Citrus Sinensis ID: 039148

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
cEEEEEEEEcccEEEEccccEEEEEEcccccEEEEEEEcccccccEEEccccccccccccHHHHHHHHcccHHHHHHHHccc
ccEEEEEEEcccEEEEcccccEEEEEcccccEEEEEEEcccccccEEHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHc
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIantafgsnpaIVTDMLAKAFQAEKKIVKQLQNTF
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
**LIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAE***********
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQNTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query82 2.2.26 [Sep-21-2011]
Q6K5P8223 Putative germin-like prot yes no 1.0 0.367 0.597 6e-21
Q6K5Q0216 Putative germin-like prot no no 1.0 0.379 0.597 2e-20
P92996222 Germin-like protein subfa no no 1.0 0.369 0.560 6e-20
P92999222 Germin-like protein subfa no no 1.0 0.369 0.560 6e-20
Q9FMA9223 Germin-like protein subfa no no 1.0 0.367 0.560 1e-19
Q9FIC8222 Germin-like protein subfa no no 1.0 0.369 0.536 1e-19
Q9FMA8223 Germin-like protein subfa no no 1.0 0.367 0.573 1e-19
Q6K5P9223 Putative germin-like prot no no 1.0 0.367 0.560 3e-19
Q6YZA9221 Germin-like protein 8-2 O no no 1.0 0.371 0.590 4e-19
Q2QXJ1229 Putative germin-like prot no no 1.0 0.358 0.578 6e-19
>sp|Q6K5P8|GL23_ORYSJ Putative germin-like protein 2-3 OS=Oryza sativa subsp. japonica GN=Os02g0491800 PE=3 SV=1 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/82 (59%), Positives = 59/82 (71%)

Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           N+L   V+ KGDVFVF  GLVHF+ N G  + VAIVA SSQN GV+T+AN  FGS P+I 
Sbjct: 142 NKLFTKVINKGDVFVFPKGLVHFQFNYGTTDAVAIVALSSQNPGVITVANAVFGSKPSIT 201

Query: 61  TDMLAKAFQAEKKIVKQLQNTF 82
            D+LAKAFQ EK +V Q+Q  F
Sbjct: 202 DDILAKAFQVEKTVVDQIQAKF 223
May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q6K5Q0|GL21_ORYSJ Putative germin-like protein 2-1 OS=Oryza sativa subsp. japonica GN=Os02g0491600 PE=3 SV=1 Back     alignment and function description
>sp|P92996|GL120_ARATH Germin-like protein subfamily 1 member 20 OS=Arabidopsis thaliana GN=GLP5A PE=1 SV=1 Back     alignment and function description
>sp|P92999|GL118_ARATH Germin-like protein subfamily 1 member 18 OS=Arabidopsis thaliana GN=GLP2A PE=2 SV=2 Back     alignment and function description
>sp|Q9FMA9|GL110_ARATH Germin-like protein subfamily 1 member 10 OS=Arabidopsis thaliana GN=At5g38930 PE=3 SV=1 Back     alignment and function description
>sp|Q9FIC8|GL116_ARATH Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1 Back     alignment and function description
>sp|Q9FMA8|GL111_ARATH Germin-like protein subfamily 1 member 11 OS=Arabidopsis thaliana GN=At5g38940 PE=2 SV=1 Back     alignment and function description
>sp|Q6K5P9|GL22_ORYSJ Putative germin-like protein 2-2 OS=Oryza sativa subsp. japonica GN=Os02g0491700 PE=3 SV=1 Back     alignment and function description
>sp|Q6YZA9|GL82_ORYSJ Germin-like protein 8-2 OS=Oryza sativa subsp. japonica GN=GER3 PE=2 SV=1 Back     alignment and function description
>sp|Q2QXJ1|GL123_ORYSJ Putative germin-like protein 12-3 OS=Oryza sativa subsp. japonica GN=Os12g0154900 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
225447031 216 PREDICTED: putative germin-like protein 1.0 0.379 0.670 7e-23
225444103 215 PREDICTED: putative germin-like protein 1.0 0.381 0.646 3e-22
357495757 220 Germin-like protein [Medicago truncatula 1.0 0.372 0.634 8e-22
357495753 220 Germin-like protein subfamily 1 member [ 1.0 0.372 0.634 9e-22
357495747 220 Germin-like protein subfamily 1 member [ 1.0 0.372 0.634 9e-22
357495751 220 Germin-like protein subfamily 1 member [ 1.0 0.372 0.634 1e-21
224122138 215 predicted protein [Populus trichocarpa] 1.0 0.381 0.646 1e-21
356528102 215 PREDICTED: putative germin-like protein 1.0 0.381 0.621 1e-21
225450871 207 PREDICTED: germin-like protein 5 [Vitis 1.0 0.396 0.634 1e-21
356535234 232 PREDICTED: germin-like protein subfamily 1.0 0.353 0.646 2e-21
>gi|225447031|ref|XP_002269347.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  111 bits (277), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%)

Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           NRLI  VL+KGDVFVF VGL+HF+ NVGYGN VAI A SSQ  GV+TIAN  FGSN  I 
Sbjct: 135 NRLITKVLQKGDVFVFPVGLIHFQRNVGYGNAVAIAALSSQTPGVITIANAVFGSNAPIA 194

Query: 61  TDMLAKAFQAEKKIVKQLQNTF 82
           +++LAKAFQ +K IV QLQ+ F
Sbjct: 195 SEVLAKAFQVDKNIVDQLQSKF 216

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225444103|ref|XP_002266227.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera] gi|297740868|emb|CBI31050.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357495757|ref|XP_003618167.1| Germin-like protein [Medicago truncatula] gi|355493182|gb|AES74385.1| Germin-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357495753|ref|XP_003618165.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|355493180|gb|AES74383.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|388516901|gb|AFK46512.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357495747|ref|XP_003618162.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|355493177|gb|AES74380.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|388502262|gb|AFK39197.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357495751|ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula] gi|355493179|gb|AES74382.1| Germin-like protein subfamily 1 member [Medicago truncatula] Back     alignment and taxonomy information
>gi|224122138|ref|XP_002330550.1| predicted protein [Populus trichocarpa] gi|222872108|gb|EEF09239.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356528102|ref|XP_003532644.1| PREDICTED: putative germin-like protein 2-1-like [Glycine max] Back     alignment and taxonomy information
>gi|225450871|ref|XP_002284236.1| PREDICTED: germin-like protein 5 [Vitis vinifera] gi|119067552|gb|ABL60874.1| germin-like protein 5 [Vitis vinifera] gi|296089656|emb|CBI39475.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356535234|ref|XP_003536153.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine max] gi|196122016|gb|ACG69482.1| germin-like protein 6 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query82
TAIR|locus:2157200222 AT5G39160 [Arabidopsis thalian 1.0 0.369 0.560 1.9e-19
TAIR|locus:2157230222 GER2 "germin-like protein 2" [ 1.0 0.369 0.560 1.9e-19
TAIR|locus:2152267223 AT5G38940 [Arabidopsis thalian 1.0 0.367 0.573 3.1e-19
TAIR|locus:2177167222 AT5G39130 [Arabidopsis thalian 1.0 0.369 0.536 3.1e-19
TAIR|locus:2152257223 AT5G38930 [Arabidopsis thalian 1.0 0.367 0.560 5.1e-19
TAIR|locus:2177147222 AT5G39110 [Arabidopsis thalian 1.0 0.369 0.524 7.5e-18
TAIR|locus:2177157221 AT5G39120 [Arabidopsis thalian 1.0 0.371 0.524 7.5e-18
TAIR|locus:2177187221 AT5G39150 [Arabidopsis thalian 1.0 0.371 0.524 7.5e-18
TAIR|locus:2074514229 AT3G05950 [Arabidopsis thalian 1.0 0.358 0.512 2e-17
TAIR|locus:2102955227 AT3G04200 [Arabidopsis thalian 1.0 0.361 0.524 2.5e-17
TAIR|locus:2157200 AT5G39160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 232 (86.7 bits), Expect = 1.9e-19, P = 1.9e-19
 Identities = 46/82 (56%), Positives = 57/82 (69%)

Query:     1 NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
             NRL   VL  GDVFVF +G++HF+ NVG    VA    SSQN GV+TIANT FGSNP I 
Sbjct:   138 NRLFAKVLHPGDVFVFPIGMIHFQVNVGKIPAVAFAGLSSQNAGVITIANTVFGSNPPIY 197

Query:    61 TDMLAKAFQAEKKIVKQLQNTF 82
              ++LA+AFQ +  +VK+LQ  F
Sbjct:   198 PELLARAFQLDASVVKELQAKF 219
GO:0005576 "extracellular region" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0030145 "manganese ion binding" evidence=IEA
GO:0045735 "nutrient reservoir activity" evidence=IEA
GO:0048046 "apoplast" evidence=IEA
TAIR|locus:2157230 GER2 "germin-like protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152267 AT5G38940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177167 AT5G39130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152257 AT5G38930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177147 AT5G39110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177157 AT5G39120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177187 AT5G39150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074514 AT3G05950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102955 AT3G04200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
smart00835146 smart00835, Cupin_1, Cupin 3e-05
pfam00190139 pfam00190, Cupin_1, Cupin 0.002
>gnl|CDD|214845 smart00835, Cupin_1, Cupin Back     alignment and domain information 
 Score = 39.2 bits (92), Expect = 3e-05
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           N++    L++GDVFV   G  HF+ N G  N+   VAF++ +                + 
Sbjct: 72  NKVYDARLREGDVFVVPQGHPHFQVNSGDENLE-FVAFNTNDPNRRFFLAGRNSVLRGLP 130

Query: 61  TDMLAKAFQ 69
            ++LA AF 
Sbjct: 131 PEVLAAAFG 139

This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel). This family contains 11S and 7S plant seed storage proteins, and germins. Plant seed storage proteins provide the major nitrogen source for the developing plant. Length = 146
>gnl|CDD|215780 pfam00190, Cupin_1, Cupin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 82
PLN00212 493 glutelin; Provisional 99.77
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 99.55
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.48
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 99.42
PLN00212493 glutelin; Provisional 99.39
smart00835146 Cupin_1 Cupin. This family represents the conserve 99.24
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 98.14
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 97.76
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 97.61
PRK04190191 glucose-6-phosphate isomerase; Provisional 97.5
COG1917131 Uncharacterized conserved protein, contains double 97.5
PF06560182 GPI: Glucose-6-phosphate isomerase (GPI); InterPro 97.4
COG4101142 Predicted mannose-6-phosphate isomerase [Carbohydr 97.2
PF02373114 JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 97.07
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 97.03
PRK13290125 ectC L-ectoine synthase; Reviewed 96.92
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 96.53
PRK15460478 cpsB mannose-1-phosphate guanyltransferase; Provis 96.44
PF01050151 MannoseP_isomer: Mannose-6-phosphate isomerase; In 96.42
TIGR01479468 GMP_PMI mannose-1-phosphate guanylyltransferase/ma 96.39
PF13621251 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU 96.38
COG3837161 Uncharacterized conserved protein, contains double 96.38
PRK11171266 hypothetical protein; Provisional 96.05
PF08007319 Cupin_4: Cupin superfamily protein; InterPro: IPR0 95.98
PRK11171266 hypothetical protein; Provisional 95.93
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 95.66
PF03079157 ARD: ARD/ARD' family; InterPro: IPR004313 The two 94.74
PF1169985 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. 94.63
TIGR02272 335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 94.35
PF02311136 AraC_binding: AraC-like ligand binding domain; Int 93.43
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 92.8
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 91.76
PRK15457233 ethanolamine utilization protein EutQ; Provisional 91.58
KOG3706 629 consensus Uncharacterized conserved protein [Funct 91.32
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 91.3
PF12852186 Cupin_6: Cupin 91.12
COG1791181 Uncharacterized conserved protein, contains double 91.01
COG3450116 Predicted enzyme of the cupin superfamily [General 89.22
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 87.34
PF13759101 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB 87.15
KOG2107179 consensus Uncharacterized conserved protein, conta 86.85
PRK05341 438 homogentisate 1,2-dioxygenase; Provisional 86.36
PLN02658 435 homogentisate 1,2-dioxygenase 85.19
COG4297163 Uncharacterized protein containing double-stranded 82.08
TIGR00218302 manA mannose-6-phosphate isomerase, class I. The n 81.51
COG3435 351 Gentisate 1,2-dioxygenase [Secondary metabolites b 81.24
PRK14585137 pgaD putative PGA biosynthesis protein; Provisiona 81.12
>PLN00212 glutelin; Provisional Back     alignment and domain information 
Probab=99.77  E-value=1.4e-18  Score=135.19  Aligned_cols=73  Identities=25%  Similarity=0.432  Sum_probs=63.9

Q ss_pred             EeecCCcEEEEccCceeEEEecCCcceEEEEeeecCCCcce--------ee-------------------ccccccCCCC
Q 039148            6 MVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVV--------TI-------------------ANTAFGSNPA   58 (82)
Q Consensus         6 ~~l~~GDv~vfP~G~~H~~~N~G~~~av~i~~~~s~npg~~--------~~-------------------~~~~F~~~p~   58 (82)
                      ++|++||||++|+|++||+||+|++|+++++++|..|+..|        .+                   +.|+|++   
T Consensus       150 ~~lr~GDViaiPaG~~hw~yN~Gd~~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~~~~~~~~~~~~~~nifsG---  226 (493)
T PLN00212        150 HQFRQGDVVALPAGVAHWFYNDGDAPVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVYGRSIEQHSGQNIFSG---  226 (493)
T ss_pred             eEeccCCEEEECCCCeEEEEeCCCCcEEEEEEEeccccccccCCCcceeeccCCCccccccccccccccccCchhhc---
Confidence            58999999999999999999999999999999997764322        11                   2469997   


Q ss_pred             CcHHHHHHHhCCCHHHHHHHHhc
Q 039148           59 IVTDMLAKAFQAEKKIVKQLQNT   81 (82)
Q Consensus        59 ~~~~vLa~af~~d~~~i~kl~~~   81 (82)
                      |++++|++||+++.++++||+++
T Consensus       227 F~~e~La~Afnv~~e~~~klq~~  249 (493)
T PLN00212        227 FSTELLSEALGINAQVAKRLQSQ  249 (493)
T ss_pred             CCHHHHHHHHCCCHHHHHHHhcc
Confidence            99999999999999999999864

>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 Back     alignment and domain information
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase Back     alignment and domain information
>PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A Back     alignment and domain information
>COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] Back     alignment and domain information
>PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>PRK15457 ethanolamine utilization protein EutQ; Provisional Back     alignment and domain information
>KOG3706 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PF12852 Cupin_6: Cupin Back     alignment and domain information
>COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A Back     alignment and domain information
>KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK05341 homogentisate 1,2-dioxygenase; Provisional Back     alignment and domain information
>PLN02658 homogentisate 1,2-dioxygenase Back     alignment and domain information
>COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] Back     alignment and domain information
>TIGR00218 manA mannose-6-phosphate isomerase, class I Back     alignment and domain information
>COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK14585 pgaD putative PGA biosynthesis protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
2et7_A201 Structural And Spectroscopic Insights Into The Mech 7e-13
2ete_A201 Recombinant Oxalate Oxidase In Complex With Glycola 7e-13
1fi2_A201 Crystal Structure Of Germin (Oxalate Oxidase) Lengt 7e-13
>pdb|2ET7|A Chain A, Structural And Spectroscopic Insights Into The Mechanism Of Oxalate Oxidase Length = 201 Back     alignment and structure 
Iteration: 1

 Score = 68.9 bits (167), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%)
Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           N+L   V++ G+ FV   GL+HF+ NVG      +V+F+SQN G+V +  T FGS+P I 
Sbjct: 116 NKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIP 175
Query: 61  TDMLAKAFQAEKKIVKQLQNTF 82
           T +L KA + E  +V+ L++ F
Sbjct: 176 TPVLTKALRVEAGVVELLKSKF 197
>pdb|2ETE|A Chain A, Recombinant Oxalate Oxidase In Complex With Glycolate Length = 201 Back     alignment and structure
>pdb|1FI2|A Chain A, Crystal Structure Of Germin (Oxalate Oxidase) Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query82
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 1e-16
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 1e-15
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 3e-13
1uij_A416 Beta subunit of beta conglycinin; double-stranded 3e-13
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 4e-13
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 1e-04
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 1e-12
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 2e-12
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 3e-12
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 1e-08
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 2e-10
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 6e-04
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 1e-09
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 2e-09
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 7e-09
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 1e-08
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 5e-08
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 4e-06
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 8e-04
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 8e-04
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 Back     alignment and structure
 Score = 69.5 bits (169), Expect = 1e-16
 Identities = 34/82 (41%), Positives = 52/82 (63%)

Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           N+L   V++ G+ FV   GL+HF+ NVG      +V+F+SQN G+V +  T FGS+P I 
Sbjct: 116 NKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIP 175

Query: 61  TDMLAKAFQAEKKIVKQLQNTF 82
           T +L KA + E  +V+ L++ F
Sbjct: 176 TPVLTKALRVEAGVVELLKSKF 197
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 99.83
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.8
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.79
3ksc_A 496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.79
3qac_A 465 11S globulin SEED storage protein; 11S SEED storag 99.79
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.78
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.77
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.75
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 99.74
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 99.73
3c3v_A 510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.73
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 99.73
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 99.72
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 99.72
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 99.71
3fz3_A 531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.71
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.7
3s7i_A418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 99.68
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 99.67
3kgl_A 466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 99.67
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 99.67
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, dom 99.66
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 99.66
1uij_A416 Beta subunit of beta conglycinin; double-stranded 99.65
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 99.64
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 99.63
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, pla 99.63
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 99.62
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 99.43
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 99.16
1dgw_Y93 Canavalin; duplicated swiss-roll beta barrels, loo 99.09
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 99.03
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 98.81
3h8u_A125 Uncharacterized conserved protein with double-STR 98.07
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 97.86
2ozi_A98 Hypothetical protein RPA4178; APC6210, putative pr 97.81
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 97.8
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupi 97.76
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 97.76
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic b 97.74
1v70_A105 Probable antibiotics synthesis protein; structural 97.68
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 97.67
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 97.64
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 97.61
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 97.57
3lag_A98 Uncharacterized protein RPA4178; functionally unkn 97.51
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 97.5
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 97.48
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 97.47
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 97.46
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 97.45
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 97.41
1vj2_A126 Novel manganese-containing cupin TM1459; structura 97.39
3nw4_A 368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 97.36
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 97.35
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 97.34
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 97.32
4i4a_A128 Similar to unknown protein; structural genomics, P 97.31
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 97.31
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 97.28
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 97.24
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 97.23
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 97.22
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 97.14
1vr3_A191 Acireductone dioxygenase; 13543033, structural gen 97.14
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 97.1
1zrr_A179 E-2/E-2' protein; nickel, cupin, beta helix, methi 96.99
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 96.95
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 96.93
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 96.91
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, 96.89
1sef_A274 Conserved hypothetical protein; structural genomic 96.89
2q30_A110 Uncharacterized protein; double-stranded beta-heli 96.89
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 96.85
3lwc_A119 Uncharacterized protein; structural genomics, unkn 96.82
1sfn_A246 Conserved hypothetical protein; structural genomic 96.79
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 96.77
3d82_A102 Cupin 2, conserved barrel domain protein; structur 96.65
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 96.58
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 96.54
3eqe_A171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 96.52
4axo_A151 EUTQ, ethanolamine utilization protein; structural 96.51
1rc6_A261 Hypothetical protein YLBA; structural genomics, NY 96.44
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 96.43
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 96.43
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 96.41
1juh_A 350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 96.28
1sef_A274 Conserved hypothetical protein; structural genomic 96.26
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 96.12
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 96.07
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 96.03
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 95.94
4gjz_A235 Lysine-specific demethylase 8; JMJC, beta barrel, 95.82
1vrb_A342 Putative asparaginyl hydroxylase; 2636534, structu 95.79
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro 95.73
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 95.7
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 95.67
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 95.3
2arc_A164 ARAC, arabinose operon regulatory protein; transcr 95.21
3bcw_A123 Uncharacterized protein; structural genomics, join 95.19
2yu1_A 451 JMJC domain-containing histone demethylation PROT; 95.13
3al5_A338 HTYW5, JMJC domain-containing protein C2ORF60; tRN 94.98
3d8c_A349 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 94.97
3k3o_A371 PHF8, PHD finger protein 8; histone demethylase, c 94.86
3kv5_D488 JMJC domain-containing histone demethylation prote 94.76
4diq_A 489 Lysine-specific demethylase NO66; structural genom 94.7
3rns_A227 Cupin 2 conserved barrel domain protein; structura 94.69
3kv9_A397 JMJC domain-containing histone demethylation prote 94.62
3pua_A392 GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe 94.52
4h7l_A157 Uncharacterized protein; structural genomics, PSI- 94.44
2y0o_A175 Probable D-lyxose ketol-isomerase; carbohydrate me 94.27
2gm6_A208 Cysteine dioxygenase type I; structural genomics, 94.17
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 93.96
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 93.81
1sfn_A246 Conserved hypothetical protein; structural genomic 93.6
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 93.43
3eln_A200 Cysteine dioxygenase type 1; peroxysulfenate, non- 93.27
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 93.11
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 93.08
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 93.07
3rns_A227 Cupin 2 conserved barrel domain protein; structura 93.01
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 92.87
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 92.45
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 92.41
3ebr_A159 Uncharacterized RMLC-like cupin; structural genomi 92.23
2xdv_A 442 MYC-induced nuclear antigen; ribosome biogenesis, 92.17
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 91.34
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 89.66
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 89.47
3uss_A211 Putative uncharacterized protein; cupin, three his 88.44
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 87.27
2xxz_A332 Lysine-specific demethylase 6B; oxidoreductase, hi 86.07
3cjx_A165 Protein of unknown function with A cupin-like FOL; 85.04
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 83.59
3gbg_A 276 TCP pilus virulence regulatory protein; cupin, hel 82.04
3avr_A 531 Lysine-specific demethylase 6A; cupin superfamily, 81.91
1zx5_A300 Mannosephosphate isomerase, putative; STRU genomic 81.73
1qwr_A319 Mannose-6-phosphate isomerase; structural genomics 80.89
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 80.12
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
Probab=99.83  E-value=1.3e-20  Score=128.99  Aligned_cols=82  Identities=41%  Similarity=0.681  Sum_probs=78.3

Q ss_pred             CeeEEEeecCCcEEEEccCceeEEEecCCcceEEEEeeecCCCcceeeccccccCCCCCcHHHHHHHhCCCHHHHHHHHh
Q 039148            1 NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQN   80 (82)
Q Consensus         1 n~~~~~~l~~GDv~vfP~G~~H~~~N~G~~~av~i~~~~s~npg~~~~~~~~F~~~p~~~~~vLa~af~~d~~~i~kl~~   80 (82)
                      +++++.+|++||+++||+|+.|+++|.|++++++++++++++||.+.++.++|+++|++++++|+++|++++++|++||+
T Consensus       116 ~~~~~~~l~~GD~~~iP~g~~H~~~N~g~~~~~~l~v~~~~~p~~~~~~~~~~~~~~~~~~~vl~~af~~~~~~v~~l~~  195 (201)
T 1fi2_A          116 NKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKS  195 (201)
T ss_dssp             TCEEEEEEETTCEEEECTTCCEEEEECSSSCEEEEEEESSSCCCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHH
T ss_pred             CeEEEEEECCCCEEEECCCCeEEEEeCCCCCEEEEEEECCCCCCeEehhhHHhcCCCCCCHHHHHHHHCcCHHHHHHHHH
Confidence            35678999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cC
Q 039148           81 TF   82 (82)
Q Consensus        81 ~f   82 (82)
                      +|
T Consensus       196 ~~  197 (201)
T 1fi2_A          196 KF  197 (201)
T ss_dssp             HS
T ss_pred             hh
Confidence            75
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} Back     alignment and structure
>4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} Back     alignment and structure
>1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* Back     alignment and structure
>1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A Back     alignment and structure
>3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* Back     alignment and structure
>3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... Back     alignment and structure
>3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* Back     alignment and structure
>3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* Back     alignment and structure
>4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} Back     alignment and structure
>2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} Back     alignment and structure
>2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} Back     alignment and structure
>2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>2xxz_A Lysine-specific demethylase 6B; oxidoreductase, histone demethylation, oxygenase, chromatin modification; HET: 8XQ; 1.80A {Homo sapiens} Back     alignment and structure
>3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} Back     alignment and structure
>3avr_A Lysine-specific demethylase 6A; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} PDB: 3avs_A* Back     alignment and structure
>1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 Back     alignment and structure
>1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 82
d2et1a1201 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare 1e-20
d1j58a_372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 9e-15
d1j58a_ 372 b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B 7e-06
d1uika2185 b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb 1e-11
g1dgw.1168 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea 4e-11
d1uija1170 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea 2e-09
d1fxza2174 b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb 5e-09
d1dgwa_178 b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( 2e-07
d1od5a2173 b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb 2e-07
d1uika1203 b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb 8e-06
d2phla2162 b.82.1.2 (A:220-381) Seed storage 7S protein {Fren 1e-05
d2phla1200 b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc 0.001
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

 Score = 78.8 bits (194), Expect = 1e-20
 Identities = 34/82 (41%), Positives = 52/82 (63%)

Query: 1   NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIV 60
           N+L   V++ G+ FV   GL+HF+ NVG      +V+F+SQN G+V +  T FGS+P I 
Sbjct: 116 NKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIP 175

Query: 61  TDMLAKAFQAEKKIVKQLQNTF 82
           T +L KA + E  +V+ L++ F
Sbjct: 176 TPVLTKALRVEAGVVELLKSKF 197
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query82
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 99.95
d1od5a1245 Seed storage 7S protein {Soybean (Glycine max), gl 99.8
d1fxza1239 Seed storage 7S protein {Soybean (Glycine max), pr 99.78
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 99.75
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 99.74
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 99.71
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 99.68
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 99.68
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 99.63
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 99.63
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 99.62
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 99.6
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.59
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 99.25
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 98.13
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 98.06
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 97.96
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 97.88
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 97.87
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 97.62
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 97.56
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 97.48
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 97.44
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 97.37
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 97.33
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 97.22
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 97.12
d2phda1 351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 97.1
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 96.93
d1zrra1179 Acireductone dioxygenase {Klebsiella pneumoniae [T 96.8
d1vrba1319 Putative asparaginyl hydroxylase YxbC {Bacillus su 96.63
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 96.47
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 96.35
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.3
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 96.24
d1vr3a1179 Acireductone dioxygenase {Mouse (Mus musculus) [Ta 96.16
d2pyta1128 Ethanolamine utilization protein EutQ {Salmonella 96.14
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 96.1
d3bu7a1355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 95.82
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 95.7
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 95.63
d3bu7a1 355 Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ 95.48
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxI 95.41
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 95.21
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 94.88
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 94.66
d2arca_161 Regulatory protein AraC {Escherichia coli [TaxId: 94.42
d1h2ka_335 Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum 94.29
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 92.78
d1zx5a1299 Putative mannosephosphate isomerase AF0035 {Archae 86.61
d2gm6a1192 Cysteine dioxygenase type I {Ralstonia eutropha [T 84.05
d1qwra_315 Mannose-6-phosphate isomerase ManA {Bacillus subti 81.55
d1eyba_ 439 Homogentisate dioxygenase {Human (Homo sapiens) [T 80.22
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: Germin/Seed storage 7S protein
domain: Germin
species: Barley (Hordeum vulgare) [TaxId: 4513]

Probab=99.95  E-value=1.3e-28  Score=169.89  Aligned_cols=82  Identities=41%  Similarity=0.681  Sum_probs=80.1

Q ss_pred             CeeEEEeecCCcEEEEccCceeEEEecCCcceEEEEeeecCCCcceeeccccccCCCCCcHHHHHHHhCCCHHHHHHHHh
Q 039148            1 NRLIIMVLKKGDVFVFLVGLVHFKCNVGYGNVVAIVAFSSQNLGVVTIANTAFGSNPAIVTDMLAKAFQAEKKIVKQLQN   80 (82)
Q Consensus         1 n~~~~~~l~~GDv~vfP~G~~H~~~N~G~~~av~i~~~~s~npg~~~~~~~~F~~~p~~~~~vLa~af~~d~~~i~kl~~   80 (82)
                      |++|+++|++||+|+||+|++||++|.|+++++++++|+|+|||.+.++..+|+++|+||+|||+++|++|+++++|||+
T Consensus       116 ~~~~~~~l~~GDv~vvP~G~~H~~~N~g~~~a~~i~~f~s~~pg~~~~~~~~f~~~~~~p~eVLa~af~i~~~~v~kLks  195 (201)
T d2et1a1         116 NKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKS  195 (201)
T ss_dssp             TCEEEEEECTTCEEEECTTCCEEEEECSSSCEEEEEEESSSCCCCEEHHHHHHHCSSCCCHHHHHHHHTSCHHHHHHHHH
T ss_pred             ceeEEEEecCCCEEEECCCCeEEEEEcCCCCEEEEEEecCCCCcceehhhhhhccCCCCCHHHHHHHhCCCHHHHHHHHh
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cC
Q 039148           81 TF   82 (82)
Q Consensus        81 ~f   82 (82)
                      +|
T Consensus       196 ~f  197 (201)
T d2et1a1         196 KF  197 (201)
T ss_dssp             TT
T ss_pred             hc
Confidence            87
>d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx5a1 b.82.1.3 (A:1-299) Putative mannosephosphate isomerase AF0035 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} Back     information, alignment and structure
>d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure