Citrus Sinensis ID: 039327


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
ccccccEEEccccEEEEEcccccccccccccEEEccccEEEEEcccccccccccccccEEEccccccccccccHHHHccccccEEEcccccccccccHHHHHcccccccEEccccEEEEEccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHccccccEEEcccccccccccccccccccccHHHcccccccEEEcccccccccccccccccccccccc
ccccccEEEcccccccccccHHHHcccccccEEEEccccccccccHHHccccccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHcccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccEEcccccccccccHHHcccccccEEEcccccccccccHHHccccEEEEcc
HLTSIEELylsnnhfqipisleplfnhsrlKRLWAYNNEIKAEIteshsltapnfQLQSLLLssgygdgvtfpkflyhqhdledvhLSHIkmngkfpnwllennaKLETLFLIndsiggpfrlpihphrrlrfldvsnnnfqghipveigdilpslfsfnistnalhgsipssfgnmNFLRILDlssnqltgeiperlavgcVNLEFLALSNnnlkghmfcrnfNLANlrqlqlednrfigeipqslskcssleglylnnnslsditmpknhlegpipvefCQLYSLHildisdnnisgslpscfhplyikkvhl
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFqlqslllssGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
******ELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKK***
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
*LTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCFHPLYIKKVHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query315 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.933 0.235 0.319 5e-26
Q9FL28 1173 LRR receptor-like serine/ no no 0.939 0.252 0.318 2e-24
Q9LYN8 1192 Leucine-rich repeat recep no no 0.920 0.243 0.320 1e-23
O49318 1124 Probable leucine-rich rep no no 0.761 0.213 0.316 4e-22
O22938 890 Leucine-rich repeat recep no no 0.701 0.248 0.323 5e-22
C0LGS2 1136 Probable LRR receptor-lik no no 0.939 0.260 0.308 5e-22
Q9LP24 1120 Probable leucine-rich rep no no 0.869 0.244 0.312 1e-21
Q9LVP0 1102 Probable leucine-rich rep no no 0.660 0.188 0.343 2e-21
Q9FZ59 1088 Leucine-rich repeat recep no no 0.955 0.276 0.306 2e-21
Q9ZPS9 1143 Serine/threonine-protein no no 0.876 0.241 0.306 3e-21
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (296), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 109/341 (31%), Positives = 160/341 (46%), Gaps = 47/341 (13%)

Query: 1   HLTSIEELYLSNNHF--QIPISLEPLFNHSRLKRLWAYNNEIKAEITE------------ 46
           +LTS+E L+L +N    +IP  L  L N   ++ L   +NE+  +I E            
Sbjct: 117 NLTSLESLFLFSNQLTGEIPSQLGSLVN---IRSLRIGDNELVGDIPETLGNLVNLQMLA 173

Query: 47  --SHSLTAPN-------FQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFP 97
             S  LT P         ++QSL+L   Y +G   P  L +  DL     +   +NG  P
Sbjct: 174 LASCRLTGPIPSQLGRLVRVQSLILQDNYLEG-PIPAELGNCSDLTVFTAAENMLNGTIP 232

Query: 98  NWL--LENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPS 155
             L  LEN   LE L L N+S+ G     +    +L++L +  N  QG IP  + D L +
Sbjct: 233 AELGRLEN---LEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSLAD-LGN 288

Query: 156 LFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNL 215
           L + ++S N L G IP  F NM+ L  L L++N L+G +P+ +     NLE L LS   L
Sbjct: 289 LQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSGTQL 348

Query: 216 KGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPK----- 270
            G +        +L+QL L +N   G IP++L +   L  LYL+NN+L     P      
Sbjct: 349 SGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSISNLT 408

Query: 271 ---------NHLEGPIPVEFCQLYSLHILDISDNNISGSLP 302
                    N+LEG +P E   L  L +L + +N  SG +P
Sbjct: 409 NLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIP 449




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
255581263 912 serine-threonine protein kinase, plant-t 0.980 0.338 0.536 6e-83
224142481 781 predicted protein [Populus trichocarpa] 0.926 0.373 0.516 2e-67
224102049 577 predicted protein [Populus trichocarpa] 0.958 0.523 0.504 2e-66
224158883315 predicted protein [Populus trichocarpa] 0.828 0.828 0.532 2e-64
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.980 0.211 0.462 3e-61
224120284 929 predicted protein [Populus trichocarpa] 0.914 0.310 0.449 3e-57
224106950 863 predicted protein [Populus trichocarpa] 0.977 0.356 0.432 4e-57
224106948 658 predicted protein [Populus trichocarpa] 0.946 0.452 0.431 3e-55
224112245 876 predicted protein [Populus trichocarpa] 0.971 0.349 0.389 1e-54
224123984 1016 predicted protein [Populus trichocarpa] 0.984 0.305 0.430 2e-54
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  313 bits (802), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 176/328 (53%), Positives = 224/328 (68%), Gaps = 19/328 (5%)

Query: 2   LTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSLL 61
           L S+ +L +SNNHFQ+P SL P FNHS LK +   NN I  E  E HS  AP FQL S++
Sbjct: 275 LKSLVDLDVSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLE-AELHS--APRFQLISII 331

Query: 62  LSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPF 121
            S GYG   TFP FLYHQ++L+ V LSH+ + G+FPNWLL NN +LE L L+N+S+ G  
Sbjct: 332 FS-GYGICGTFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHL 390

Query: 122 RLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLR 181
           +LP+HPH  L  LD+SNN+   HIP+EIG  LP L   N+S+N   GSIPSSFGNMN LR
Sbjct: 391 QLPLHPHVNLLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLR 450

Query: 182 ILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIG 241
           ILDLS+NQL+G IPE LA GC +L  L LSNN+L+G MF + FNL NL  L+L+ N F G
Sbjct: 451 ILDLSNNQLSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSG 510

Query: 242 EIPQSLSKCSSLEGLYLNNNSLS--------------DITMPKNHLEGPIPVEFCQLYSL 287
            IP+SLSK S+L  + L++N LS              ++ +  N L+GPIPVEFCQL+ L
Sbjct: 511 RIPKSLSK-SALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYL 569

Query: 288 HILDISDNNISGSLPSCFHPLYIKKVHL 315
            +LD+++N++SG LPSC  P  I  VHL
Sbjct: 570 EVLDLANNSVSGILPSCLSPSSIIHVHL 597




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224102049|ref|XP_002334215.1| predicted protein [Populus trichocarpa] gi|222870030|gb|EEF07161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224158883|ref|XP_002338020.1| predicted protein [Populus trichocarpa] gi|222870336|gb|EEF07467.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106950|ref|XP_002333589.1| predicted protein [Populus trichocarpa] gi|222837497|gb|EEE75876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106948|ref|XP_002333588.1| predicted protein [Populus trichocarpa] gi|222837496|gb|EEE75875.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query315
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.955 0.301 0.365 3.5e-40
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.939 0.306 0.358 3.5e-38
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.930 0.270 0.355 5.8e-38
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.971 0.313 0.360 2.6e-37
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.911 0.316 0.357 1.1e-35
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.933 0.329 0.329 1.7e-34
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.723 0.243 0.367 6.5e-31
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.920 0.266 0.324 1.6e-26
TAIR|locus:2007918 1088 PEPR2 "PEP1 receptor 2" [Arabi 0.879 0.254 0.340 2.7e-26
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.917 0.294 0.323 7.7e-26
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 438 (159.2 bits), Expect = 3.5e-40, P = 3.5e-40
 Identities = 119/326 (36%), Positives = 165/326 (50%)

Query:     1 HLTSIEELYLSNNHFQIPISLEPLFNHSRLK--RLWAYNNEIKAEITESHSLTAPNFXXX 58
             +L S+E L L  N+F+   SL  L N S+LK  RL + +N ++ E   S     P F   
Sbjct:   304 NLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWK---PKFQLV 360

Query:    59 XXXXXXGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIG 118
                      + V  P FL HQ DL  V LS  +++G FP+WLLENN KLE L L N+S  
Sbjct:   361 VIALRSCNLEKV--PHFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFT 418

Query:   119 GPFRLPIHPHRRLRFLDVSNNNFQGHIPVE-IGDILPSLFSFNISTNALHGSIPSSFGNM 177
               F+LP   H  L FL+VS N F  H+ ++  G ILP L   N++ N   G++PSS  NM
Sbjct:   419 S-FQLPKSAHNLL-FLNVSVNKFN-HLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNM 475

Query:   178 NFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDN 237
               +  LDLS N+  G++P R   GC NL  L LS+N L G +F    N   L  + +++N
Sbjct:   476 KSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLSGEVFPEAANFTRLWVMSMDNN 535

Query:   238 RFIGEIPQSLSKCSSLEGLYLNNNSLSDIT--------------MPKNHLEGPIPVEFCQ 283
              F G I +      SL  L ++NN L+ +               +  N LEG IP     
Sbjct:   536 LFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQGLFALQLSNNMLEGEIPTSLFN 595

Query:   284 LYSLHILDISDNNISGSLPSCFHPLY 309
             +  L +LD+S N +SG +P     +Y
Sbjct:   596 ISYLQLLDLSSNRLSGDIPPHVSSIY 621


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007918 PEPR2 "PEP1 receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-27
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-23
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  110 bits (277), Expect = 6e-27
 Identities = 104/322 (32%), Positives = 149/322 (46%), Gaps = 31/322 (9%)

Query: 2   LTSIEELYLSNNHF--QIPISLEPLFNHSRLKRLWAYNNEIKAEITES-HSLTAPNFQLQ 58
           LTS+  L L  N+    IP SL  L     L+ L+ Y N++   I  S  SL     +L 
Sbjct: 235 LTSLNHLDLVYNNLTGPIPSSLGNL---KNLQYLFLYQNKLSGPIPPSIFSLQ----KLI 287

Query: 59  SLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIG 118
           SL LS     G   P+ +    +LE +HL      GK P   L +  +L+ L L ++   
Sbjct: 288 SLDLSDNSLSG-EIPELVIQLQNLEILHLFSNNFTGKIPV-ALTSLPRLQVLQLWSNKFS 345

Query: 119 GPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMN 178
           G     +  H  L  LD+S NN  G IP  +     +LF   + +N+L G IP S G   
Sbjct: 346 GEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSS-GNLFKLILFSNSLEGEIPKSLGACR 404

Query: 179 FLRILDLSSNQLTGEIP-ERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDN 237
            LR + L  N  +GE+P E   +  V   FL +SNNNL+G +  R +++ +L+ L L  N
Sbjct: 405 SLRRVRLQDNSFSGELPSEFTKLPLVY--FLDISNNNLQGRINSRKWDMPSLQMLSLARN 462

Query: 238 RFIGEIPQSLSKCSSLEGLYLNNNSLS--------------DITMPKNHLEGPIPVEFCQ 283
           +F G +P S      LE L L+ N  S               + + +N L G IP E   
Sbjct: 463 KFFGGLPDS-FGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSS 521

Query: 284 LYSLHILDISDNNISGSLPSCF 305
              L  LD+S N +SG +P+ F
Sbjct: 522 CKKLVSLDLSHNQLSGQIPASF 543


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 315
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.34
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
PLN03150623 hypothetical protein; Provisional 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.01
PLN03150623 hypothetical protein; Provisional 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.79
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.78
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.46
KOG4341483 consensus F-box protein containing LRR [General fu 98.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.22
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.18
KOG4341483 consensus F-box protein containing LRR [General fu 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
PRK15386426 type III secretion protein GogB; Provisional 98.06
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.82
PRK15386 426 type III secretion protein GogB; Provisional 97.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.66
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.21
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.01
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.39
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.47
KOG4308 478 consensus LRR-containing protein [Function unknown 94.38
KOG4308478 consensus LRR-containing protein [Function unknown 94.07
smart0037026 LRR Leucine-rich repeats, outliers. 92.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.03
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.35
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.59
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-35  Score=287.11  Aligned_cols=304  Identities=33%  Similarity=0.429  Sum_probs=198.2

Q ss_pred             CCccceEEeecCcccccCCCcccCCCcccceeecccccccc-cccccccCCCCccccEEEEeccCCCCccccccccccCC
Q 039327            2 LTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKA-EITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQH   80 (315)
Q Consensus         2 l~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~-~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~   80 (315)
                      +++|+.|++++|.+.+.+|.+.+..+++|++|++++|.+++ +|..    .++  +|++|++ ++|.+.+..|..+.+++
T Consensus        92 l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~----~l~--~L~~L~L-s~n~~~~~~p~~~~~l~  164 (968)
T PLN00113         92 LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG----SIP--NLETLDL-SNNMLSGEIPNDIGSFS  164 (968)
T ss_pred             CCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCcc----ccC--CCCEEEC-cCCcccccCChHHhcCC
Confidence            56788888888877777775445577788888888777765 4432    244  7777888 77777777777777788


Q ss_pred             CCCeEEecCceecccCChhhhhcccccceeEeecCCCcCcCcCCCcCCCCccEEEcccCcCCCCCchhhhhcCCCceEEE
Q 039327           81 DLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFN  160 (315)
Q Consensus        81 ~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~  160 (315)
                      +|++|++++|.+.+.+|..+ +++++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+.. +++|++|+
T Consensus       165 ~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~-l~~L~~L~  242 (968)
T PLN00113        165 SLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLD  242 (968)
T ss_pred             CCCEEECccCcccccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhc-CCCCCEEE
Confidence            88888888887777777764 67777888888777777667777777777777777777776666666655 66777777


Q ss_pred             eecCcCCCCCCccccCCCCCcEEEccCccccCcCchhhccCCCcccEEEccCCCCCCcccccccCCCCCCEEEcCCCccc
Q 039327          161 ISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFI  240 (315)
Q Consensus       161 l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~~~  240 (315)
                      +.+|.+++..|..++.+++|++|++++|.+.+.+|..+. .+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.
T Consensus       243 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~  321 (968)
T PLN00113        243 LVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT  321 (968)
T ss_pred             CcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh-hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccC
Confidence            777777666666677777777777777766655555544 3556666666666655555555555555555555555555


Q ss_pred             cccccccccCCCCcEEEccCCcccc--------------------------------------ccCCCCccccCCchhhc
Q 039327          241 GEIPQSLSKCSSLEGLYLNNNSLSD--------------------------------------ITMPKNHLEGPIPVEFC  282 (315)
Q Consensus       241 ~~~~~~~~~~~~L~~L~l~~n~i~~--------------------------------------l~l~~~~l~~~~~~~l~  282 (315)
                      +..|..+..+++|+.|++++|.+..                                      +++.+|.+.+.+|.++.
T Consensus       322 ~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~  401 (968)
T PLN00113        322 GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLG  401 (968)
T ss_pred             CcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHh
Confidence            4444444455555555554443321                                      33444455555555555


Q ss_pred             ccCCCCEEecccCccCCCCCCCcc-ccccceecC
Q 039327          283 QLYSLHILDISDNNISGSLPSCFH-PLYIKKVHL  315 (315)
Q Consensus       283 ~~~~L~~L~l~~n~~~~~~~~~~~-~~~L~~l~l  315 (315)
                      .+++|+.|++++|.+++.+|..+. ++.|+.|++
T Consensus       402 ~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  435 (968)
T PLN00113        402 ACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDI  435 (968)
T ss_pred             CCCCCCEEECcCCEeeeECChhHhcCCCCCEEEC
Confidence            566666666666666656666555 566655543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-21
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-21
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-05
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-05
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 97.8 bits (242), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 81/232 (34%), Positives = 117/232 (50%), Gaps = 14/232 (6%) Query: 76 LYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGPF--RLPIHPHRRLRF 133 L L+ + LS + +G+ P L +A L TL L +++ GP L +P L+ Sbjct: 339 LLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQE 398 Query: 134 LDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGE 193 L + NN F G IP + + L S ++S N L G+IPSS G+++ LR L L N L GE Sbjct: 399 LYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 457 Query: 194 IPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSL 253 IP+ L LE L L N+L G + N NL + L +NR GEIP+ + + +L Sbjct: 458 IPQELMY-VKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENL 516 Query: 254 EGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDNNISGSLPSCF 305 L L+NNS S G IP E SL LD++ N +G++P+ Sbjct: 517 AILKLSNNSFS----------GNIPAELGDCRSLIWLDLNTNLFNGTIPAAM 558
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query315
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-49
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-18
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-36
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-31
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-20
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-27
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-25
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-29
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-26
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-18
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-18
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-13
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-18
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-17
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-10
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-09
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  182 bits (465), Expect = 2e-52
 Identities = 88/310 (28%), Positives = 137/310 (44%), Gaps = 25/310 (8%)

Query: 1   HLTSIEELYLSNNHF--QIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQ 58
            L S+E L LS N       +          LK L    N+I  ++  S         L+
Sbjct: 149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSR-CV----NLE 203

Query: 59  SLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIG 118
            L +SS        P FL     L+ + +S  K++G F   +     +L+ L + ++   
Sbjct: 204 FLDVSSNNFST-GIP-FLGDCSALQHLDISGNKLSGDFSRAIS-TCTELKLLNISSNQFV 260

Query: 119 GPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMN 178
           GP  +P  P + L++L ++ N F G IP  +     +L   ++S N  +G++P  FG+ +
Sbjct: 261 GP--IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCS 318

Query: 179 FLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNL-ANLRQLQLEDN 237
            L  L LSSN  +GE+P    +    L+ L LS N   G +     NL A+L  L L  N
Sbjct: 319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 378

Query: 238 RFIGEIPQSLSKC--SSLEGLYLNNNSLSDITMPKNHLEGPIPVEFCQLYSLHILDISDN 295
            F G I  +L +   ++L+ LYL NN  +          G IP        L  L +S N
Sbjct: 379 NFSGPILPNLCQNPKNTLQELYLQNNGFT----------GKIPPTLSNCSELVSLHLSFN 428

Query: 296 NISGSLPSCF 305
            +SG++PS  
Sbjct: 429 YLSGTIPSSL 438


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.98
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.87
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.75
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.5
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.44
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.82
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.24
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1e-38  Score=299.87  Aligned_cols=250  Identities=32%  Similarity=0.389  Sum_probs=110.5

Q ss_pred             CccceEEeecCcccccCCCcccCCCcccceeecccccccc-cccc-cccCCCCccccEEEEeccCCCCccccccccccCC
Q 039327            3 TSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKA-EITE-SHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQH   80 (315)
Q Consensus         3 ~~L~~l~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~-~~~~-~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~   80 (315)
                      ++|++|++++|.+.+..| ..+.++++|++|++++|.+.+ +|.. +.+  .+  +|++|++ ++|.+.+.+|..+.+++
T Consensus       294 ~~L~~L~Ls~n~l~~~~p-~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~--l~--~L~~L~L-s~n~l~~~~p~~l~~l~  367 (768)
T 3rgz_A          294 DTLTGLDLSGNHFYGAVP-PFFGSCSLLESLALSSNNFSGELPMDTLLK--MR--GLKVLDL-SFNEFSGELPESLTNLS  367 (768)
T ss_dssp             TTCSEEECCSSEEEECCC-GGGGGCTTCCEEECCSSEEEEECCHHHHTT--CT--TCCEEEC-CSSEEEECCCTTHHHHT
T ss_pred             CcCCEEECcCCcCCCccc-hHHhcCCCccEEECCCCcccCcCCHHHHhc--CC--CCCEEeC-cCCccCccccHHHHhhh
Confidence            344444444444443333 234444444444444444432 3322 221  22  4444444 44444433443333332


Q ss_pred             -CCCeEEecCceecccCChhhhhc--ccccceeEeecCCCcCcCcCCCcCCCCccEEEcccCcCCCCCchhhhhcCCCce
Q 039327           81 -DLEDVHLSHIKMNGKFPNWLLEN--NAKLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLF  157 (315)
Q Consensus        81 -~L~~L~l~~~~~~~~~~~~~~~~--~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~  157 (315)
                       +|++|++++|.+++.+|..+ ..  +++|++|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+.. +++|+
T Consensus       368 ~~L~~L~Ls~N~l~~~~~~~~-~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~-l~~L~  445 (768)
T 3rgz_A          368 ASLLTLDLSSNNFSGPILPNL-CQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS-LSKLR  445 (768)
T ss_dssp             TTCSEEECCSSEEEEECCTTT-TCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGG-CTTCC
T ss_pred             cCCcEEEccCCCcCCCcChhh-hhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhc-CCCCC
Confidence             33333333333332222221 11  233444444444444344444444555555555555554444444443 44555


Q ss_pred             EEEeecCcCCCCCCccccCCCCCcEEEccCccccCcCchhhccCCCcccEEEccCCCCCCcccccccCCCCCCEEEcCCC
Q 039327          158 SFNISTNALHGSIPSSFGNMNFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDN  237 (315)
Q Consensus       158 ~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n  237 (315)
                      .|++++|.+++..|..+..+++|++|++++|.+.+.+|..+. .+++|+.|++++|.+.+..|..+..+++|+.|++++|
T Consensus       446 ~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N  524 (768)
T 3rgz_A          446 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS-NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNN  524 (768)
T ss_dssp             EEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGG-GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSS
T ss_pred             EEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHh-cCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCC
Confidence            555555555444444444555555555555555444444333 3445555555555554444444444555555555555


Q ss_pred             ccccccccccccCCCCcEEEccCC
Q 039327          238 RFIGEIPQSLSKCSSLEGLYLNNN  261 (315)
Q Consensus       238 ~~~~~~~~~~~~~~~L~~L~l~~n  261 (315)
                      .+.+.+|..++.+++|+.|++++|
T Consensus       525 ~l~~~~p~~l~~l~~L~~L~Ls~N  548 (768)
T 3rgz_A          525 SFSGNIPAELGDCRSLIWLDLNTN  548 (768)
T ss_dssp             CCEEECCGGGGGCTTCCEEECCSS
T ss_pred             cccCcCCHHHcCCCCCCEEECCCC
Confidence            554444444444444444444444



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 315
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-04
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 68.5 bits (166), Expect = 1e-13
 Identities = 55/325 (16%), Positives = 98/325 (30%), Gaps = 43/325 (13%)

Query: 1   HLTSIEELYLSNNHFQIPISLEPLFNHSRLKRLWAYNNEIKAEITESHSLTAPNFQLQSL 60
           +L ++ ++  SNN       + PL N ++L  +   NN+I      ++        L + 
Sbjct: 64  YLNNLTQINFSNNQLT---DITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNN 120

Query: 61  LLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNAKLETLFLINDSIGGP 120
            ++                       +S +            N            ++   
Sbjct: 121 QITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERL 180

Query: 121 FRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHG---SIPSSFGNM 177
                          ++N         +I DI P     N+   +L+G       +  ++
Sbjct: 181 DISSNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASL 240

Query: 178 NFLRILDLSSNQLTGEIPERLAVGCVNLEFLALSNNNLKG-------------------- 217
             L  LDL++NQ++   P     G   L  L L  N +                      
Sbjct: 241 TNLTDLDLANNQISNLAPLS---GLTKLTELKLGANQISNISPLAGLTALTNLELNENQL 297

Query: 218 HMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSDITMPKNHLEGPI 277
                  NL NL  L L  N      P  +S  + L+ L+  NN +SD++          
Sbjct: 298 EDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSDVS---------- 345

Query: 278 PVEFCQLYSLHILDISDNNISGSLP 302
                 L +++ L    N IS   P
Sbjct: 346 --SLANLTNINWLSAGHNQISDLTP 368


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query315
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.28
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.63
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.51
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=1.1e-28  Score=206.15  Aligned_cols=253  Identities=25%  Similarity=0.345  Sum_probs=157.0

Q ss_pred             ccceeecccccccc---cccccccCCCCccccEEEEeccCCCCccccccccccCCCCCeEEecCceecccCChhhhhccc
Q 039327           29 RLKRLWAYNNEIKA---EITESHSLTAPNFQLQSLLLSSGYGDGVTFPKFLYHQHDLEDVHLSHIKMNGKFPNWLLENNA  105 (315)
Q Consensus        29 ~L~~L~l~~~~~~~---~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~  105 (315)
                      ++++|+|+++.+.+   +|..+.+  ++  +|++|+++.++.+.+.+|..+.++++|++|++++|++.+..+.. +..++
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~--L~--~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~-~~~~~  125 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLAN--LP--YLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF-LSQIK  125 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGG--CT--TCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGG-GGGCT
T ss_pred             EEEEEECCCCCCCCCCCCChHHhc--Cc--cccccccccccccccccccccccccccchhhhcccccccccccc-ccchh
Confidence            46666776666653   5566554  55  67777772235666666666677777777777777666555544 35666


Q ss_pred             ccceeEeecCCCcCcCcCCCcCCCCccEEEcccCcCCCCCchhhhhcCCCceEEEeecCcCCCCCCccccCCCCCcEEEc
Q 039327          106 KLETLFLINDSIGGPFRLPIHPHRRLRFLDVSNNNFQGHIPVEIGDILPSLFSFNISTNALHGSIPSSFGNMNFLRILDL  185 (315)
Q Consensus       106 ~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l  185 (315)
                      +|+++++++|.+...+|..+..+++++++++++|.+.+.+|..+......++.+++.+|.+++..|..+..+.. ..+++
T Consensus       126 ~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l  204 (313)
T d1ogqa_         126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDL  204 (313)
T ss_dssp             TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEEC
T ss_pred             hhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccccccccccccccccc-ccccc
Confidence            67777777666666666666667777777777666666666666552323466666666666555555555443 35666


Q ss_pred             cCccccCcCchhhccCCCcccEEEccCCCCCCcccccccCCCCCCEEEcCCCccccccccccccCCCCcEEEccCCcccc
Q 039327          186 SSNQLTGEIPERLAVGCVNLEFLALSNNNLKGHMFCRNFNLANLRQLQLEDNRFIGEIPQSLSKCSSLEGLYLNNNSLSD  265 (315)
Q Consensus       186 ~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~i~~  265 (315)
                      ..+...+.+|.... ..+.++.++++++.+.+.++ .+..+++++.|++++|++++.+|..++.+++|++|++++|++. 
T Consensus       205 ~~~~~~~~~~~~~~-~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~-  281 (313)
T d1ogqa_         205 SRNMLEGDASVLFG-SDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC-  281 (313)
T ss_dssp             CSSEEEECCGGGCC-TTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE-
T ss_pred             cccccccccccccc-cccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCccc-
Confidence            66666655554443 46666777777766655433 4556667777777777777666777777777777777666554 


Q ss_pred             ccCCCCccccCCchhhcccCCCCEEecccCc-cCCC
Q 039327          266 ITMPKNHLEGPIPVEFCQLYSLHILDISDNN-ISGS  300 (315)
Q Consensus       266 l~l~~~~l~~~~~~~l~~~~~L~~L~l~~n~-~~~~  300 (315)
                               |.+| .++++++|+.+++++|+ +.+.
T Consensus       282 ---------g~iP-~~~~L~~L~~l~l~~N~~l~g~  307 (313)
T d1ogqa_         282 ---------GEIP-QGGNLQRFDVSAYANNKCLCGS  307 (313)
T ss_dssp             ---------EECC-CSTTGGGSCGGGTCSSSEEEST
T ss_pred             ---------ccCC-CcccCCCCCHHHhCCCccccCC
Confidence                     2445 34566667777777665 4433



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure