Citrus Sinensis ID: 039195

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MPLEEFDYYLNVSMVHIAMLARATPSHSTVSPLSVSQLPQKPFSGKVELVFICPRSYQSKGDKGYSVCCFCKTKDAEIDKIEDKEQDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSWKE
cccccccEEEEEEEEEEEEEcccccccccccccEEEccccccccccEEEEEEcccccccccccccEEEEEEEcccHHHHccccccccccccccHHHHHHHHHcccccccccccccccEEEEccccEEEEEcHHHHHHHcccEEEEEEEEEccccccccccccccccccccccccEEEEEEcccHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEccccccccccccEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEccccccEEEEcHHHHHHHHccEEEEEEEEccccccccccEEEEEccccccccccEEEEEEccccHHccEEEcccc
mpleefdyYLNVSMVHIAMLAratpshstvsplsvsqlpqkpfsgkvelvficprsyqskgdkgysvccfcktkdaeidkiedkeqderppfdINLAVILAGFafeayttppesvgrkevdvaGCKTVYLSESFAHEMYDGQLFIKLekcfnlpamdpwithacstgflgtsdpyvVMELDGQEIRMKCWWSWKE
MPLEEFDYYLNVSMVHIAMLARATPSHSTVSPLSVSQLPQKPFSGKVELVFICPRsyqskgdkgysvCCFCKTKDAEIDKiedkeqderppFDINLAVILAGFAFEAYttppesvgrkevdvAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSWKE
MPLEEFDYYLNVSMVHIAMLARATPSHSTVSPLSVSQLPQKPFSGKVELVFICPRSYQSKGDKGYSVCCFCktkdaeidkiedkeqdeRPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSWKE
*****FDYYLNVSMVHIAMLARA*******************FSGKVELVFICPRSYQSKGDKGYSVCCFCKTKDAEID***********PFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSW**
*PLEEFDYYLNVSMVHIAMLARATPS**TV****VSQLPQKPFSGKVELVFICPRSYQSKGDKGYS***************************INLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIR*********
MPLEEFDYYLNVSMVHIAMLARA*************QLPQKPFSGKVELVFICPRSYQSKGDKGYSVCCFCKTKDAEIDKIEDKEQDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSWKE
MPLEEFDYYLNVSMVHIAMLARATPSHS***PLSVSQLPQKPFSGKVELVFICPRSYQSKGDKGYSVCCFCKTKD**IDKI****QDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWW****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLEEFDYYLNVSMVHIAMLARATPSHSTVSPLSVSQLPQKPFSGKVELVFICPRSYQSKGDKGYSVCCFCKTKDAEIDKIEDKEQDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDVAGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSWKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
357439857 1019 hypothetical protein MTR_1g045930 [Medic 0.625 0.119 0.586 7e-39
224107575 552 predicted protein [Populus trichocarpa] 0.441 0.155 0.75 9e-35
218195187 889 hypothetical protein OsI_16594 [Oryza sa 0.497 0.109 0.588 9e-31
242073674 895 hypothetical protein SORBIDRAFT_06g02216 0.497 0.108 0.570 4e-30
413918883 697 hypothetical protein ZEAMMB73_298032 [Ze 0.502 0.140 0.564 5e-30
326504440 859 predicted protein [Hordeum vulgare subsp 0.558 0.126 0.525 3e-28
357164616 879 PREDICTED: uncharacterized protein LOC10 0.523 0.116 0.535 6e-28
224100007158 predicted protein [Populus trichocarpa] 0.692 0.854 0.433 4e-25
115459352 888 Os04g0509100 [Oryza sativa Japonica Grou 0.369 0.081 0.694 1e-24
168061670 909 predicted protein [Physcomitrella patens 0.492 0.105 0.469 2e-20
>gi|357439857|ref|XP_003590206.1| hypothetical protein MTR_1g045930 [Medicago truncatula] gi|355479254|gb|AES60457.1| hypothetical protein MTR_1g045930 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  165 bits (418), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 78/133 (58%), Positives = 98/133 (73%), Gaps = 11/133 (8%)

Query: 63  KGYSVCCFCKTKDAEIDKIEDKEQDERPPFDINLAVILAGFAFEAYTTPPESVGRKEVDV 122
           +G+S+CC  KT D++I+K  +++ DERPPFDINLAVILAGFAFEAYTTPPE++GR+EVD 
Sbjct: 50  QGFSICCSSKT-DSQIEKSSNEKNDERPPFDINLAVILAGFAFEAYTTPPENLGRREVDA 108

Query: 123 AGCKTVYLSESFAHEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDG 182
           AG KT+YLSE F  E+YDGQ+FIKL+K    PAMDPW          GTSDPYVV+++  
Sbjct: 109 AGTKTIYLSEEFFREIYDGQIFIKLKKGSRFPAMDPW----------GTSDPYVVVQMGS 158

Query: 183 QEIRMKCWWSWKE 195
           Q  +    W  KE
Sbjct: 159 QTAKSNIKWGTKE 171

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224107575|ref|XP_002314524.1| predicted protein [Populus trichocarpa] gi|222863564|gb|EEF00695.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|218195187|gb|EEC77614.1| hypothetical protein OsI_16594 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|242073674|ref|XP_002446773.1| hypothetical protein SORBIDRAFT_06g022160 [Sorghum bicolor] gi|241937956|gb|EES11101.1| hypothetical protein SORBIDRAFT_06g022160 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|413918883|gb|AFW58815.1| hypothetical protein ZEAMMB73_298032 [Zea mays] Back     alignment and taxonomy information
>gi|326504440|dbj|BAJ91052.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|357164616|ref|XP_003580112.1| PREDICTED: uncharacterized protein LOC100834372 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|224100007|ref|XP_002311707.1| predicted protein [Populus trichocarpa] gi|222851527|gb|EEE89074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|115459352|ref|NP_001053276.1| Os04g0509100 [Oryza sativa Japonica Group] gi|32488294|emb|CAE03360.1| OSJNBb0065L13.3 [Oryza sativa Japonica Group] gi|113564847|dbj|BAF15190.1| Os04g0509100 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|168061670|ref|XP_001782810.1| predicted protein [Physcomitrella patens subsp. patens] gi|162665712|gb|EDQ52387.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
pfam0016885 pfam00168, C2, C2 domain 0.001
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information 
 Score = 36.5 bits (85), Expect = 0.001
 Identities = 15/46 (32%), Positives = 19/46 (41%), Gaps = 10/46 (21%)

Query: 143 LFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMK 188
           L + +    NLP  D            G SDPYV + L GQ+   K
Sbjct: 1   LRVTVISAKNLPPKDL----------NGKSDPYVKVSLGGQKKDTK 36

Length = 85

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 98.8
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 98.71
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 98.69
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 98.68
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 98.65
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 98.64
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 98.64
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 98.62
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 98.62
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 98.56
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 98.56
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 98.55
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 98.54
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 98.52
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 98.48
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 98.48
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 98.46
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 98.46
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 98.45
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 98.44
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 98.41
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 98.38
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 98.37
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 98.35
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 98.35
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 98.33
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 98.3
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 98.3
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 98.27
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 98.27
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 98.25
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 98.23
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 98.21
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 98.2
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 98.2
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 98.19
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 98.17
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 98.16
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 98.16
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 98.15
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 98.14
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 98.12
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 98.11
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 98.11
PLN032002102 cellulose synthase-interactive protein; Provisiona 98.11
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 98.11
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 98.1
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 98.1
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 98.1
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 98.09
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 98.08
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 98.07
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 98.06
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 98.05
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 98.05
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 98.05
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 98.04
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 98.02
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 98.02
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 98.01
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 97.99
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 97.97
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 97.97
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 97.94
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 97.94
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 97.92
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 97.89
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 97.85
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 97.83
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 97.77
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 97.76
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 97.73
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 97.73
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 97.71
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 97.67
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 97.66
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 97.55
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 97.43
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 97.38
PLN03008 868 Phospholipase D delta 96.97
cd00030102 C2 C2 domain. The C2 domain was first identified i 96.59
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 96.56
KOG0696 683 consensus Serine/threonine protein kinase [Signal 96.56
KOG1028 421 consensus Ca2+-dependent phospholipid-binding prot 96.37
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 96.01
KOG1028421 consensus Ca2+-dependent phospholipid-binding prot 94.95
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 94.7
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 94.56
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 94.54
KOG1326 1105 consensus Membrane-associated protein FER-1 and re 94.18
KOG1011 1283 consensus Neurotransmitter release regulator, UNC- 93.15
KOG1030 168 consensus Predicted Ca2+-dependent phospholipid-bi 92.29
PLN02270 808 phospholipase D alpha 91.51
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 90.81
KOG1328 1103 consensus Synaptic vesicle protein BAIAP3, involve 88.75
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 82.07
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 81.74
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information 
Probab=98.80  E-value=1e-08  Score=79.13  Aligned_cols=42  Identities=14%  Similarity=0.179  Sum_probs=38.9

Q ss_pred             ceeEEEEEEeecCCCCCCccccccccCCCCCCCCceEEEEecCeeEEEeeeec
Q 039195          140 DGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWS  192 (195)
Q Consensus       140 ~G~L~V~Vvra~nLp~~D~~~~~a~~~~~gGsSDPYVVL~l~~Q~~Kt~v~w~  192 (195)
                      .|.|.|+|++|++|+..| +          |+|||||+|++++|+.||++...
T Consensus         1 ~g~L~v~v~~Ak~l~~~~-~----------g~sDPYv~i~lg~~~~kT~v~~~   42 (121)
T cd04016           1 VGRLSITVVQAKLVKNYG-L----------TRMDPYCRIRVGHAVYETPTAYN   42 (121)
T ss_pred             CcEEEEEEEEccCCCcCC-C----------CCCCceEEEEECCEEEEeEEccC
Confidence            489999999999999888 7          89999999999999999999764

Tollip is a part of the Interleukin-1 receptor (IL-1R) signaling pathway. Tollip is proposed to link serine/threonine kinase IRAK to IL-1Rs as well as inhibiting phosphorylation of IRAK. There is a single C2 domain present in Tollip. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice varian
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>KOG1028 consensus Ca2+-dependent phospholipid-binding protein Synaptotagmin, required for synaptic vesicle and secretory granule exocytosis [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1326 consensus Membrane-associated protein FER-1 and related ferlins, contain multiple C2 domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1011 consensus Neurotransmitter release regulator, UNC-13 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1030 consensus Predicted Ca2+-dependent phospholipid-binding protein [General function prediction only] Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1328 consensus Synaptic vesicle protein BAIAP3, involved in vesicle priming/regulation [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 4e-06
3m7f_B 176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 1e-05
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 9e-05
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 1e-04
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 1e-04
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 1e-04
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 2e-04
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-04
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 2e-04
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 4e-04
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 6e-04
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 7e-04
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 7e-04
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 9e-04
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
 Score = 43.5 bits (103), Expect = 4e-06
 Identities = 12/48 (25%), Positives = 16/48 (33%), Gaps = 10/48 (20%)

Query: 141 GQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMK 188
           G L + L     L   D          FL   DPYV +    Q+ +  
Sbjct: 10  GTLEVVLVSAKGLEDAD----------FLNNMDPYVQLTCRTQDQKSN 47
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 98.87
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 98.8
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 98.72
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 98.71
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 98.63
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 98.62
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 98.59
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 98.59
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 98.58
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 98.55
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 98.51
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 98.51
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 98.51
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 98.51
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 98.5
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.5
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 98.5
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 98.49
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 98.48
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.48
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.47
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 98.47
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 98.45
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 98.44
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.43
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 98.42
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 98.4
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 98.4
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 98.38
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 98.37
3nsj_A 540 Perforin-1; pore forming protein, immune system; H 98.36
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 98.31
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 98.3
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 98.27
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.27
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 97.98
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 97.94
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 97.92
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 97.87
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 97.66
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.52
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 97.48
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 95.67
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 95.63
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 95.31
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 93.97
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
Probab=98.87  E-value=3e-09  Score=78.55  Aligned_cols=48  Identities=25%  Similarity=0.369  Sum_probs=42.3

Q ss_pred             hhhcceeEEEEEEeecCCCCCCccccccccCCCCCCCCceEEEEecCeeEEEeeeecc
Q 039195          136 HEMYDGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSW  193 (195)
Q Consensus       136 rE~y~G~L~V~Vvra~nLp~~D~~~~~a~~~~~gGsSDPYVVL~l~~Q~~Kt~v~w~~  193 (195)
                      ++++.|.|.|+|++|.||+..|..          |.+||||++.+++++.||+++..|
T Consensus        12 ~~~~~~~L~V~v~~a~~L~~~d~~----------g~~dpyv~v~~~~~~~kT~~~~~t   59 (148)
T 3kwu_A           12 TSKWSAKISITVVCAQGLQAKDKT----------GSSDPYVTVQVGKTKKRTKTIYGN   59 (148)
T ss_dssp             ---CCEEEEEEEEEEESCCCCSTT----------SCCCEEEEEEETTEEEECCCCCSC
T ss_pred             ccccccEEEEEEEeeeCCCCCCCC----------CCcCeEEEEEECCEEEECCccCCC
Confidence            456789999999999999999988          899999999999999999997665
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d2ep6a1126 b.7.1.1 (A:92-217) Multiple C2 and transmembrane d 0.002
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 0.003
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.8 bits (79), Expect = 0.002
 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 10/51 (19%)

Query: 141 GQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWW 191
           G L +K+ K  +L A D          F G SDP+ ++EL    ++    +
Sbjct: 6   GILQVKVLKAADLLAAD----------FSGKSDPFCLLELGNDRLQTHTVY 46
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 98.98
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 98.75
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 98.73
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.65
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 98.62
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 98.59
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.48
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 98.47
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 98.41
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 98.38
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 98.27
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 98.19
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.17
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.15
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 98.14
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 98.09
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.02
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 97.88
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 96.39
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 94.94
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Multiple C2 and transmembrane domain-containing protein 2, MCTP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.98  E-value=2.9e-10  Score=81.65  Aligned_cols=44  Identities=30%  Similarity=0.419  Sum_probs=40.8

Q ss_pred             ceeEEEEEEeecCCCCCCccccccccCCCCCCCCceEEEEecCeeEEEeeeecc
Q 039195          140 DGQLFIKLEKCFNLPAMDPWITHACSTGFLGTSDPYVVMELDGQEIRMKCWWSW  193 (195)
Q Consensus       140 ~G~L~V~Vvra~nLp~~D~~~~~a~~~~~gGsSDPYVVL~l~~Q~~Kt~v~w~~  193 (195)
                      .|.|.|+|++|+||+.+|..          |++||||++++++|+.||+++-.|
T Consensus         5 ~G~L~V~v~~A~~L~~~d~~----------g~~Dpyv~v~~~~~~~~T~~~~~t   48 (126)
T d2ep6a1           5 VGILQVKVLKAADLLAADFS----------GKSDPFCLLELGNDRLQTHTVYKN   48 (126)
T ss_dssp             SEEEEEEEEEEESCCCSSSS----------SCCCEEEEEEETTEEEECCCCSSC
T ss_pred             cEEEEEEEEEeECCCCCCCC----------CCcCeEEEEEcCCeEEEEEeeCCc
Confidence            39999999999999999988          899999999999999999987655
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure