_pred             CCCCCCCcCCCCCCCCCceeEecCCCCccccchhhcCCCCCcEEecCCCCCCCcCCCCCCCCCCcEeecccccccccccc
Q 039126            1 WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHS   80 (295)
Q Consensus         1 ~~~~~~~~~p~~~~~~~L~~L~l~~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~   80 (295)
                      |++++++.+|..+.+.+|+.|+++++.+..+|.++..+++|+.|+++++.....+|.+..+++|++|++++|..+..+|.
T Consensus       596 ~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~  675 (1153)
T PLN03210        596 WDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPS  675 (1153)
T ss_pred             ecCCCCCCCCCcCCccCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccch
Confidence            78899999999999999999999999999999999999999999999998788899999999999999999999999999


Q ss_pred             chhcccCCcEEccccCcCCceeCCcccCccccEEeccCCCCCcccCcCCCCCceEEccCccccccc
Q 039126           81 SIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSGCSNLMSFPELFYNIKELSLDGTAINELP  146 (295)
Q Consensus        81 ~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~L~~L~l~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~  146 (295)
                      .+..+++|+.|++++|..++.+|....+++|+.|++++|..++.+|....+|+.|++.++.+..+|
T Consensus       676 si~~L~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP  741 (1153)
T PLN03210        676 SIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFP  741 (1153)
T ss_pred             hhhccCCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCcccccc
Confidence            999999999999999999999998878899999999998877777766666666666666655444



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 5e-04
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 6/122 (4%) Query: 36 QRLVNLKSINLNHSEHLTEIPSLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNLKH 95 Q LVNL+S+ L + + S++ NL+SL R + L +I HL K +L+ Sbjct: 180 QGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKI-RNSPLSALGPAIHHLPKLEELDLRG 238 Query: 96 CRSLTNLSTSIHLES-LKKLILSGCSNLMSFP---ELFYNIKELSLDGTA-INELPSSIE 150 C +L N + LK+LIL CSNL++ P +++L L G ++ LPS I Sbjct: 239 CTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIA 298 Query: 151 YL 152 L Sbjct: 299 QL 300

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-06
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  101 bits (253), Expect = 4e-25
 Identities = 52/218 (23%), Positives = 91/218 (41%), Gaps = 19/218 (8%)

Query: 16  KNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIP-SLSLATNLESLNFQRYTS 74
              V+ E+    + Q      RL +L+ + ++ +  L E+P ++     LE+L       
Sbjct: 81  PGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAG-LMELPDTMQQFAGLETLTL-ARNP 138

Query: 75  LLETHSSIRHLNKFVARNLKHCRSLTNLSTSI----------HLESLKKLILSGCSNLMS 124
           L    +SI  LN+    +++ C  LT L   +           L +L+ L L   + + S
Sbjct: 139 LRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLE-WTGIRS 197

Query: 125 FPELFY---NIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQH 181
            P       N+K L +  + ++ L  +I +L KL  L+L   + L   P        L+ 
Sbjct: 198 LPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKR 257

Query: 182 LNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETL 219
           L L  CSNL + P ++  L    L  ++   C +L  L
Sbjct: 258 LILKDCSNLLTLPLDIHRL--TQLEKLDLRGCVNLSRL 293


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.91
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.89
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.88
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.87
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.85
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.85
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.8
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.78
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.78
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.69
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.6
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.55
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.54
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.54
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.52
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.44
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.41
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.4
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.3
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.17
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.9
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.87
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.79
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.59
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.97
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.85
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.68
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.18
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.52
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.91
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.95  E-value=2e-27  Score=206.72  Aligned_cols=217  Identities=24%  Similarity=0.347  Sum_probs=196.7

Q ss_pred             CCCceeEecCCCCccccchhhcCCCCCcEEecCCCCCCCcCC-CCCCCCCCcEeeccccccccccccchhcccCCcEEcc
Q 039126           15 PKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIP-SLSLATNLESLNFQRYTSLLETHSSIRHLNKFVARNL   93 (295)
Q Consensus        15 ~~~L~~L~l~~~~~~~l~~~~~~l~~L~~L~L~~~~~~~~~~-~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l   93 (295)
                      .++++.|++++|.+..+|..+..+++|++|++++|.+. .+| .+..+++|++|++++|. +..+|..+..+++|++|++
T Consensus        80 ~~~l~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~~~~l~~L~~L~Ls~n~-l~~lp~~l~~l~~L~~L~L  157 (328)
T 4fcg_A           80 QPGRVALELRSVPLPQFPDQAFRLSHLQHMTIDAAGLM-ELPDTMQQFAGLETLTLARNP-LRALPASIASLNRLRELSI  157 (328)
T ss_dssp             STTCCEEEEESSCCSSCCSCGGGGTTCSEEEEESSCCC-CCCSCGGGGTTCSEEEEESCC-CCCCCGGGGGCTTCCEEEE
T ss_pred             ccceeEEEccCCCchhcChhhhhCCCCCEEECCCCCcc-chhHHHhccCCCCEEECCCCc-cccCcHHHhcCcCCCEEEC
Confidence            48899999999999999999999999999999999977 777 58999999999999964 5588989999999999999


Q ss_pred             ccCcCCceeCCccc----------CccccEEeccCCCCCcccCcCC---CCCceEEccCccccccchhhhCCCCCcEEec
Q 039126           94 KHCRSLTNLSTSIH----------LESLKKLILSGCSNLMSFPELF---YNIKELSLDGTAINELPSSIEYLSKLVILNL  160 (295)
Q Consensus        94 ~~~~~l~~l~~~~~----------~~~L~~L~l~~~~~~~~~~~~~---~~L~~L~l~~~~i~~~~~~~~~~~~L~~L~l  160 (295)
                      ++|...+.+|..+.          +++|+.|++++|.+. .+|..+   .+|++|++++|.++.+|..++.+++|+.|++
T Consensus       158 ~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~L  236 (328)
T 4fcg_A          158 RACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIR-SLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDL  236 (328)
T ss_dssp             EEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCC-CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEEC
T ss_pred             CCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcC-cchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEEC
Confidence            99988888887653          899999999998754 777654   4788999999999999999999999999999


Q ss_pred             CCCcCCcCcccccCCCCCCCeeeccCCCCCCCchhhhhccCCCCcceeecccccccccccccchhhhccCCcccEEeecC
Q 039126          161 GNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLETLSGLSIIFTKISRNTQSFDFIN  240 (295)
Q Consensus       161 ~~~~~~~~~p~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~  240 (295)
                      ++|...+.+|..++++++|++|++++|...+.+|..+..+  ++|++|++++|+.++.+|..+    ..+++|+.+.+..
T Consensus       237 s~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l--~~L~~L~L~~n~~~~~iP~~l----~~L~~L~~l~l~~  310 (328)
T 4fcg_A          237 RGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRL--TQLEKLDLRGCVNLSRLPSLI----AQLPANCIILVPP  310 (328)
T ss_dssp             TTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGC--TTCCEEECTTCTTCCCCCGGG----GGSCTTCEEECCG
T ss_pred             cCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcC--CCCCEEeCCCCCchhhccHHH----hhccCceEEeCCH
Confidence            9998889999999999999999999999999999999998  999999999999999998765    6889999998864



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 40.8 bits (94), Expect = 1e-04
 Identities = 30/187 (16%), Positives = 71/187 (37%), Gaps = 11/187 (5%)

Query: 1   WHGCPFKSLSSIIRPKNLVSPEIPRNSIKQLWKVVQRLVNLKSINLNHSEHLTEIPSLSL 60
                   ++ +    NL    +  N +K +   +  L NL  ++L ++  ++ +  LS 
Sbjct: 204 ATNNQISDITPLGILTNLDELSLNGNQLKDI-GTLASLTNLTDLDLANN-QISNLAPLSG 261

Query: 61  ATNLESLNFQRY--TSLLETHSSIRHLNKFVARNLKHCRSLTNLSTSIHLESLKKLILSG 118
            T L  L       +++          N  +  N     S  +   ++   +L    +S 
Sbjct: 262 LTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISD 321

Query: 119 CSNLMSFPELFYNIKELSLDGTAINELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKS 178
            S + S  +L    + L      ++++ S +  L+ +  L+ G++ ++  L   +  L  
Sbjct: 322 ISPVSSLTKL----QRLFFANNKVSDVSS-LANLTNINWLSAGHN-QISDLTP-LANLTR 374

Query: 179 LQHLNLS 185
           +  L L+
Sbjct: 375 ITQLGLN 381


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.83
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.77
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.29
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.0
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.94
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.88
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.85
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.74
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.66
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.06
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.84
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.55
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.86  E-value=3.1e-22  Score=170.67  Aligned_cols=222  Identities=14%  Similarity=0.129  Sum_probs=152.0

Q ss_pred             CCCceeEecCCCCcc---ccchhhcCCCCCcEEecCC-CCCCCcCC-CCCCCCCCcEeeccccccccccccchhcccCCc
Q 039126           15 PKNLVSPEIPRNSIK---QLWKVVQRLVNLKSINLNH-SEHLTEIP-SLSLATNLESLNFQRYTSLLETHSSIRHLNKFV   89 (295)
Q Consensus        15 ~~~L~~L~l~~~~~~---~l~~~~~~l~~L~~L~L~~-~~~~~~~~-~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~   89 (295)
                      -.+++.|+|+++.+.   .+|..++++++|++|+|++ |.+.+.+| .+.++++|++|++++|...+..+..+..+..|+
T Consensus        49 ~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~  128 (313)
T d1ogqa_          49 TYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLV  128 (313)
T ss_dssp             CCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCC
T ss_pred             cEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhc
Confidence            346888999988776   4778889999999999986 67777888 588899999999998766666666678888888


Q ss_pred             EEccccCcCCceeCCcc-cCccccEEeccCCCCCcccCcCCCC----CceEEccCcccc---------------------
Q 039126           90 ARNLKHCRSLTNLSTSI-HLESLKKLILSGCSNLMSFPELFYN----IKELSLDGTAIN---------------------  143 (295)
Q Consensus        90 ~L~l~~~~~l~~l~~~~-~~~~L~~L~l~~~~~~~~~~~~~~~----L~~L~l~~~~i~---------------------  143 (295)
                      .+++++|.....+|..+ .++.++.+++++|...+.+|..+.+    ++.+++++|.++                     
T Consensus       129 ~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~  208 (313)
T d1ogqa_         129 TLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNM  208 (313)
T ss_dssp             EEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSE
T ss_pred             ccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            88888876666666655 3788888888888777677765442    245566665554                     


Q ss_pred             ---ccchhhhCCCCCcEEecCCCcCCcCcccccCCCCCCCeeeccCCCCCCCchhhhhccCCCCcceeecccccccc-cc
Q 039126          144 ---ELPSSIEYLSKLVILNLGNSSRLEGLPSKICKLKSLQHLNLSCCSNLESFPNELRNLFPCDLYDIEAHWCSSLE-TL  219 (295)
Q Consensus       144 ---~~~~~~~~~~~L~~L~l~~~~~~~~~p~~l~~l~~L~~L~l~~~~~~~~~~~~l~~~~~~~L~~L~l~~~~~l~-~~  219 (295)
                         .+|..++.+++++.+++.+|.....+ ..++.+++|+.|++++|.+.+.+|..+..+  ++|++|+++++. ++ .+
T Consensus       209 ~~~~~~~~~~~~~~l~~l~~~~~~l~~~~-~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L--~~L~~L~Ls~N~-l~g~i  284 (313)
T d1ogqa_         209 LEGDASVLFGSDKNTQKIHLAKNSLAFDL-GKVGLSKNLNGLDLRNNRIYGTLPQGLTQL--KFLHSLNVSFNN-LCGEI  284 (313)
T ss_dssp             EEECCGGGCCTTSCCSEEECCSSEECCBG-GGCCCCTTCCEEECCSSCCEECCCGGGGGC--TTCCEEECCSSE-EEEEC
T ss_pred             ccccccccccccccccccccccccccccc-cccccccccccccCccCeecccCChHHhCC--CCCCEEECcCCc-ccccC
Confidence               22333445556666666666433333 346666777777777776666677777666  677777777654 33 45


Q ss_pred             cccchhhhccCCcccEEeecCCCCCh
Q 039126          220 SGLSIIFTKISRNTQSFDFINCFKLH  245 (295)
Q Consensus       220 ~~~~~~~~~~~~~L~~L~l~~c~~l~  245 (295)
                      |..     ..+++|+.+++.+++.+.
T Consensus       285 P~~-----~~L~~L~~l~l~~N~~l~  305 (313)
T d1ogqa_         285 PQG-----GNLQRFDVSAYANNKCLC  305 (313)
T ss_dssp             CCS-----TTGGGSCGGGTCSSSEEE
T ss_pred             CCc-----ccCCCCCHHHhCCCcccc
Confidence            431     345666666666655443



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure