Citrus Sinensis ID: 039376


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MDPSKPASSDLSKNDNKINEMKPMNSSQPSSRLLDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
cccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHccccHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHccHHHHHHHHHccccccccccccccccccc
cccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHHHccccccEEEEcccHHHHHHHccccccHHccccccccccHEEcccHHHHHHHHHccccccccccHHHHHHHHcccHHHHHHHHHcccHHHHHHcccccccHHHHHHcccHHHHHHHHHHccccccHHHHHccccccccHHHHHHHcccHHHHHHHHcccccHHcccccccccHHHHHHHcccHHHHHHHHHccccHHcccccccccHHHcccccHHEHEHEHcccHccccccccccccccc
mdpskpassdlskndnkinemkpmnssqpssrlldsknEDEIVKMKqkdfaqpssklvvgkkedeitemkpandpiievksherqQIKQVKTSEDWFREMVETGVkvdlgehpqLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLdmispldleetdtsggtpltsaaiVGNTKAAKILVKYNKnlpnmrnrigqcpihcaarsghRETVEYLLSVTgveeedshekysnpfageCGLKLLEILIEFNFLgqytcntlssnmhif
mdpskpassdlskndnkinemkpmnssqpssrlldSKNEDEIVKMkqkdfaqpssklvvgkkedeitemkpandpiievksherqqikqvktseDWFREMVETgvkvdlgehpqlrralvrkdWKEVERfisenpdtlyAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEEtdtsggtpltsaaivgnTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
MDPSKPASSDLSKNDNKINEMKPMNSSQPSSRLLDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
**********************************************************************************************DWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDL*********PLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVE*******YSNPFAGECGLKLLEILIEFNFLGQYTCNTL*******
*********************************LDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
************KNDNKINEMK************DSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVT***********SNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
******************NEM****SSQPSSRLLDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPSKPASSDLSKNDNKINEMKPMNSSQPSSRLLDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQIKQVKTSEDWFREMVETGVKVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNFLGQYTCNTLSSNMHIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes no 0.318 0.023 0.367 7e-06
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes no 0.318 0.023 0.367 8e-06
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.179 0.027 0.490 9e-06
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.314 0.092 0.336 3e-05
Q3TYL0343 Putative IQ motif and ank yes no 0.204 0.172 0.416 6e-05
Q9XZC0 1413 Alpha-latrocrustotoxin-Lt N/A no 0.529 0.108 0.268 0.0002
Q07E15 1645 Cortactin-binding protein N/A no 0.200 0.035 0.372 0.0003
Q07E28 1658 Cortactin-binding protein N/A no 0.200 0.034 0.372 0.0003
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.179 0.011 0.415 0.0004
Q1RGM2168 Putative ankyrin repeat p yes no 0.211 0.363 0.403 0.0004
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function desciption
 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 50/98 (51%), Gaps = 6/98 (6%)

Query: 141 KFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAA 200
           + TES  T  H  A+        LL   L+  + +D   T  +G TPL  A+  GNT   
Sbjct: 228 RTTESGFTPLHIAAHYGNVNVATLL---LNRGAAVDF--TARNGITPLHVASKRGNTNMV 282

Query: 201 KILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLL 238
           K+L+     + + + R G  P+HCAARSGH + VE LL
Sbjct: 283 KLLLDRGGQI-DAKTRDGLTPLHCAARSGHDQVVELLL 319




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes. Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Homo sapiens (taxid: 9606)
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q3TYL0|YH010_MOUSE Putative IQ motif and ankyrin repeat domain-containing protein LOC642574 homolog OS=Mus musculus PE=5 SV=2 Back     alignment and function description
>sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 Back     alignment and function description
>sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 Back     alignment and function description
>sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q1RGM2|Y1411_RICBR Putative ankyrin repeat protein RBE_1411 OS=Rickettsia bellii (strain RML369-C) GN=RBE_1411 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
147826943327 hypothetical protein VITISV_001418 [Viti 0.553 0.489 0.313 2e-16
147838601332 hypothetical protein VITISV_008901 [Viti 0.543 0.472 0.307 2e-13
255544802 590 ankyrin repeat-containing protein, putat 0.525 0.257 0.329 2e-13
147843694289 hypothetical protein VITISV_011483 [Viti 0.730 0.730 0.281 8e-13
147784800 1697 hypothetical protein VITISV_029434 [Viti 0.442 0.075 0.343 1e-12
297737987 1855 unnamed protein product [Vitis vinifera] 0.442 0.069 0.343 1e-12
147822636216 hypothetical protein VITISV_038214 [Viti 0.539 0.722 0.306 2e-12
359472754 789 PREDICTED: ankyrin repeat-containing pro 0.474 0.173 0.335 2e-12
359494194 626 PREDICTED: uncharacterized protein LOC10 0.442 0.204 0.366 3e-12
356532646 606 PREDICTED: uncharacterized protein LOC10 0.633 0.301 0.285 5e-12
>gi|147826943|emb|CAN68876.1| hypothetical protein VITISV_001418 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 90/169 (53%), Gaps = 9/169 (5%)

Query: 106 KVDLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLL 165
           + DL  + +L +A+V  DWK   + + +NP +  A    +   + H   ++ E  +   +
Sbjct: 103 EADLFYYWELYKAVVNGDWKSASKLLEDNPTSFLAPIRRNDPPMLHIAVDLGE-ASMGFV 161

Query: 166 DEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCA 225
           ++ ++ +    L   D+ G T L +AA+ GN KAAK+LV  N +LPN+ +     P+H A
Sbjct: 162 EKLVEFMPSEALSLQDSDGATALFTAAMAGNIKAAKLLVDKNPSLPNICSYGNLVPLHSA 221

Query: 226 ARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLE--ILIEFN 272
            + GH+E   YLLSVT        + Y +PFA + G +LL   +++ FN
Sbjct: 222 LKYGHKELTSYLLSVT------RDDVYPSPFADKPGFELLRRALMVGFN 264




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147838601|emb|CAN65057.1| hypothetical protein VITISV_008901 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255544802|ref|XP_002513462.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223547370|gb|EEF48865.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147843694|emb|CAN79870.1| hypothetical protein VITISV_011483 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784800|emb|CAN68568.1| hypothetical protein VITISV_029434 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737987|emb|CBI27188.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147822636|emb|CAN63937.1| hypothetical protein VITISV_038214 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359472754|ref|XP_002276402.2| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494194|ref|XP_002266127.2| PREDICTED: uncharacterized protein LOC100258383 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532646|ref|XP_003534882.1| PREDICTED: uncharacterized protein LOC100813731 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2080240 574 AT3G54070 "AT3G54070" [Arabido 0.467 0.235 0.312 1.4e-10
TAIR|locus:2165194282 AT5G35830 [Arabidopsis thalian 0.477 0.489 0.340 2e-10
UNIPROTKB|E1C390130 DYSFIP1 "Uncharacterized prote 0.245 0.546 0.364 1.9e-05
ASPGD|ASPL0000075867855 AN8767 [Emericella nidulans (t 0.411 0.139 0.338 2.2e-05
ZFIN|ZDB-GENE-030515-6112 nrarpa "notch-regulated ankyri 0.276 0.714 0.313 4e-05
POMBASE|SPBP16F5.05c146 SPBP16F5.05c "ribosome biogene 0.269 0.534 0.325 7.2e-05
ZFIN|ZDB-GENE-030515-7111 nrarpb "notch-regulated ankyri 0.276 0.720 0.313 8.6e-05
DICTYBASE|DDB_G0287459 986 secG "Arf guanyl-nucleotide ex 0.311 0.091 0.340 0.0002
MGI|MGI:3588184343 K230010J24Rik "RIKEN cDNA K230 0.217 0.183 0.406 0.00021
UNIPROTKB|G3MYP6114 NRARP "Uncharacterized protein 0.276 0.701 0.301 0.00023
TAIR|locus:2080240 AT3G54070 "AT3G54070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 174 (66.3 bits), Expect = 1.4e-10, P = 1.4e-10
 Identities = 44/141 (31%), Positives = 74/141 (52%)

Query:   117 RALVRKDWKEVERFISENPDTLYAKFTESCGTLFH-SMANINEDEAHRLLDEFLDMISPL 175
             +A++  DWK     IS     +  + T +     H ++A  ++D    LL E    + P 
Sbjct:    56 KAVLTGDWKTASTLISRKECNVVEQITGNSEIALHIAVAAKHKDFVRNLLRE----MDPP 111

Query:   176 DLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVE 235
             DL   +  G TPL+ AA +G+ + A++L+   ++LP++ N     PIH AA  GH E V+
Sbjct:   112 DLSLKNKDGNTPLSFAAALGDIETAEMLINMIRDLPDISNEKTMTPIHIAALYGHGEMVQ 171

Query:   236 YLLSVTGVEEEDSHEKYSNPF 256
             YL S T +++ +  ++Y N F
Sbjct:   172 YLFSKTSIKDLND-QQYLNLF 191




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2165194 AT5G35830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C390 DYSFIP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ASPGD|ASPL0000075867 AN8767 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030515-6 nrarpa "notch-regulated ankyrin repeat protein a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBP16F5.05c SPBP16F5.05c "ribosome biogenesis protein Nop8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030515-7 nrarpb "notch-regulated ankyrin repeat protein b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287459 secG "Arf guanyl-nucleotide exchange factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:3588184 K230010J24Rik "RIKEN cDNA K230010J24 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3MYP6 NRARP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00000182001
SubName- Full=Chromosome undetermined scaffold_102, whole genome shotgun sequence; (285 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 65.1 bits (159), Expect = 3e-13
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 149 LFHSMANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNK 208
           L  + +N + +    LL+         D+   D  G TPL  AA  G+ +  K+L++   
Sbjct: 11  LHLAASNGHLEVVKLLLEN------GADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGA 64

Query: 209 NLPNMRNRIGQCPIHCAARSGHRETVEYLLS 239
           +  N R++ G  P+H AAR+G+ + V+ LL 
Sbjct: 65  D-VNARDKDGNTPLHLAARNGNLDVVKLLLK 94


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 99.98
PHA03100 480 ankyrin repeat protein; Provisional 99.98
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA03095 471 ankyrin-like protein; Provisional 99.96
PHA03100 480 ankyrin repeat protein; Provisional 99.96
PHA02791284 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02989 494 ankyrin repeat protein; Provisional 99.96
PHA02878 477 ankyrin repeat protein; Provisional 99.96
PHA03095 471 ankyrin-like protein; Provisional 99.96
PHA02874 434 ankyrin repeat protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02876 682 ankyrin repeat protein; Provisional 99.95
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.95
PHA02876 682 ankyrin repeat protein; Provisional 99.95
PHA02878 477 ankyrin repeat protein; Provisional 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
KOG0508 615 consensus Ankyrin repeat protein [General function 99.93
PHA02798 489 ankyrin-like protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02917 661 ankyrin-like protein; Provisional 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.91
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.91
KOG0514452 consensus Ankyrin repeat protein [General function 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.89
PHA02917 661 ankyrin-like protein; Provisional 99.89
PHA02792 631 ankyrin-like protein; Provisional 99.88
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.88
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.87
PHA02736154 Viral ankyrin protein; Provisional 99.87
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.86
PHA02741169 hypothetical protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.83
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.83
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
PHA02884 300 ankyrin repeat protein; Provisional 99.8
KOG0514452 consensus Ankyrin repeat protein [General function 99.8
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.79
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.78
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.78
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.78
PHA02792 631 ankyrin-like protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.76
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.73
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.66
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.65
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.63
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.61
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.56
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.54
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.53
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.48
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.44
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.41
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.37
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.35
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.94
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.88
PF1360630 Ank_3: Ankyrin repeat 98.83
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.79
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.79
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.73
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.69
PF1360630 Ank_3: Ankyrin repeat 98.68
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.65
KOG0522 560 consensus Ankyrin repeat protein [General function 98.6
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.6
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.55
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.45
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.44
KOG0522 560 consensus Ankyrin repeat protein [General function 98.31
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.26
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.17
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.14
KOG0511 516 consensus Ankyrin repeat protein [General function 98.14
KOG0511 516 consensus Ankyrin repeat protein [General function 98.06
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.02
KOG2384223 consensus Major histocompatibility complex protein 98.0
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.97
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.97
KOG2384223 consensus Major histocompatibility complex protein 97.83
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.04
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.45
KOG2505591 consensus Ankyrin repeat protein [General function 96.21
KOG2505591 consensus Ankyrin repeat protein [General function 95.88
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.28
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.08
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.92
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.07
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 92.62
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.63
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=5.5e-33  Score=209.89  Aligned_cols=166  Identities=21%  Similarity=0.232  Sum_probs=134.0

Q ss_pred             cHHHhcCCHHHHHHHHHc-CCcC---CCCCchHHHHHHHcCCHHHHHHHHhhCCCCcccccCCCCChHHHHHHhcCCchH
Q 039376           86 QIKQVKTSEDWFREMVET-GVKV---DLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEA  161 (289)
Q Consensus        86 ~~~~~~~~~~~~~~Ll~~-g~~~---~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~t~Lh~A~~~g~~~~  161 (289)
                      |.+...++.+++.+|++. +..+   |..|+||||+|+..|+.++|+.|+.+.+++++.. +..|.||||||+..|+   
T Consensus        43 Hwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~-tn~G~T~LHyAagK~r---  118 (226)
T KOG4412|consen   43 HWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNAT-TNGGQTCLHYAAGKGR---  118 (226)
T ss_pred             eeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCccee-cCCCcceehhhhcCCh---
Confidence            346667778888888853 3333   4578888888888888888888888668888888 8888888888888888   


Q ss_pred             HHHHHHHHhccCCCCccccCCCCCCHHHHHHHhCCHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhcC
Q 039376          162 HRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVT  241 (289)
Q Consensus       162 ~~~v~~Ll~~~~g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~i~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g  241 (289)
                      .+|+++|++.  |+.++.+|..|.||||-|+..|..+++++|++.|+.+ |.+|..|+||||.|...|+.+....|+++|
T Consensus       119 ~eIaqlLle~--ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~-n~qDk~G~TpL~~al~e~~~d~a~lLV~~g  195 (226)
T KOG4412|consen  119 LEIAQLLLEK--GALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPL-NTQDKYGFTPLHHALAEGHPDVAVLLVRAG  195 (226)
T ss_pred             hhHHHHHHhc--CCCCcccccccCchhHHHHhccchhhHHHHHhcCCCC-CcccccCccHHHHHHhccCchHHHHHHHhc
Confidence            8888888888  8888888888888888888888888888888888885 888888888888888888888888888888


Q ss_pred             CCcccccccCCCCcccccccchHHHHHH
Q 039376          242 GVEEEDSHEKYSNPFAGECGLKLLEILI  269 (289)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~g~~~l~~a~  269 (289)
                      ++.+          +.|+.| |++..+.
T Consensus       196 Ad~~----------~edke~-t~~~~a~  212 (226)
T KOG4412|consen  196 ADTD----------REDKEG-TALRIAC  212 (226)
T ss_pred             ccee----------eccccC-chHHHHH
Confidence            8888          888777 7776654



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 8e-07
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 9e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-05
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 3e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 6e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 8e-04
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 38/121 (31%), Positives = 66/121 (54%), Gaps = 8/121 (6%) Query: 154 ANINEDEAHRLLDEFLDMISPLDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNM 213 A +D+ R+L M + D+ D SG TPL AAI G+ + ++L+K+ ++ N Sbjct: 22 ARAGQDDEVRIL-----MANGADVNAEDDSGKTPLHLAAIKGHLEIVEVLLKHGADV-NA 75 Query: 214 RNRIGQCPIHCAARSGHRETVEYLL-SVTGVEEEDSHEKYSNPFAGECG-LKLLEILIEF 271 +++G P+H AA GH E VE LL + V D++ A + G L+++E+L+++ Sbjct: 76 ADKMGDTPLHLAALYGHLEIVEVLLKNGADVNATDTYGFTPLHLAADAGHLEIVEVLLKY 135 Query: 272 N 272 Sbjct: 136 G 136
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-10
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-09
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-06
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-12
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-11
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-11
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-12
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-12
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-10
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-09
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-10
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 3e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-11
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-04
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-09
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 5e-09
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-08
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-06
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-04
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-10
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-10
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-10
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-07
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-10
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-11
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-11
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-09
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 7e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-10
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-07
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-11
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-09
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-08
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-07
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-11
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-06
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-10
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-10
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-10
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 3e-08
2rfa_A232 Transient receptor potential cation channel subfa 4e-08
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-10
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-10
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-08
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-05
2etb_A256 Transient receptor potential cation channel subfam 8e-09
2etb_A256 Transient receptor potential cation channel subfam 5e-08
2etb_A256 Transient receptor potential cation channel subfam 1e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-08
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 9e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-04
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 3e-07
2pnn_A273 Transient receptor potential cation channel subfa 2e-05
2pnn_A273 Transient receptor potential cation channel subfa 3e-04
2pnn_A 273 Transient receptor potential cation channel subfa 4e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 5e-05
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
 Score = 67.9 bits (167), Expect = 1e-13
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 2/78 (2%)

Query: 176 DLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVE 235
            +   D     PL  AA VG+ K  ++L    K+  N +++ G  P+  A   GH +   
Sbjct: 132 SVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAV 191

Query: 236 YLLSVTG--VEEEDSHEK 251
            L+   G   +  D+   
Sbjct: 192 LLVEKYGAEYDLVDNKGA 209


>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.98
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.98
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.97
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.97
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.89
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.88
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.88
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.81
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.77
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.4e-34  Score=244.80  Aligned_cols=210  Identities=14%  Similarity=0.106  Sum_probs=164.2

Q ss_pred             hhhhhhcCCchHHHHHHHhccCCCchhhhhcCChhhhhhcccCCCCccchhcccccc---HHHhcC-CHHHHHHHHHcCC
Q 039376           30 SSRLLDSKNEDEIVKMKQKDFAQPSSKLVVGKKEDEITEMKPANDPIIEVKSHERQQ---IKQVKT-SEDWFREMVETGV  105 (289)
Q Consensus        30 ~~~~~~~~~~~~iv~~L~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~---~~~~~~-~~~~~~~Ll~~g~  105 (289)
                      ....+...|+.++|++|++.+.........                .++..+..+.+   .+...+ ...+++.|++.|+
T Consensus        14 ~L~~A~~~G~~~~v~~LL~~~~~~~~~~~~----------------~~~~~~~~~~t~L~~a~~~~~~~~~v~~Ll~~Ga   77 (269)
T 4b93_B           14 KLLRAVADGDLEMVRYLLEWTEEDLEDAED----------------TVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGL   77 (269)
T ss_dssp             HHHHHHHTTCHHHHHHHHTCC--------------------------------------------------------CCC
T ss_pred             HHHHHHHcCCHHHHHHHHHCCCcccccccc----------------cccccCccCCCHHHHHHHhCCHHHHHHHHHHCCC
Confidence            344566789999999999988654321100                00111111111   122222 2347889999999


Q ss_pred             cC---CCCCchHHHHHHHcCCHHHHHHHHhhCCCCcccccCCCCChHHHHHHhcCCchHHHHHHHHHhccCCCCccccCC
Q 039376          106 KV---DLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISPLDLEETDT  182 (289)
Q Consensus       106 ~~---~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~t~Lh~A~~~g~~~~~~~v~~Ll~~~~g~~~~~~~~  182 (289)
                      ++   |..|.||||+|++.|+.+++++|++ .+++++.+ +..|.||+|+|+..++   .+++++|++.  |++++.+|.
T Consensus        78 dvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~-~~a~~~~~-~~~g~t~l~~a~~~~~---~~~~~~Ll~~--g~~~n~~d~  150 (269)
T 4b93_B           78 GVNVTSQDGSSPLHVAALHGRADLIPLLLK-HGANAGAR-NADQAVPLHLACQQGH---FQVVKCLLDS--NAKPNKKDL  150 (269)
T ss_dssp             CTTCCCTTSCCHHHHHHHTTCTTHHHHHHH-TTCCTTCC-CTTCCCHHHHHHHHTC---HHHHHHHHHT--TCCSCCCCT
T ss_pred             CCCCcCCCCCCHHHHHHHcCcHHHHHHHHh-cCCCcCcc-CCCCCCccccccccCh---HHHHHHHHHC--CCCCCCCCC
Confidence            87   5689999999999999999999998 68999998 9999999999999999   9999999999  999999999


Q ss_pred             CCCCHHHHHHHhCCHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCcccccccc
Q 039376          183 SGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGL  262 (289)
Q Consensus       183 ~g~t~L~~A~~~g~~~~v~~Ll~~g~~i~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~  262 (289)
                      .|+||||+|+..|+.+++++|+++|+++ +.++..|+||||+|+..|+.+++++|+++|++++          +.+.+|+
T Consensus       151 ~g~TpL~~A~~~g~~~~v~~Ll~~gadv-n~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~Gad~~----------~~d~~G~  219 (269)
T 4b93_B          151 SGNTPLIYACSGGHHELVALLLQHGASI-NASNNKGNTALHEAVIEKHVFVVELLLLHGASVQ----------VLNKRQR  219 (269)
T ss_dssp             TCCCHHHHHHHTTCGGGHHHHHHTTCCT-TCBCTTSCBHHHHHHHTTCHHHHHHHHHTTCCSC----------CCCTTSC
T ss_pred             CCCCHHHHHHHCCCHHHHHHHHHCCCCC-CccccCCCcHHHHHHHcCCHHHHHHHHHCCCCCC----------CcCCCCC
Confidence            9999999999999999999999999996 9999999999999999999999999999999999          9999999


Q ss_pred             hHHHHHHHhCC
Q 039376          263 KLLEILIEFNF  273 (289)
Q Consensus       263 ~~l~~a~~~g~  273 (289)
                      |||++|+.+|.
T Consensus       220 TpL~~A~~~~~  230 (269)
T 4b93_B          220 TAVDCAEQNSK  230 (269)
T ss_dssp             CSGGGSCTTCH
T ss_pred             CHHHHHHhCCc
Confidence            99999988775



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-11
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-06
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 4e-06
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: RNase L, 2-5a-dependent ribonuclease
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.1 bits (147), Expect = 2e-11
 Identities = 20/125 (16%), Positives = 43/125 (34%), Gaps = 2/125 (1%)

Query: 115 LRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINEDEAHRLLDEFLDMISP 174
           L  A  +   + ++  + E    + A        L H++ + ++ +   +    LD    
Sbjct: 152 LMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLD--HG 209

Query: 175 LDLEETDTSGGTPLTSAAIVGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETV 234
            D+      G TPL  A    +    + L++      N  +  G+  +  A     ++  
Sbjct: 210 ADVNVRGERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIA 269

Query: 235 EYLLS 239
           E L  
Sbjct: 270 ELLCK 274


>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.96
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.93
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.92
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.91
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.9
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.87
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.81
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97  E-value=8.9e-31  Score=217.07  Aligned_cols=181  Identities=16%  Similarity=0.124  Sum_probs=159.0

Q ss_pred             ccHHHhcCCHHHHHHHHHcCCcC------CCCCchHHHHHHHcCCHHHHHHHHhhCCCCcccccCCCCChHHHHHHhcCC
Q 039376           85 QQIKQVKTSEDWFREMVETGVKV------DLGEHPQLRRALVRKDWKEVERFISENPDTLYAKFTESCGTLFHSMANINE  158 (289)
Q Consensus        85 ~~~~~~~~~~~~~~~Ll~~g~~~------~~~g~t~Lh~A~~~g~~~~v~~ll~~~~~~~~~~~~~~~~t~Lh~A~~~g~  158 (289)
                      .+.|+..++.+++++|+++|++.      |..|.||||+|+..|+.+++++|++ .|++++.+ +..|.||||+|+..++
T Consensus        13 Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~-~ga~i~~~-d~~g~tpL~~A~~~~~   90 (255)
T d1oy3d_          13 LHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYA-AGAGVLVA-ERGGHTALHLACRVRA   90 (255)
T ss_dssp             HHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHH-TTCCSSCC-CTTSCCHHHHHTTTTC
T ss_pred             HHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhccccccccccc-cccccccc-ccccchhhhhhhccCc
Confidence            45688999999999999998763      5689999999999999999999998 58999999 9999999999999999


Q ss_pred             chHHHHHHHHHhcc---------------------------------------------CCCCccccCCCCCCHHHHHHH
Q 039376          159 DEAHRLLDEFLDMI---------------------------------------------SPLDLEETDTSGGTPLTSAAI  193 (289)
Q Consensus       159 ~~~~~~v~~Ll~~~---------------------------------------------~g~~~~~~~~~g~t~L~~A~~  193 (289)
                         .+++++|++..                                             .+.+++.++..|.||||+|++
T Consensus        91 ---~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~  167 (255)
T d1oy3d_          91 ---HTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVI  167 (255)
T ss_dssp             ---HHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHHH
T ss_pred             ---hHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccccccccc
Confidence               99999986531                                             012234567889999999999


Q ss_pred             hCCHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhcCCCcccccccCCCCcccccccchHHHHHHHhCC
Q 039376          194 VGNTKAAKILVKYNKNLPNMRNRIGQCPIHCAARSGHRETVEYLLSVTGVEEEDSHEKYSNPFAGECGLKLLEILIEFNF  273 (289)
Q Consensus       194 ~g~~~~v~~Ll~~g~~i~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~g~  273 (289)
                      .++.+++++|++.+++.....+..|+||||+|+..|+.+++++|+++|++++          .++..|.||||+|+.+|+
T Consensus       168 ~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin----------~~d~~g~t~L~~A~~~~~  237 (255)
T d1oy3d_         168 HKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPT----------ARMYGGRTPLGSALLRPN  237 (255)
T ss_dssp             TTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTT----------CCCTTSCCHHHHHHTSSC
T ss_pred             ccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCC----------CCCCCCCCHHHHHHHCCC
Confidence            9999999999999998644567889999999999999999999999999999          999999999999999999


Q ss_pred             CCccccc
Q 039376          274 LGQYTCN  280 (289)
Q Consensus       274 ~~~~~~~  280 (289)
                      .++...+
T Consensus       238 ~~i~~~L  244 (255)
T d1oy3d_         238 PILARLL  244 (255)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            8865444



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure