Citrus Sinensis ID: 039381

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLRSFQDEQSSPSQSRTREHWLSAWEMENRGLWP
cccccccHHHHHHHHHccccEEEEEcHHHHHHHHHHccccEEEccccccccEEEEEccccccHHHHHHHHHcccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccc
cccccccHHHHHHHHHcccEEEEEccHHHHHHHHHHcccEEEEcccEcccccEEEcccccccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHccccc
niepifsenrhrqaLTSGEIAAAFLEVPYVKLFLAkncknfttgptysvggfgfafpkdsayLADFSQAILQLSEEGKLRELEEAmlspyncstkennedleglglrsfqdeqsspsqsrtrEHWLSAWEMENRGLWP
niepifsenrhrqaLTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLrsfqdeqsspsqsrtrehwlsawemenrglwp
NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLRSFQDEQSSPSQSRTREHWLSAWEMENRGLWP
***************TSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQL*****************************************************************
NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAM***********************QDEQSSPSQSRTREHWLSAWEMENRGL**
NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLRS**************EHWLSAWEMENRGLWP
*IEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYN************************************AWEMENR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLRSFQDEQSSPSQSRTREHWLSAWEMENRGLWP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query138 2.2.26 [Sep-21-2011]
Q93YT1912 Glutamate receptor 3.2 OS yes no 0.768 0.116 0.431 7e-16
Q7XJL2921 Glutamate receptor 3.1 OS no no 0.768 0.115 0.407 2e-15
Q8GXJ4959 Glutamate receptor 3.4 OS no no 0.782 0.112 0.385 1e-12
Q9C8E7933 Glutamate receptor 3.3 OS no no 0.681 0.100 0.382 5e-12
O81776896 Glutamate receptor 2.4 OS no no 0.615 0.094 0.409 6e-12
Q9SDQ4921 Glutamate receptor 3.7 OS no no 0.775 0.116 0.380 1e-11
Q84W41903 Glutamate receptor 3.6 OS no no 0.768 0.117 0.345 2e-11
Q9SW97953 Glutamate receptor 3.5 OS no no 0.782 0.113 0.359 5e-11
O81078 940 Glutamate receptor 2.9 OS no no 0.601 0.088 0.390 2e-10
Q9SHV2895 Glutamate receptor 2.3 OS no no 0.492 0.075 0.449 3e-10
>sp|Q93YT1|GLR32_ARATH Glutamate receptor 3.2 OS=Arabidopsis thaliana GN=GLR3.2 PE=1 SV=2 Back     alignment and function desciption
 Score = 82.4 bits (202), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 47/109 (43%), Positives = 64/109 (58%), Gaps = 3/109 (2%)

Query: 4   PIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYL 63
           P+ S   +  AL +G +AA   E PYV LFL++ C     G  ++  G+GFAFP+DS   
Sbjct: 721 PLGSPKEYAAALQNGTVAAIVDERPYVDLFLSEFCGFAIRGQEFTRSGWGFAFPRDSPLA 780

Query: 64  ADFSQAILQLSEEGKLRELEEAMLSPYNCST---KENNEDLEGLGLRSF 109
            D S AIL LSE G+L+++ +  LS  NCS      ++ED E L LRSF
Sbjct: 781 IDMSTAILGLSETGQLQKIHDKWLSRSNCSNLNGSVSDEDSEQLKLRSF 829
Glutamate-gated receptor that probably acts as non-selective cation channel. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells. Could play a role in calcium unloading from xylem.
Arabidopsis thaliana (taxid: 3702)
>sp|Q7XJL2|GLR31_ARATH Glutamate receptor 3.1 OS=Arabidopsis thaliana GN=GLR3.1 PE=2 SV=2 Back     alignment and function description
>sp|Q8GXJ4|GLR34_ARATH Glutamate receptor 3.4 OS=Arabidopsis thaliana GN=GLR3.4 PE=2 SV=2 Back     alignment and function description
>sp|Q9C8E7|GLR33_ARATH Glutamate receptor 3.3 OS=Arabidopsis thaliana GN=GLR3.3 PE=2 SV=1 Back     alignment and function description
>sp|O81776|GLR24_ARATH Glutamate receptor 2.4 OS=Arabidopsis thaliana GN=GLR2.4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SDQ4|GLR37_ARATH Glutamate receptor 3.7 OS=Arabidopsis thaliana GN=GLR3.7 PE=2 SV=2 Back     alignment and function description
>sp|Q84W41|GLR36_ARATH Glutamate receptor 3.6 OS=Arabidopsis thaliana GN=GLR3.6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SW97|GLR35_ARATH Glutamate receptor 3.5 OS=Arabidopsis thaliana GN=GLR3.5 PE=2 SV=2 Back     alignment and function description
>sp|O81078|GLR29_ARATH Glutamate receptor 2.9 OS=Arabidopsis thaliana GN=GLR2.9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHV2|GLR23_ARATH Glutamate receptor 2.3 OS=Arabidopsis thaliana GN=GLR2.3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
224121836153 glutamate-gated kainate-type ion channel 0.724 0.653 0.534 5e-23
147768651 794 hypothetical protein VITISV_011992 [Viti 0.789 0.137 0.518 6e-22
359493621 1452 PREDICTED: glutamate receptor 2.7-like [ 0.789 0.075 0.518 7e-22
302142930 1391 unnamed protein product [Vitis vinifera] 0.789 0.078 0.518 1e-21
449456599 859 PREDICTED: glutamate receptor 2.5-like [ 0.789 0.126 0.481 1e-20
307135943 863 glutamate-gated kainate-type ion channel 0.789 0.126 0.463 1e-20
359493615 1162 PREDICTED: glutamate receptor 2.8-like [ 0.681 0.080 0.494 3e-20
359493617 886 PREDICTED: glutamate receptor 2.7-like [ 0.681 0.106 0.536 3e-20
302142929 1053 unnamed protein product [Vitis vinifera] 0.681 0.089 0.536 4e-20
125554140 873 hypothetical protein OsI_21730 [Oryza sa 0.623 0.098 0.574 5e-20
>gi|224121836|ref|XP_002330665.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222872269|gb|EEF09400.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%), Gaps = 1/101 (0%)

Query: 11  HRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTT-GPTYSVGGFGFAFPKDSAYLADFSQA 69
           + QAL S EIAAA+LEVP +K+FLAK+CK FTT GPTY VGGFGF FP+ S YL D S+A
Sbjct: 4   YAQALVSEEIAAAYLEVPCIKVFLAKHCKGFTTSGPTYRVGGFGFFFPRSSPYLLDISEA 63

Query: 70  ILQLSEEGKLRELEEAMLSPYNCSTKENNEDLEGLGLRSFQ 110
           +++++E G L++L  ++ S Y C   E++E+ + L L SF+
Sbjct: 64  VVEVAESGALKDLGNSLTSSYKCLASESDENTDRLRLSSFR 104

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147768651|emb|CAN71665.1| hypothetical protein VITISV_011992 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493621|ref|XP_002282909.2| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142930|emb|CBI20225.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449456599|ref|XP_004146036.1| PREDICTED: glutamate receptor 2.5-like [Cucumis sativus] gi|449528706|ref|XP_004171344.1| PREDICTED: glutamate receptor 2.5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307135943|gb|ADN33804.1| glutamate-gated kainate-type ion channel receptor subunit glur5 [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|359493615|ref|XP_003634636.1| PREDICTED: glutamate receptor 2.8-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493617|ref|XP_002282943.2| PREDICTED: glutamate receptor 2.7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142929|emb|CBI20224.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125554140|gb|EAY99745.1| hypothetical protein OsI_21730 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
TAIR|locus:2122128912 GLUR2 "glutamate receptor 2" [ 0.768 0.116 0.431 1.9e-14
TAIR|locus:2207165959 GLR3.4 "AT1G05200" [Arabidopsi 0.782 0.112 0.385 8.2e-13
TAIR|locus:2206095933 GLR3.3 "glutamate receptor 3.3 0.673 0.099 0.421 7.2e-12
TAIR|locus:2062586921 GLR5 "glutamate receptor 5" [A 0.775 0.116 0.389 3.9e-11
TAIR|locus:2066086 947 GLR2.8 "glutamate receptor 2.8 0.782 0.114 0.327 1.1e-10
TAIR|locus:2066148 940 GLR2.9 "glutamate receptor 2.9 0.782 0.114 0.353 1.4e-10
TAIR|locus:2081805903 GLR3.6 "glutamate receptor 3.6 0.768 0.117 0.345 1.7e-10
TAIR|locus:2047256920 GLR2.2 "glutamate receptor 2.2 0.608 0.091 0.413 5.9e-10
TAIR|locus:2047251895 GLR2.3 "glutamate receptor 2.3 0.601 0.092 0.395 7.3e-10
TAIR|locus:2181196901 GLR2.1 "glutamate receptor 2.1 0.601 0.092 0.383 7.3e-10
TAIR|locus:2122128 GLUR2 "glutamate receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 1.9e-14, P = 1.9e-14
 Identities = 47/109 (43%), Positives = 64/109 (58%)

Query:     4 PIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYL 63
             P+ S   +  AL +G +AA   E PYV LFL++ C     G  ++  G+GFAFP+DS   
Sbjct:   721 PLGSPKEYAAALQNGTVAAIVDERPYVDLFLSEFCGFAIRGQEFTRSGWGFAFPRDSPLA 780

Query:    64 ADFSQAILQLSEEGKLRELEEAMLSPYNCSTKE---NNEDLEGLGLRSF 109
              D S AIL LSE G+L+++ +  LS  NCS      ++ED E L LRSF
Sbjct:   781 IDMSTAILGLSETGQLQKIHDKWLSRSNCSNLNGSVSDEDSEQLKLRSF 829
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=IMP
GO:0006883 "cellular sodium ion homeostasis" evidence=IMP
GO:0030007 "cellular potassium ion homeostasis" evidence=IMP
GO:0009416 "response to light stimulus" evidence=NAS
GO:0030003 "cellular cation homeostasis" evidence=RCA
TAIR|locus:2207165 GLR3.4 "AT1G05200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206095 GLR3.3 "glutamate receptor 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062586 GLR5 "glutamate receptor 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066148 GLR2.9 "glutamate receptor 2.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081805 GLR3.6 "glutamate receptor 3.6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047256 GLR2.2 "glutamate receptor 2.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047251 GLR2.3 "glutamate receptor 2.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181196 GLR2.1 "glutamate receptor 2.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01420081
glutamate-gated kainate-type ion channel receptor subunit GluR5 (153 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 1e-20
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 7e-20
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 4e-08
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 4e-05
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 9e-05
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information 
 Score = 83.9 bits (208), Expect = 1e-20
 Identities = 36/101 (35%), Positives = 49/101 (48%), Gaps = 3/101 (2%)

Query: 13  QALTSGEIAAAFL-EVPYVKLFLAKNCKNFTT-GPTYSVGGFGFAFPKDSAYLADFSQAI 70
           Q +  G    AFL E  Y++  +A++    TT G  +   G+G AFPK S      S+AI
Sbjct: 158 QRVRKGNGLYAFLMESAYLEYEVARDPCKLTTVGEVFGTKGYGIAFPKGSPLRDKLSRAI 217

Query: 71  LQLSEEGKLRELEEA-MLSPYNCSTKENNEDLEGLGLRSFQ 110
           L+L E G+L++LE         CS K        LGL SF 
Sbjct: 218 LELRESGELQKLENKWWKKKGECSLKSTAVSSSQLGLESFA 258

This family includes the four transmembrane regions of the ionotropic glutamate receptors and NMDA receptors. Length = 268
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
KOG1053 1258 consensus Glutamate-gated NMDA-type ion channel re 99.9
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.8
KOG4440 993 consensus NMDA selective glutamate-gated ion chann 99.77
KOG1054897 consensus Glutamate-gated AMPA-type ion channel re 99.61
KOG1052656 consensus Glutamate-gated kainate-type ion channel 99.54
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.46
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.42
PRK11260266 cystine transporter subunit; Provisional 99.41
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.37
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.3
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.28
PRK15007243 putative ABC transporter arginine-biding protein; 99.27
TIGR02285268 conserved hypothetical protein. Members of this fa 99.24
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.2
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.18
PRK15437259 histidine ABC transporter substrate-binding protei 99.12
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.12
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 99.09
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.0
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 98.98
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 98.95
cd00134218 PBPb Bacterial periplasmic transport systems use m 98.94
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 98.88
PRK09959 1197 hybrid sensory histidine kinase in two-component r 98.87
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.24
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 97.85
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.73
COG4623 473 Predicted soluble lytic transglycosylase fused to 97.49
PF03401274 TctC: Tripartite tricarboxylate transporter family 96.37
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 95.19
COG3181319 Uncharacterized protein conserved in bacteria [Fun 95.1
PRK11553314 alkanesulfonate transporter substrate-binding subu 94.09
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 93.35
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 92.97
PF09084216 NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent 92.68
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 87.83
smart00094 332 TR_FER Transferrin. 87.72
TIGR01728 288 SsuA_fam ABC transporter, substrate-binding protei 85.82
TIGR00363258 lipoprotein, YaeC family. This family of putative 85.82
TIGR01729 300 taurine_ABC_bnd taurine ABC transporter, periplasm 85.32
PF03180237 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR0048 85.16
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 84.86
PRK11553 314 alkanesulfonate transporter substrate-binding subu 84.68
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 84.04
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 83.56
PRK11063271 metQ DL-methionine transporter substrate-binding s 81.19
PRK03537188 molybdate ABC transporter periplasmic molybdate-bi 80.9
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 80.85
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 80.57
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information 
Probab=99.90  E-value=1.1e-24  Score=186.53  Aligned_cols=124  Identities=21%  Similarity=0.355  Sum_probs=114.9

Q ss_pred             CCHHHHHHHHHcCCceEEEecHHHHHHHHHhc--CCCeeeC--CCCCcceeEEEEeCCChhHHHHHHHHHHHhhcCcHHH
Q 039381            6 FSENRHRQALTSGEIAAAFLEVPYVKLFLAKN--CKNFTTG--PTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRE   81 (138)
Q Consensus         6 ~~~~e~~~aL~~G~vdA~i~d~~~l~~~~~~~--~~~~~~~--~~~~~~~~g~a~~Kgspl~~~in~~l~~l~~~G~~~~   81 (138)
                      ..++++++.|++|++||+|+|.+++.|.+.++  |+.+++|  +.|..++||||+|||||++..||.+|+++..+|++++
T Consensus       720 ~~v~dal~sLK~gKLDAFIyDaAVLnY~agkDegCKLvTIGsgKvFAttGYGIal~k~Spwkr~IdlallQy~gdGeme~  799 (1258)
T KOG1053|consen  720 PGVEDALESLKNGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIALPKNSPWKRQIDLALLQYLGDGEMEM  799 (1258)
T ss_pred             CchHHHHHHHhcccchhHHHHHHHHHHhhccCCCceEEEecCCceeeecceeeecCCCCcchhhHHHHHHHHhccchHHH
Confidence            46799999999999999999999999998764  8744466  8999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCCCCCCCCccCCcccccccceeeeehhhhhhhHhhhhhh
Q 039381           82 LEEAMLSPYNCSTKENNEDLEGLGLRSFQDEQSSPSQSRTREHWLSAWE  130 (138)
Q Consensus        82 l~~kW~~~~~c~~~~~~~~~~~l~~~~~~G~F~~~g~~~~~~~~~~~~~  130 (138)
                      |.++|+. +.|+++.+++++.+|+++||+|+||+|++++..+...+.||
T Consensus       800 Le~~Wlt-gic~n~k~evmSsqLdIdnmaGvFymL~~amgLSllvfi~E  847 (1258)
T KOG1053|consen  800 LETLWLT-GICHNSKNEVMSSQLDIDNMAGVFYMLAVAMGLSLLVFIWE  847 (1258)
T ss_pred             HHHHHhh-cccccchhhhhhcccChhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            9999996 79998878899999999999999999999999999999887

>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03401 TctC: Tripartite tricarboxylate transporter family receptor; InterPro: IPR005064 Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth [] Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>smart00094 TR_FER Transferrin Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>TIGR00363 lipoprotein, YaeC family Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PF03180 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR004872 This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK03537 molybdate ABC transporter periplasmic molybdate-binding protein; Provisional Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 1e-04
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 2e-04
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 5e-04
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 7e-04
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 7e-04
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 7e-04
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 7e-04
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 9e-04
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 9e-04
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 9e-04
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure 
Iteration: 1

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%)
Query: 22  AAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRE 81
           A  +E   ++    +NC     G      G+G   PK S Y    + AILQL EEGKL  
Sbjct: 187 AFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPKGSPYRDKITIAILQLQEEGKLHM 246
Query: 82  LEE 84
           ++E
Sbjct: 247 MKE 249
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 4e-24
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-12
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 2e-12
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 8e-12
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 5e-11
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 7e-11
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-09
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 5e-09
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 7e-09
3qax_A268 Probable ABC transporter arginine-binding protein; 8e-08
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 1e-07
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 2e-07
3del_B242 Arginine binding protein; alpha and beta protein ( 2e-07
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 6e-07
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 7e-07
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 1e-06
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 2e-06
3tql_A227 Arginine-binding protein; transport and binding pr 3e-06
3k4u_A245 Binding component of ABC transporter; structural g 3e-06
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 4e-06
3hv1_A268 Polar amino acid ABC uptake transporter substrate 6e-06
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 6e-06
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 7e-06
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 1e-05
2yln_A283 Putative ABC transporter, periplasmic binding Pro 3e-05
2o1m_A258 Probable amino-acid ABC transporter extracellular- 5e-05
2q88_A257 EHUB, putative ABC transporter amino acid-binding 9e-05
3kzg_A237 Arginine 3RD transport system periplasmic binding 9e-05
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 2e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score = 95.6 bits (237), Expect = 4e-24
 Identities = 24/103 (23%), Positives = 39/103 (37%), Gaps = 4/103 (3%)

Query: 12  RQALTSGEIAAAFLEVPYVKLFLAKNCKNFTT-GPTYSVGGFGFAFPKDSAYLADFSQAI 70
            +   S    A  LE    +    +   +    G      G+G A PK S+     + A+
Sbjct: 682 ARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAV 741

Query: 71  LQLSEEGKLRELEEAMLSPYN-CSTKENN--EDLEGLGLRSFQ 110
           L+LSE+G L +L+         C  K++   E    L L +  
Sbjct: 742 LKLSEQGLLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVA 784
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 99.73
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.7
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.67
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.65
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.61
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.6
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.6
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.57
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.56
3del_B242 Arginine binding protein; alpha and beta protein ( 99.55
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.53
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.53
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.51
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.51
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.51
3k4u_A245 Binding component of ABC transporter; structural g 99.5
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.45
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.45
3qax_A268 Probable ABC transporter arginine-binding protein; 99.44
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.42
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.42
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.42
3tql_A227 Arginine-binding protein; transport and binding pr 99.42
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.39
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.39
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.38
2vha_A287 Periplasmic binding transport protein; periplasmic 99.36
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.36
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.35
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.35
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.34
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.3
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.3
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.25
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.25
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.22
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 98.95
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.55
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.53
2f5x_A312 BUGD; periplasmic binding protein, transport prote 97.82
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 97.79
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 97.75
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 97.7
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 96.73
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 96.71
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 94.64
3qsl_A346 Putative exported protein; unknown, structural gen 93.91
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, s 93.21
3ix1_A 302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 91.94
2g29_A417 Nitrate transport protein NRTA; solute-binding pro 91.72
3ksx_A 324 Nitrate transport protein; SSUA, alkanesulfonate-b 91.67
3un6_A 341 Hypothetical protein saouhsc_00137; structural gen 91.33
2xxp_A 398 CPS2A; replication, peptidoglycan, LCP, LYTR; HET: 91.28
3qsl_A 346 Putative exported protein; unknown, structural gen 91.02
4esw_A 342 Pyrimidine biosynthesis enzyme THI13; thiamin pyri 90.68
3up9_A245 Putative uncharacterized protein; membrane lipopro 90.33
3gxa_A275 Outer membrane lipoprotein GNA1946; periplasmic, L 90.31
2de3_A365 Dibenzothiophene desulfurization enzyme B; alpha-b 90.0
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 89.72
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 89.44
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 89.36
2x26_A 308 Periplasmic aliphatic sulphonates-binding protein; 88.44
3k2d_A237 ABC-type metal ION transport system, periplasmic; 88.1
3ir1_A245 Outer membrane lipoprotein GNA1946; D-methionine c 86.9
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- 85.83
4ib2_A252 Putative lipoprotein; putative methionine-bindning 85.75
3muq_A237 Uncharacterized conserved protein; structural geno 85.67
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 84.84
3tqw_A240 Methionine-binding protein; transport and binding 84.56
4ef1_A246 Pheromone COB1/lipoprotein, YAEC family; periplasm 84.19
3skp_A 342 Serotransferrin; iron binding protein, transferrin 84.03
3r26_A237 Molybdate-binding periplasmic protein; protein bin 83.47
1iej_A 332 Ovotransferrin; iron, metal binding protein; 1.65A 82.5
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; peripl 81.44
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 80.81
1h45_A 334 Lactoferrin; metal transport, iron transport, meta 80.79
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 80.32
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 80.15
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=99.73  E-value=1.3e-17  Score=142.84  Aligned_cols=125  Identities=21%  Similarity=0.248  Sum_probs=107.2

Q ss_pred             cCCHHHHHHHHH-cCCceEEEecHHHHHHHHHhc-CCCee-eCCCCCcceeEEEEeCCChhHHHHHHHHHHHhhcCcHHH
Q 039381            5 IFSENRHRQALT-SGEIAAAFLEVPYVKLFLAKN-CKNFT-TGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLRE   81 (138)
Q Consensus         5 ~~~~~e~~~aL~-~G~vdA~i~d~~~l~~~~~~~-~~~~~-~~~~~~~~~~g~a~~Kgspl~~~in~~l~~l~~~G~~~~   81 (138)
                      +++.++++++++ +++.+|++.|.+.+.|+.+++ |+ +. +++.+...+|||++||||||++.||.+|++|+++|.+++
T Consensus       674 ~~~~~~~~~~~~~~~~~~A~~~~~~~~~y~~~~~~c~-l~~v~~~~~~~~~~~~~~k~spl~~~~~~~il~l~e~G~~~~  752 (823)
T 3kg2_A          674 VRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCD-TMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGLLDK  752 (823)
T ss_dssp             BSSHHHHHHHHHTTTTSEEEEEEHHHHHHHHTSTTCC-EEEESCCSSCEEECCEEETTCSSHHHHHHHHHHHHHTTHHHH
T ss_pred             cCCHHHHHHHHhccCCceEEEechHHHHHHHhcCCCc-eEEccccccccceeEeecCCChHHHHHHHHHHHHHhCCcHHH
Confidence            468899999998 677899999999999887776 76 88 999999999999999999999999999999999999999


Q ss_pred             HHHHhcCC-CCCCCCCC--CCccCCcccccccceeeeehhhhhhhHhhhhhh
Q 039381           82 LEEAMLSP-YNCSTKEN--NEDLEGLGLRSFQDEQSSPSQSRTREHWLSAWE  130 (138)
Q Consensus        82 l~~kW~~~-~~c~~~~~--~~~~~~l~~~~~~G~F~~~g~~~~~~~~~~~~~  130 (138)
                      +.+||+.. ..|.....  ...+.+|+++++.|+|++++++++++..++-+|
T Consensus       753 ~~~~w~~~~~~c~~~~~~~~~~~~~L~l~~l~g~f~il~~g~~la~~vf~~E  804 (823)
T 3kg2_A          753 LKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIE  804 (823)
T ss_dssp             HHHHHHTTSCSCSSTTTSTTTCCCSCCSHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHhhCcCCCCCCCCCccccccCCccchhhhhhHHHHHHHHHHHHHHHHHHH
Confidence            99999864 68987532  356779999999999999988765555555444
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2xxp_A CPS2A; replication, peptidoglycan, LCP, LYTR; HET: DSL PEG; 1.69A {Streptococcus pneumoniae} PDB: 3tep_A* 3tfl_A* 2xxq_A* 3tel_A* 4de8_A* Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>4esw_A Pyrimidine biosynthesis enzyme THI13; thiamin pyrimidine biosynthesis, transferase; HET: CIT; 1.60A {Candida albicans} PDB: 4esx_A* Back     alignment and structure
>3up9_A Putative uncharacterized protein; membrane lipoprotein, L-methionine binding protein, NLPA LIP structural genomics; HET: PG4 PE4; 2.35A {Actinomyces odontolyticus} SCOP: c.94.1.0 Back     alignment and structure
>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} Back     alignment and structure
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3k2d_A ABC-type metal ION transport system, periplasmic; alpha/beta domain, immune system; 2.60A {Vibrio vulnificus} Back     alignment and structure
>3ir1_A Outer membrane lipoprotein GNA1946; D-methionine cultured, protein binding; 2.15A {Neisseria meningitidis} Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>4ib2_A Putative lipoprotein; putative methionine-bindning, NLPA lipoprotein, PF03180 FAMI structural genomics, joint center for structural genomics; 1.76A {Ruminococcus gnavus} Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3tqw_A Methionine-binding protein; transport and binding proteins, transport protein; HET: MSE; 2.00A {Coxiella burnetii} Back     alignment and structure
>4ef1_A Pheromone COB1/lipoprotein, YAEC family; periplasmic methionine binding protein, NLPA lipoprotein, ST genomics; 1.90A {Enterococcus faecalis} PDB: 4ef2_A* Back     alignment and structure
>3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 138
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 7e-12
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 5e-11
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 1e-10
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 1e-08
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-06
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 6e-05
d1lsta_238 c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding 1e-04
d1xt8a1248 c.94.1.1 (A:10-257) Putative amino-acid transporte 3e-04
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 58.9 bits (141), Expect = 7e-12
 Identities = 21/94 (22%), Positives = 40/94 (42%)

Query: 1   NIEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFTTGPTYSVGGFGFAFPKDS 60
                 S     QA+   ++ A   +   ++   ++ C   TTG  +   GFG    KDS
Sbjct: 196 EKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDS 255

Query: 61  AYLADFSQAILQLSEEGKLRELEEAMLSPYNCST 94
            +  + S +IL+  E G + +L++  +    C +
Sbjct: 256 PWKQNVSLSILKSHENGFMEDLDKTWVRYQECDS 289
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Length = 238 Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Length = 248 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.77
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.73
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.6
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.57
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.49
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.46
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.33
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.19
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.81
d1xs5a_240 Putative lipoprotein (NlpA family) {Treponema pall 92.73
d1ce2a1 333 Lactoferrin {Domestic water buffalo (Bubalus arnee 85.0
d2hava1 325 Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId 82.68
d1h76a2 346 Transferrin {Pig (Sus scrofa) [TaxId: 9823]} 80.78
d1p99a_255 Putative lipoprotein (NlpA family) {Staphylococcus 80.43
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.77  E-value=5.9e-19  Score=133.09  Aligned_cols=92  Identities=22%  Similarity=0.391  Sum_probs=86.7

Q ss_pred             eeecCCHHHHHHHHHcCCceEEEecHHHHHHHHHhcCCCee-eCCCCCcceeEEEEeCCChhHHHHHHHHHHHhhcCcHH
Q 039381            2 IEPIFSENRHRQALTSGEIAAAFLEVPYVKLFLAKNCKNFT-TGPTYSVGGFGFAFPKDSAYLADFSQAILQLSEEGKLR   80 (138)
Q Consensus         2 i~~~~~~~e~~~aL~~G~vdA~i~d~~~l~~~~~~~~~~~~-~~~~~~~~~~g~a~~Kgspl~~~in~~l~~l~~~G~~~   80 (138)
                      ++.|++..+++++|.+|++||++.|.+.+.++.++.|+ +. ++..+..++||||++||+||++.||.+|.+|+++|+++
T Consensus       197 ~~~~~~~~~~~~~l~~g~~da~i~d~~~~~~~~~~~~~-l~~~~~~~~~~~~~~a~~k~~~l~~~in~al~~l~~~G~~~  275 (289)
T d1pb7a_         197 KHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCD-LVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFME  275 (289)
T ss_dssp             TTCBSSHHHHHHHHHTTSCSEEEEEHHHHHHHHHHCTT-EEECSSCSEEEEECCEEETTCSSHHHHHHHHHHHHHSSHHH
T ss_pred             EEEcCCHHHHHHHHhCCCeEEEEehhhHHHHHHhhCCC-EEEeccccCceeEEEEEcCChHHHHHHHHHHHHHHHCCHHH
Confidence            46789999999999999999999999999999888886 88 99999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCCCC
Q 039381           81 ELEEAMLSPYNCST   94 (138)
Q Consensus        81 ~l~~kW~~~~~c~~   94 (138)
                      +|++|||+.++|.+
T Consensus       276 ~l~~Kw~~~~~c~~  289 (289)
T d1pb7a_         276 DLDKTWVRYQECDS  289 (289)
T ss_dssp             HHHHHHTSSSCCCC
T ss_pred             HHHHhccCCCCCCC
Confidence            99999999999963
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Back     information, alignment and structure
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure