Citrus Sinensis ID: 039288

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
cccHHHHHHHHHHcccccccEEEEEEEEcccccccccEEEEEccccccHHHHHccccccccccccEEEEEEEEEEEccccccccccccHHHHHHHHEEEEEEEEccccccHHHHHHHHHHHHHHccEEEEEEEEEccc
ccccEEEEEHHEccccccccEEEEEEcccccHcccccHHHHcccccccHHHHHHHHcccHHcccccccEEEEEHEEccccccccccHHHHHHHHHHHEEcEEEEEcHHHHHHHHHHHHHHHHHHcccEEEEEEEEccc
MPGLTAYANLFenfspkmgeEYVFISAAFSSVyrsgfddafnykeelDLNATLKrsvrffptchQTAALRFCEMTsqynldlpenVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
*****AYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE**************
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRK*QL***
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
*PGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGLTAYANLFENFSPKMGEEYVFISAAFSSVYRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQTAALRFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREKARLSMRKAQLKDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q6WAU0342 (+)-pulegone reductase OS N/A no 0.869 0.350 0.387 2e-22
Q39173343 NADP-dependent alkenal do no no 0.869 0.349 0.375 4e-22
Q39172345 NADP-dependent alkenal do no no 0.869 0.347 0.375 2e-21
Q9C0Y6349 Zinc-type alcohol dehydro no no 0.811 0.320 0.268 0.0003
>sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 Back     alignment and function desciption
 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/173 (38%), Positives = 83/173 (47%), Gaps = 53/173 (30%)

Query: 1   MPGLTAYANLFENFSPKMGEEYVFISAAFSSVY--------------------------- 33
           MPG+TAYA  FE  SPK GE  VF++AA  SV                            
Sbjct: 135 MPGMTAYAGFFEICSPKKGET-VFVTAAAGSVGQLVGQFAKMFGCYVVGSAGSKEKVDLL 193

Query: 34  --RSGFDDAFNYKEELDLNATLKRSVRFFP--------------------TCHQTAALRF 71
             + GFDDAFNYKEE D +  LKR    FP                           +  
Sbjct: 194 KNKFGFDDAFNYKEESDYDTALKR---HFPEGIDIYFDNVGGKMLEAVINNMRVHGRIAV 250

Query: 72  CEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE 124
           C M SQY+L  PE VHNL+ ++  + RMQGF+V DY  +YP+FLEM+LP I+E
Sbjct: 251 CGMVSQYSLKQPEGVHNLLKLIPKQIRMQGFVVVDYYHLYPKFLEMVLPRIKE 303
Monoterpene synthase that catalyzes the specific reduction of the 4,8-double bond of (+)-pulegone to produce both (-)-menthone and (+)-isomenthone in a 70:30 ratio. Unable to utilize either (-)-isopiperitenone or (+)-cis-isopulegone, or to catalyze the reverse reaction with (-)-menthone or (+)-isomenthone. Has an absolute requirement for NADPH.
Mentha piperita (taxid: 34256)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 8EC: 1
>sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 Back     alignment and function description
>sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 Back     alignment and function description
>sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
224117858 348 predicted protein [Populus trichocarpa] 0.869 0.344 0.398 2e-23
356504476 343 PREDICTED: NADP-dependent alkenal double 0.898 0.361 0.415 2e-23
255577883 269 alcohol dehydrogenase, putative [Ricinus 0.869 0.446 0.404 3e-23
255648265 343 unknown [Glycine max] 0.898 0.361 0.415 5e-23
346465005 314 hypothetical protein [Amblyomma maculatu 0.869 0.382 0.398 1e-22
224117874 348 predicted protein [Populus trichocarpa] 0.869 0.344 0.387 2e-22
255577885 332 alcohol dehydrogenase, putative [Ricinus 0.876 0.364 0.437 3e-22
388506034 322 unknown [Lotus japonicus] 0.891 0.381 0.411 8e-22
225434189 345 PREDICTED: NADP-dependent alkenal double 0.869 0.347 0.398 9e-22
308943732 347 alcohol dehydrogenase [Camellia sinensis 0.862 0.342 0.412 1e-21
>gi|224117858|ref|XP_002331649.1| predicted protein [Populus trichocarpa] gi|222874045|gb|EEF11176.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/173 (39%), Positives = 90/173 (52%), Gaps = 53/173 (30%)

Query: 1   MPGLTAYANLFENFSPKMGEEYVFISAAFSSVY--------------------------- 33
           MPGLTAYA  +E  SPK GE +VFISAA  +V                            
Sbjct: 141 MPGLTAYAGFYEICSPKKGE-FVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL 199

Query: 34  --RSGFDDAFNYKEELDLNATLKRSVRFFPTCHQT--------------------AALRF 71
             + GFDDAFNYKEELDL+A LKR   +FP                           +  
Sbjct: 200 KNKFGFDDAFNYKEELDLDAALKR---YFPDGIDIYFENVGGKMLDAVVLNMRVRGRISV 256

Query: 72  CEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE 124
           C M SQYNL+ PE VHNLM +V  R  M+GF+V+D+  ++P++L+M+LPYI++
Sbjct: 257 CGMVSQYNLEQPEGVHNLMHLVPKRIHMEGFLVYDFFHLFPKYLDMVLPYIKQ 309

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356504476|ref|XP_003521022.1| PREDICTED: NADP-dependent alkenal double bond reductase P1-like [Glycine max] Back     alignment and taxonomy information
>gi|255577883|ref|XP_002529814.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530691|gb|EEF32563.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255648265|gb|ACU24585.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|346465005|gb|AEO32347.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|224117874|ref|XP_002331653.1| predicted protein [Populus trichocarpa] gi|222874049|gb|EEF11180.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577885|ref|XP_002529815.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530692|gb|EEF32564.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388506034|gb|AFK41083.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225434189|ref|XP_002279359.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147792339|emb|CAN61471.1| hypothetical protein VITISV_043825 [Vitis vinifera] Back     alignment and taxonomy information
>gi|308943732|gb|ADO51748.1| alcohol dehydrogenase [Camellia sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2097795350 AT3G03080 [Arabidopsis thalian 0.384 0.151 0.528 1.6e-24
TAIR|locus:505006405346 AT3G59845 [Arabidopsis thalian 0.391 0.156 0.444 1.7e-22
TAIR|locus:2148116346 AT5G16960 [Arabidopsis thalian 0.384 0.153 0.490 6e-22
UNIPROTKB|Q6WAU0342 Q6WAU0 "(+)-pulegone reductase 0.702 0.283 0.382 3.4e-19
TAIR|locus:2148166343 AT5G16990 [Arabidopsis thalian 0.673 0.271 0.4 3.2e-18
TAIR|locus:2148186345 AT5G17000 [Arabidopsis thalian 0.673 0.269 0.39 1.2e-17
TAIR|locus:2148131345 AER "alkenal reductase" [Arabi 0.673 0.269 0.38 2.6e-17
TAIR|locus:2154041353 AT5G38000 [Arabidopsis thalian 0.673 0.263 0.38 4.7e-15
TAIR|locus:2153799353 AT5G37940 [Arabidopsis thalian 0.673 0.263 0.37 1e-14
TAIR|locus:2034109350 AT1G65560 [Arabidopsis thalian 0.405 0.16 0.315 5.9e-13
TAIR|locus:2097795 AT3G03080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 148 (57.2 bits), Expect = 1.6e-24, Sum P(3) = 1.6e-24
 Identities = 28/53 (52%), Positives = 38/53 (71%)

Query:    72 CEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE 124
             C M SQYNL+  E VHNL  V++ R R++GF+V DY   + +FL+ +LPYIRE
Sbjct:   259 CGMISQYNLEDQEGVHNLANVIYKRIRIKGFVVSDYFDKHLKFLDFVLPYIRE 311
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0030036 "actin cytoskeleton organization" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
TAIR|locus:505006405 AT3G59845 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148116 AT5G16960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6WAU0 Q6WAU0 "(+)-pulegone reductase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2148166 AT5G16990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148186 AT5G17000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148131 AER "alkenal reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154041 AT5G38000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153799 AT5G37940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034109 AT1G65560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0170002101
hypothetical protein (349 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis a 1e-35
PLN03154348 PLN03154, PLN03154, putative allyl alcohol dehydro 4e-23
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 8e-22
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 7e-13
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun 4e-12
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 0.002
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information 
 Score =  125 bits (315), Expect = 1e-35
 Identities = 69/176 (39%), Positives = 85/176 (48%), Gaps = 57/176 (32%)

Query: 1   MPGLTAYANLFENFSPKMGEEYVFISAAFSSV-------------Y-------------- 33
           MPGLTAYA  +E   PK GE  VF+SAA  +V             Y              
Sbjct: 134 MPGLTAYAGFYEVCKPKKGE-TVFVSAASGAVGQLVGQLAKLKGCYVVGSAGSDEKVDLL 192

Query: 34  --RSGFDDAFNYKEELDLNATLKRSVRFFP----------------------TCHQTAAL 69
             + GFDDAFNYKEE DL+A LKR   +FP                        H   A 
Sbjct: 193 KNKLGFDDAFNYKEEPDLDAALKR---YFPNGIDIYFDNVGGKMLDAVLLNMNLHGRIAA 249

Query: 70  RFCEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIREK 125
             C M SQYNL+ PE V NL+ +++ R ++QGF+V DY   YPEFLE +  YI+E 
Sbjct: 250 --CGMISQYNLEWPEGVRNLLNIIYKRVKIQGFLVGDYLHRYPEFLEEMSGYIKEG 303

This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism. Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in inflamatory cells, and in other cells by bifunctional LTB4 12-HD/PGR. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 338
>gnl|CDD|215606 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.91
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.86
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 99.75
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.74
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.55
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.51
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.44
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.4
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 99.38
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.34
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.28
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 99.22
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.07
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.03
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 98.97
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 98.97
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 98.92
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 98.86
PLN02827378 Alcohol dehydrogenase-like 98.84
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 98.83
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 98.83
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 98.78
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 98.73
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 98.72
PLN02740381 Alcohol dehydrogenase-like 98.71
PTZ00354334 alcohol dehydrogenase; Provisional 98.71
PRK09880343 L-idonate 5-dehydrogenase; Provisional 98.7
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 98.68
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 98.68
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 98.66
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 98.66
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 98.65
PLN02586360 probable cinnamyl alcohol dehydrogenase 98.63
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 98.62
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 98.61
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 98.6
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 98.58
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 98.57
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 98.57
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 98.56
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 98.55
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 98.54
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 98.51
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 98.5
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 98.49
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 98.49
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 98.49
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 98.48
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 98.48
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 98.47
PLN02178375 cinnamyl-alcohol dehydrogenase 98.47
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 98.46
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 98.46
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 98.46
cd08252336 AL_MDR Arginate lyase and other MDR family members 98.46
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 98.45
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 98.45
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 98.44
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 98.44
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 98.42
cd08251303 polyketide_synthase polyketide synthase. Polyketid 98.37
PLN02514357 cinnamyl-alcohol dehydrogenase 98.37
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 98.36
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 98.35
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 98.35
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 98.34
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 98.34
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 98.34
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 98.33
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 98.32
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 98.32
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 98.32
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 98.31
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 98.31
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 98.29
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 98.26
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 98.25
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 98.25
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 98.25
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 98.24
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 98.22
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 98.22
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 98.2
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 98.17
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 98.12
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 98.12
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 98.07
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 98.07
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 98.06
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 98.06
PRK10083339 putative oxidoreductase; Provisional 98.03
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 98.02
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 98.02
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 98.0
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 97.98
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 97.98
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 97.97
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 97.95
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 97.93
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 97.93
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 97.92
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 97.9
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 97.87
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 97.82
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 97.82
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 97.82
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 97.81
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 97.8
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 97.78
PRK13771334 putative alcohol dehydrogenase; Provisional 97.75
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 97.74
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 97.68
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 97.66
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 97.65
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 97.65
PLN02702364 L-idonate 5-dehydrogenase 97.58
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 97.56
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 97.53
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 97.49
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 97.3
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 97.3
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 97.22
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 97.14
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 97.14
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 97.07
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 97.04
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 95.45
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 81.11
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information 
Probab=99.91  E-value=2.5e-24  Score=157.70  Aligned_cols=127  Identities=39%  Similarity=0.593  Sum_probs=112.3

Q ss_pred             CchHhHHHHHHhhcCCCCCCeEEEEecCCcce--------------------------e---ecCCceEeecCccccHHH
Q 039288            1 MPGLTAYANLFENFSPKMGEEYVFISAAFSSV--------------------------Y---RSGFDDAFNYKEELDLNA   51 (138)
Q Consensus         1 ~~~~TA~~~L~~~~~~~~g~~~VLI~gaaggv--------------------------~---~lGad~vi~~~~~~~~~~   51 (138)
                      ||++|||++|.+.++.++|| +|+|+||||+|                          |   .||+|.+|||+++ ||.+
T Consensus       133 mpG~TAY~gLl~igqpk~Ge-tvvVSaAaGaVGsvvgQiAKlkG~rVVGiaGg~eK~~~l~~~lGfD~~idyk~~-d~~~  210 (340)
T COG2130         133 MPGLTAYFGLLDIGQPKAGE-TVVVSAAAGAVGSVVGQIAKLKGCRVVGIAGGAEKCDFLTEELGFDAGIDYKAE-DFAQ  210 (340)
T ss_pred             CchHHHHHHHHHhcCCCCCC-EEEEEecccccchHHHHHHHhhCCeEEEecCCHHHHHHHHHhcCCceeeecCcc-cHHH
Confidence            79999999999999999999 99999999999                          1   6999999999999 9999


Q ss_pred             HHhhhhccCCCCcc-----------cc---------eeeeeeeeeecCCC-CCcchhcHHHHHhcCeeeeeeeec-cccc
Q 039288           52 TLKRSVRFFPTCHQ-----------TA---------ALRFCEMTSQYNLD-LPENVHNLMFVVFGRSRMQGFIVF-DYSS  109 (138)
Q Consensus        52 ~v~~~~~~t~~gvd-----------d~---------~~~~~G~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~-~~~~  109 (138)
                      ++++   .+|+|+|           |+         |++.||.++.||.. .+..|..+..++.++++++||.+. .+..
T Consensus       211 ~L~~---a~P~GIDvyfeNVGg~v~DAv~~~ln~~aRi~~CG~IS~YN~~~~~~gp~~l~~l~~kr~~v~Gfiv~~~~~~  287 (340)
T COG2130         211 ALKE---ACPKGIDVYFENVGGEVLDAVLPLLNLFARIPVCGAISQYNAPELPPGPRRLPLLMAKRLRVQGFIVASDYDQ  287 (340)
T ss_pred             HHHH---HCCCCeEEEEEcCCchHHHHHHHhhccccceeeeeehhhcCCCCCCCCcchhhHHHhhhheeEEEEechhhhh
Confidence            9999   9999999           22         89999999999765 455667777788899999999994 4555


Q ss_pred             hHHHHHHHHHHHHHhCCceecee
Q 039288          110 VYPEFLEMILPYIREKARLSMRK  132 (138)
Q Consensus       110 ~~~~~~~~~~~~~~~g~l~~~~~  132 (138)
                      ..+++.+++..|+++|||+..++
T Consensus       288 ~~~e~~~~l~~wv~~GKi~~~et  310 (340)
T COG2130         288 RFPEALRELGGWVKEGKIQYRET  310 (340)
T ss_pred             hhHHHHHHHHHHHHcCceeeEee
Confidence            56689999999999999998873

>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
4hfj_A351 X-ray Crystal Structure Of A Double Bond Reductase 3e-23
2j3h_A345 Crystal Structure Of Arabidopsis Thaliana Double Bo 1e-22
4b7c_A336 Crystal Structure Of Hypothetical Protein Pa1648 Fr 3e-07
>pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum Length = 351 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 84/172 (48%), Gaps = 53/172 (30%)
Query: 1   MPGLTAYANLFENFSPKMGEEYVFISAAFSSV---------------------------- 32
           MPG+TAYA   E  SPK GE  VF+SAA  +V                            
Sbjct: 136 MPGMTAYAGFHEVCSPKKGET-VFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLL 194
Query: 33  -YRSGFDDAFNYKEELDLNATLKRSVRFFPTCHQT--------------------AALRF 71
             + GFD+AFNYKEE DL+A LKR   +FP                           +  
Sbjct: 195 KSKFGFDEAFNYKEEQDLSAALKR---YFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAV 251
Query: 72  CEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIR 123
           C M SQYNL+  E VHNL  ++  R RM+GF+VFDY  +YP++LEM++P I+
Sbjct: 252 CGMISQYNLEQTEGVHNLFCLITKRIRMEGFLVFDYYHLYPKYLEMVIPQIK 303
>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond Reductase (At5g16970)-Apo Form Length = 345 Back     alignment and structure
>pdb|4B7C|A Chain A, Crystal Structure Of Hypothetical Protein Pa1648 From Pseudomonas Aeruginosa. Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 4e-32
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 3e-26
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 2e-25
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 8e-16
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
 Score =  115 bits (290), Expect = 4e-32
 Identities = 66/176 (37%), Positives = 83/176 (47%), Gaps = 59/176 (33%)

Query: 1   MPGLTAYANLFENFSPKMGEEYVFISAAFSSV---------------------------- 32
           MPG+TAYA  +E  SPK GE  V++SAA  +V                            
Sbjct: 138 MPGMTAYAGFYEVCSPKEGE-TVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDLL 196

Query: 33  -YRSGFDDAFNYKEELDLNATLKRSVRFFPTC--------------HQTAAL-------R 70
             + GFDDAFNYKEE DL A LKR                         A L       R
Sbjct: 197 KTKFGFDDAFNYKEESDLTAALKR------CFPNGIDIYFENVGGKMLDAVLVNMNMHGR 250

Query: 71  F--CEMTSQYNLDLPENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE 124
              C M SQYNL+  E VHNL  +++ R+R+QGF+V D+   Y +FLE +LP+IRE
Sbjct: 251 IAVCGMISQYNLENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFLEFVLPHIRE 306
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.6
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.49
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.47
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.46
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.46
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.45
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.45
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.44
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.43
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.42
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.41
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.4
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.39
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.38
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.38
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.37
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.35
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.35
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.35
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.35
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.34
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.33
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.32
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.3
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.3
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.3
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.29
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.28
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.28
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.27
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.27
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.27
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.26
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.26
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.26
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.26
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.25
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.24
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.24
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.23
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.23
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.23
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.22
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.21
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.2
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.2
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.19
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.18
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.17
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.17
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.16
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.16
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.14
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.13
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.11
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.1
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.08
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.04
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 98.97
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 98.97
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 98.95
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 98.94
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 98.93
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 98.92
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 98.92
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 98.9
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 98.88
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 98.87
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 98.86
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 98.82
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.28
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 87.49
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 85.23
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 83.54
4b79_A 242 PA4098, probable short-chain dehydrogenase; oxidor 81.38
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 80.59
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 80.07
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
Probab=99.60  E-value=5.1e-15  Score=110.72  Aligned_cols=127  Identities=36%  Similarity=0.541  Sum_probs=96.6

Q ss_pred             chHhHHHHHHhhcCCCCCCeEEEEecCCcce-----------------------------eecCCceEeecCccccHHHH
Q 039288            2 PGLTAYANLFENFSPKMGEEYVFISAAFSSV-----------------------------YRSGFDDAFNYKEELDLNAT   52 (138)
Q Consensus         2 ~~~TA~~~L~~~~~~~~g~~~VLI~gaaggv-----------------------------~~lGad~vi~~~~~~~~~~~   52 (138)
                      +++|||++|.+.+++++|+ +|||+||+|++                             .++|+++++|++++ ++.+.
T Consensus       133 ~~~tA~~al~~~~~~~~g~-~vlI~Ga~g~iG~~~~~~a~~~Ga~Vi~~~~~~~~~~~~~~~~g~~~~~~~~~~-~~~~~  210 (336)
T 4b7c_A          133 TGMTAYFALLDVGQPKNGE-TVVISGAAGAVGSVAGQIARLKGCRVVGIAGGAEKCRFLVEELGFDGAIDYKNE-DLAAG  210 (336)
T ss_dssp             HHHHHHHHHHHTTCCCTTC-EEEESSTTSHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHTTCCSEEEETTTS-CHHHH
T ss_pred             HHHHHHHHHHHhcCCCCCC-EEEEECCCCHHHHHHHHHHHHCCCEEEEEeCCHHHHHHHHHHcCCCEEEECCCH-HHHHH
Confidence            5799999998899999999 99999999998                             16799999999998 99999


Q ss_pred             HhhhhccCCCCcc---cc-----------------eeeeeeeeeecCC-CCCcchhcHHHHHhcCeeeeeeeeccccchH
Q 039288           53 LKRSVRFFPTCHQ---TA-----------------ALRFCEMTSQYNL-DLPENVHNLMFVVFGRSRMQGFIVFDYSSVY  111 (138)
Q Consensus        53 v~~~~~~t~~gvd---d~-----------------~~~~~G~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  111 (138)
                      +++   .+++|+|   |.                 +++.+|....+.. ..+..+.++..++.+++++.++....+....
T Consensus       211 ~~~---~~~~~~d~vi~~~g~~~~~~~~~~l~~~G~iv~~G~~~~~~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~~~  287 (336)
T 4b7c_A          211 LKR---ECPKGIDVFFDNVGGEILDTVLTRIAFKARIVLCGAISQYNNKEAVRGPANYLSLLVNRARMEGMVVMDYAQRF  287 (336)
T ss_dssp             HHH---HCTTCEEEEEESSCHHHHHHHHTTEEEEEEEEECCCGGGGC------CCTTTTHHHHTTCEEEECCGGGGGGGH
T ss_pred             HHH---hcCCCceEEEECCCcchHHHHHHHHhhCCEEEEEeecccccCCcccccchhHHHHHhCCcEEEEEEhhhhhhhh
Confidence            998   7777888   21                 4444444332211 1111234555677899999998776655556


Q ss_pred             HHHHHHHHHHHHhCCceeceee
Q 039288          112 PEFLEMILPYIREKARLSMRKA  133 (138)
Q Consensus       112 ~~~~~~~~~~~~~g~l~~~~~~  133 (138)
                      ++.++++++++++|++++....
T Consensus       288 ~~~~~~~~~l~~~g~l~~~~~~  309 (336)
T 4b7c_A          288 PEGLKEMATWLAEGKLQSREDI  309 (336)
T ss_dssp             HHHHHHHHHHHHTTSSCCCEEE
T ss_pred             HHHHHHHHHHHHCCCcccceee
Confidence            7889999999999999887654
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 7e-10
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative zinc-binding alcohol dehydrogenase
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 52.3 bits (124), Expect = 7e-10
 Identities = 23/175 (13%), Positives = 46/175 (26%), Gaps = 51/175 (29%)

Query: 1   MPGLTAYANLFENFSPKMGE-EYVFISAAFSSV--------------------------- 32
           MPGLT+   + E      G  + + +S A  +                            
Sbjct: 11  MPGLTSLIGVQEKGHISAGSNQTMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCL 70

Query: 33  --YRSGFDDAFNYKEELDLNATLKRSV-----------------RFFPTCHQTAALRFCE 73
                   DA    +  ++   L+ +                        ++ + +  C 
Sbjct: 71  FLTSELGFDAAVNYKTGNVAEQLREACPGGVDVYFDNVGGDISNTVISQMNENSHIILCG 130

Query: 74  MTSQYNLDL----PENVHNLMFVVFGRSRMQGFIVFDYSSVYPEFLEMILPYIRE 124
             SQYN D+    P                + F V +Y   +   +  +  + +E
Sbjct: 131 QISQYNKDVPYPPPLPPAVEAIRKERNITRERFTVLNYKDKFEPGILQLSQWFKE 185

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.87
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.85
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.76
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.73
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.73
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.67
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.65
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.63
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.61
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.56
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.51
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.5
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.49
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.48
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.48
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.48
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.45
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.45
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.44
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.42
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.42
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.35
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.32
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.27
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.23
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.23
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.23
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.1
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 98.19
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 89.34
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 88.94
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 88.48
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 87.74
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 87.71
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 87.61
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 87.53
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 87.28
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 87.28
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 87.05
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 86.97
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 86.67
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 86.62
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 86.52
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 86.52
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 86.5
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 86.3
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 86.17
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 86.14
d1nffa_ 244 Putative oxidoreductase Rv2002 {Mycobacterium tube 85.95
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 85.76
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 85.76
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 85.57
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 85.54
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 85.43
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 85.32
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 85.04
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 84.7
d1yb1a_ 244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 84.69
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 84.63
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 84.48
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 84.11
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 84.08
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 84.07
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 83.89
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 83.82
d2a4ka1 241 beta-keto acyl carrier protein reductase {Thermus 83.68
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 83.58
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 82.94
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 82.91
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 82.47
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 82.39
d2c07a1 251 beta-keto acyl carrier protein reductase {Malaria 82.38
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 81.68
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 80.59
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 80.27
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative zinc-binding alcohol dehydrogenase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.87  E-value=3.7e-22  Score=137.31  Aligned_cols=121  Identities=24%  Similarity=0.342  Sum_probs=93.1

Q ss_pred             CchHhHHHHHHhhcCCCCC--CeEEEEecCCcce------------------------------eecCCceEeecCcccc
Q 039288            1 MPGLTAYANLFENFSPKMG--EEYVFISAAFSSV------------------------------YRSGFDDAFNYKEELD   48 (138)
Q Consensus         1 ~~~~TA~~~L~~~~~~~~g--~~~VLI~gaaggv------------------------------~~lGad~vi~~~~~~~   48 (138)
                      ++++|||++|++.+++++|  | +||||||+|+|                              .++|+|++|||+++ +
T Consensus        11 ~~glTA~~~l~~~~~~~~G~~e-tVLI~gaaGgVG~~aiQlak~~Ga~~vi~~~~~~e~~~~l~~~~gad~vi~~~~~-~   88 (187)
T d1vj1a2          11 MPGLTSLIGVQEKGHISAGSNQ-TMVVSGAAGACGSLAGQIGHLLGCSRVVGICGTQEKCLFLTSELGFDAAVNYKTG-N   88 (187)
T ss_dssp             HHHHHHHHHHHHHSCCCTTSCC-EEEESSTTSTTGGGHHHHHHHTTCSEEEEEESSHHHHHHHHHHSCCSEEEETTSS-C
T ss_pred             cHHHHHHHHHHHHhCCCCCCCC-EEEEECCCchhhHHHHHHHHHcCCcceecccchHHHHhhhhhcccceEEeeccch-h
Confidence            4799999999999999988  8 99999999999                              16899999999999 9


Q ss_pred             HHHHHhhhhccCCCCcc---cc-----------------eeeeeeeeeecCCCCC----cchhcHHHHHhcCeeeeeeee
Q 039288           49 LNATLKRSVRFFPTCHQ---TA-----------------ALRFCEMTSQYNLDLP----ENVHNLMFVVFGRSRMQGFIV  104 (138)
Q Consensus        49 ~~~~v~~~~~~t~~gvd---d~-----------------~~~~~G~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~  104 (138)
                      +.+.+++   .+++|||   |.                 +++.+|..++++...+    ..+.....+..|++++.+|.+
T Consensus        89 ~~~~~~~---~~~~GvDvv~D~vGg~~~~~~~~~l~~~G~iv~~G~~s~~~~~~~~~~~~~~~~~~~~~~k~i~~~g~~~  165 (187)
T d1vj1a2          89 VAEQLRE---ACPGGVDVYFDNVGGDISNTVISQMNENSHIILCGQISQYNKDVPYPPPLPPAVEAIRKERNITRERFTV  165 (187)
T ss_dssp             HHHHHHH---HCTTCEEEEEESSCHHHHHHHHTTEEEEEEEEEC------------CCCCCHHHHHHHHHTTCEEEECCG
T ss_pred             HHHHHHH---HhccCceEEEecCCchhHHHHhhhccccccEEEeccccccccccccCCchHHHHHHHHHhcceEEEEeEe
Confidence            9999999   8888999   32                 7888888777643322    111222345668999999988


Q ss_pred             ccccchHHHHHHHHHHHHHhCC
Q 039288          105 FDYSSVYPEFLEMILPYIREKA  126 (138)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~~g~  126 (138)
                      .++.+..++.++++++|+++||
T Consensus       166 ~~~~~~~~e~~~~l~~~i~~Gk  187 (187)
T d1vj1a2         166 LNYKDKFEPGILQLSQWFKEGK  187 (187)
T ss_dssp             GGCGGGHHHHHHHHHHHHHHTS
T ss_pred             cchHHHHHHHHHHHHHHHHCcC
Confidence            8887778899999999999996
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure