Citrus Sinensis ID: 039580


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHEEEEEEEEcccccccEEEc
MKSETLTMVLVNLAGIMEradesllpgvykevgaalctdptglgslTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVadstdesnrgmAFGWLQLTgnfgsiigglc
MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLqltgnfgsiigglc
MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
*****LTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGG**
**SETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
*KSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHoo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
224099933 520 predicted protein [Populus trichocarpa] 1.0 0.286 0.926 2e-73
224096193 520 predicted protein [Populus trichocarpa] 1.0 0.286 0.899 7e-72
225439014 526 PREDICTED: uncharacterized protein LOC10 1.0 0.283 0.892 8e-72
296090607 521 unnamed protein product [Vitis vinifera] 1.0 0.285 0.892 1e-71
224099937 465 predicted protein [Populus trichocarpa] 1.0 0.320 0.885 6e-71
449451621 520 PREDICTED: protein spinster-like [Cucumi 1.0 0.286 0.865 7e-70
357489577 506 Quinolone resistance protein norA [Medic 0.993 0.292 0.878 7e-70
449502871 521 PREDICTED: LOW QUALITY PROTEIN: uncharac 1.0 0.285 0.838 8e-68
449437244 521 PREDICTED: uncharacterized protein LOC10 1.0 0.285 0.838 9e-68
255545694 526 carbohydrate transporter, putative [Rici 1.0 0.283 0.852 1e-67
>gi|224099933|ref|XP_002334427.1| predicted protein [Populus trichocarpa] gi|222872190|gb|EEF09321.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  279 bits (714), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/149 (92%), Positives = 143/149 (95%)

Query: 1   MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPL 60
           MK ETLT+VLVNLAGIMERADESLLPGVYKEVGAAL TDPTGLGSLTLFRSIVQSSCYPL
Sbjct: 1   MKQETLTLVLVNLAGIMERADESLLPGVYKEVGAALHTDPTGLGSLTLFRSIVQSSCYPL 60

Query: 61  AAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVA 120
           AAYL+VHHN AH+IALGAFLWAAATFLVAIS+TF +VAVSRGLNGIGLAIVT AIQSLVA
Sbjct: 61  AAYLAVHHNRAHVIALGAFLWAAATFLVAISSTFLEVAVSRGLNGIGLAIVTPAIQSLVA 120

Query: 121 DSTDESNRGMAFGWLQLTGNFGSIIGGLC 149
           DSTDESNRGMAFGWLQLTGN GSIIGGLC
Sbjct: 121 DSTDESNRGMAFGWLQLTGNLGSIIGGLC 149




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224096193|ref|XP_002310569.1| predicted protein [Populus trichocarpa] gi|222853472|gb|EEE91019.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225439014|ref|XP_002262789.1| PREDICTED: uncharacterized protein LOC100241664 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090607|emb|CBI40991.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099937|ref|XP_002334428.1| predicted protein [Populus trichocarpa] gi|222872191|gb|EEF09322.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449451621|ref|XP_004143560.1| PREDICTED: protein spinster-like [Cucumis sativus] gi|449496531|ref|XP_004160158.1| PREDICTED: protein spinster-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357489577|ref|XP_003615076.1| Quinolone resistance protein norA [Medicago truncatula] gi|355516411|gb|AES98034.1| Quinolone resistance protein norA [Medicago truncatula] Back     alignment and taxonomy information
>gi|449502871|ref|XP_004161766.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101220496 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437244|ref|XP_004136402.1| PREDICTED: uncharacterized protein LOC101220496 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545694|ref|XP_002513907.1| carbohydrate transporter, putative [Ricinus communis] gi|223546993|gb|EEF48490.1| carbohydrate transporter, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
TAIR|locus:2194749 490 UNE2 "AT1G78130" [Arabidopsis 1.0 0.304 0.805 4.3e-61
TAIR|locus:2184163 488 AT5G10190 "AT5G10190" [Arabido 1.0 0.305 0.845 5.5e-61
TAIR|locus:2115430 489 AT4G36790 "AT4G36790" [Arabido 0.966 0.294 0.479 7.4e-30
TAIR|locus:2046313 473 AT2G18590 "AT2G18590" [Arabido 0.953 0.300 0.377 2.1e-22
UNIPROTKB|F1NJ05 484 SPNS3 "Uncharacterized protein 0.939 0.289 0.289 1.4e-06
TAIR|locus:2194749 UNE2 "AT1G78130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 625 (225.1 bits), Expect = 4.3e-61, P = 4.3e-61
 Identities = 120/149 (80%), Positives = 137/149 (91%)

Query:     1 MKSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPL 60
             MK+ET+T++LVNLAGIMERADESLLPGVYKEVG AL TDPTGLGSLTL RS+VQ++CYPL
Sbjct:     1 MKAETMTLLLVNLAGIMERADESLLPGVYKEVGLALHTDPTGLGSLTLLRSMVQAACYPL 60

Query:    61 AAYLSVHHNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVA 120
             AAY+++ HN AH+IALGAFLW+AATFLVA S+TFFQVAVSR LNGIGLA+V  AIQSLVA
Sbjct:    61 AAYMAIRHNRAHVIALGAFLWSAATFLVAFSSTFFQVAVSRALNGIGLALVAPAIQSLVA 120

Query:   121 DSTDESNRGMAFGWLQLTGNFGSIIGGLC 149
             DSTD++NRG AFGWLQLT N GSI+GGLC
Sbjct:   121 DSTDDANRGTAFGWLQLTANIGSILGGLC 149




GO:0005351 "sugar:hydrogen symporter activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0009567 "double fertilization forming a zygote and endosperm" evidence=IMP
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2184163 AT5G10190 "AT5G10190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115430 AT4G36790 "AT4G36790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046313 AT2G18590 "AT2G18590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ05 SPNS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.1413.4.1
hypothetical protein (465 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 4e-09
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 9e-09
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 0.002
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
 Score = 53.5 bits (129), Expect = 4e-09
 Identities = 34/141 (24%), Positives = 61/141 (43%)

Query: 8   MVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVH 67
           ++L+ L   +   D  LL      +   L    +  G +    S+  +    LA YLS  
Sbjct: 1   LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDR 60

Query: 68  HNCAHIIALGAFLWAAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESN 127
                ++ LG  L+A  + L+A +++ + + V R L G+G   +  A  +L+A+      
Sbjct: 61  FGRRRVLLLGLLLFALGSLLLAFASSLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKE 120

Query: 128 RGMAFGWLQLTGNFGSIIGGL 148
           RG A G        G+++G L
Sbjct: 121 RGRALGLFSAGFGLGALLGPL 141


MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated. Length = 352

>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.91
PRK03545 390 putative arabinose transporter; Provisional 99.89
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.89
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.88
PRK03633 381 putative MFS family transporter protein; Provision 99.88
TIGR00891 405 2A0112 putative sialic acid transporter. 99.88
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.87
PRK12307 426 putative sialic acid transporter; Provisional 99.86
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.86
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.86
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.86
PRK09705 393 cynX putative cyanate transporter; Provisional 99.85
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.85
PRK03699 394 putative transporter; Provisional 99.85
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.85
PRK10091 382 MFS transport protein AraJ; Provisional 99.85
PRK10504 471 putative transporter; Provisional 99.84
PRK11663 434 regulatory protein UhpC; Provisional 99.84
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.84
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.84
PRK12382 392 putative transporter; Provisional 99.84
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.84
PRK03893 496 putative sialic acid transporter; Provisional 99.83
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.83
PRK10642 490 proline/glycine betaine transporter; Provisional 99.83
PRK05122 399 major facilitator superfamily transporter; Provisi 99.83
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.83
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.83
PRK10133 438 L-fucose transporter; Provisional 99.82
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.82
PRK15075 434 citrate-proton symporter; Provisional 99.82
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.82
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.82
TIGR00893 399 2A0114 d-galactonate transporter. 99.82
TIGR00900 365 2A0121 H+ Antiporter protein. 99.82
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.82
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.81
TIGR00895 398 2A0115 benzoate transport. 99.81
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.81
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.81
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.81
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.8
PRK10054 395 putative transporter; Provisional 99.8
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.8
PLN00028 476 nitrate transmembrane transporter; Provisional 99.8
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.8
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.8
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.79
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.79
PRK11043 401 putative transporter; Provisional 99.78
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.78
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.78
PRK09952 438 shikimate transporter; Provisional 99.78
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.78
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.78
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.77
PRK09874 408 drug efflux system protein MdtG; Provisional 99.77
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.76
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.76
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.75
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.74
TIGR00898 505 2A0119 cation transport protein. 99.73
PRK10489 417 enterobactin exporter EntS; Provisional 99.73
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.73
TIGR00805 633 oat sodium-independent organic anion transporter. 99.71
PTZ00207 591 hypothetical protein; Provisional 99.71
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.69
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.68
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.65
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.65
KOG2615 451 consensus Permease of the major facilitator superf 99.64
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.64
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.64
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.63
TIGR00895398 2A0115 benzoate transport. 99.63
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.63
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.63
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.63
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.62
TIGR00900365 2A0121 H+ Antiporter protein. 99.62
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.62
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.61
KOG0254 513 consensus Predicted transporter (major facilitator 99.61
KOG2532 466 consensus Permease of the major facilitator superf 99.59
TIGR00901356 2A0125 AmpG-related permease. 99.59
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.59
PRK15011393 sugar efflux transporter B; Provisional 99.58
KOG2533 495 consensus Permease of the major facilitator superf 99.58
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.57
TIGR00891405 2A0112 putative sialic acid transporter. 99.57
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.57
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.57
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.57
PRK11902 402 ampG muropeptide transporter; Reviewed 99.56
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 99.55
TIGR00901 356 2A0125 AmpG-related permease. 99.55
PRK15011 393 sugar efflux transporter B; Provisional 99.55
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.55
PRK10642490 proline/glycine betaine transporter; Provisional 99.54
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.54
PRK10489417 enterobactin exporter EntS; Provisional 99.54
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.53
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.53
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.53
PRK12382392 putative transporter; Provisional 99.53
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.53
PRK11010 491 ampG muropeptide transporter; Validated 99.53
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.52
PRK10504471 putative transporter; Provisional 99.52
PRK05122399 major facilitator superfamily transporter; Provisi 99.51
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.51
PRK09874408 drug efflux system protein MdtG; Provisional 99.5
PRK09528420 lacY galactoside permease; Reviewed 99.5
PRK03633381 putative MFS family transporter protein; Provision 99.5
TIGR00897402 2A0118 polyol permease family. This family of prot 99.5
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 99.5
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.49
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.49
PRK03545390 putative arabinose transporter; Provisional 99.49
PRK03699394 putative transporter; Provisional 99.49
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.49
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.49
PRK09952438 shikimate transporter; Provisional 99.48
TIGR00896355 CynX cyanate transporter. This family of proteins 99.46
TIGR00893399 2A0114 d-galactonate transporter. 99.46
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.45
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.45
PRK15075434 citrate-proton symporter; Provisional 99.45
PRK03893496 putative sialic acid transporter; Provisional 99.45
PRK12307426 putative sialic acid transporter; Provisional 99.45
PRK09528 420 lacY galactoside permease; Reviewed 99.43
COG2270438 Permeases of the major facilitator superfamily [Ge 99.43
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.43
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 99.42
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.42
PRK11646400 multidrug resistance protein MdtH; Provisional 99.42
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.41
PRK09705393 cynX putative cyanate transporter; Provisional 99.4
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.4
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.39
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.39
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.37
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.37
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.37
KOG0569 485 consensus Permease of the major facilitator superf 99.36
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.36
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.35
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.35
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.34
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.34
PRK11195393 lysophospholipid transporter LplT; Provisional 99.33
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.33
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.32
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.32
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.32
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.31
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.31
PRK09848448 glucuronide transporter; Provisional 99.31
PRK11663434 regulatory protein UhpC; Provisional 99.3
PF13347428 MFS_2: MFS/sugar transport protein 99.3
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.29
TIGR00898505 2A0119 cation transport protein. 99.27
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.27
PRK10054395 putative transporter; Provisional 99.26
PRK11010 491 ampG muropeptide transporter; Validated 99.25
PRK10091382 MFS transport protein AraJ; Provisional 99.25
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.24
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 99.23
KOG2325 488 consensus Predicted transporter/transmembrane prot 99.23
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.22
PRK10133438 L-fucose transporter; Provisional 99.22
PRK11043401 putative transporter; Provisional 99.21
PRK10429473 melibiose:sodium symporter; Provisional 99.21
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.2
PRK09669444 putative symporter YagG; Provisional 99.2
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.19
PLN00028476 nitrate transmembrane transporter; Provisional 99.16
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.16
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.15
PRK09669 444 putative symporter YagG; Provisional 99.14
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.14
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.13
PRK10429 473 melibiose:sodium symporter; Provisional 99.1
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.1
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.09
COG0477 338 ProP Permeases of the major facilitator superfamil 99.09
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.07
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.07
PRK11902402 ampG muropeptide transporter; Reviewed 99.06
PRK11652394 emrD multidrug resistance protein D; Provisional 99.06
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.06
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.05
KOG0569485 consensus Permease of the major facilitator superf 99.01
PRK09584500 tppB putative tripeptide transporter permease; Rev 99.0
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.0
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 99.0
KOG2563 480 consensus Permease of the major facilitator superf 98.98
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 98.97
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.96
PRK11462460 putative transporter; Provisional 98.94
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.94
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 98.92
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 98.92
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 98.9
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.87
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.84
PF1283277 MFS_1_like: MFS_1 like family 98.84
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.81
PRK09848 448 glucuronide transporter; Provisional 98.8
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.78
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 98.73
COG2211467 MelB Na+/melibiose symporter and related transport 98.7
PF13347 428 MFS_2: MFS/sugar transport protein 98.7
PRK11462 460 putative transporter; Provisional 98.68
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.68
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.68
KOG3762618 consensus Predicted transporter [General function 98.66
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.65
KOG0254513 consensus Predicted transporter (major facilitator 98.58
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.57
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.55
KOG3764464 consensus Vesicular amine transporter [Intracellul 98.54
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.53
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.44
KOG2615451 consensus Permease of the major facilitator superf 98.42
KOG2816463 consensus Predicted transporter ADD1 (major facili 98.41
KOG2816 463 consensus Predicted transporter ADD1 (major facili 98.36
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.33
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.31
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.27
KOG2532466 consensus Permease of the major facilitator superf 98.24
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.19
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.14
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 98.14
KOG2533495 consensus Permease of the major facilitator superf 98.12
COG2270 438 Permeases of the major facilitator superfamily [Ge 98.09
COG2211 467 MelB Na+/melibiose symporter and related transport 98.03
PTZ00207591 hypothetical protein; Provisional 98.02
KOG0637 498 consensus Sucrose transporter and related proteins 97.98
KOG3626 735 consensus Organic anion transporter [Secondary met 97.97
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.93
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 97.87
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.83
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.8
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.72
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.71
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 97.62
KOG3762 618 consensus Predicted transporter [General function 97.47
KOG3098 461 consensus Uncharacterized conserved protein [Funct 97.38
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 97.31
TIGR00805 633 oat sodium-independent organic anion transporter. 97.27
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 97.1
KOG3098461 consensus Uncharacterized conserved protein [Funct 96.86
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 96.7
KOG1330493 consensus Sugar transporter/spinster transmembrane 96.55
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 96.52
KOG2563480 consensus Permease of the major facilitator superf 96.28
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 96.08
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 96.03
PRK03612 521 spermidine synthase; Provisional 95.99
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 95.63
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 94.81
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 94.78
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 94.58
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 94.22
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 93.84
KOG4332454 consensus Predicted sugar transporter [Carbohydrat 93.07
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 92.76
KOG0637498 consensus Sucrose transporter and related proteins 91.06
KOG3626 735 consensus Organic anion transporter [Secondary met 90.96
COG5336116 Uncharacterized protein conserved in bacteria [Fun 88.57
COG3202 509 ATP/ADP translocase [Energy production and convers 88.23
KOG2325488 consensus Predicted transporter/transmembrane prot 87.58
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 86.21
KOG3880409 consensus Predicted small molecule transporter inv 86.09
KOG3810433 consensus Micronutrient transporters (folate trans 85.48
KOG1479406 consensus Nucleoside transporter [Nucleotide trans 83.93
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 80.33
PF11947153 DUF3464: Protein of unknown function (DUF3464); In 80.03
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
Probab=99.91  E-value=2.8e-23  Score=151.15  Aligned_cols=147  Identities=16%  Similarity=0.002  Sum_probs=137.5

Q ss_pred             CccchHHHHHHHHHHHHHhhhcccccchHHHHhhcCCCcchhhHHHHHHHHHHHhhhhhHhHhhhhccchHHHHHHHHHH
Q 039580            2 KSETLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLW   81 (149)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~~~~~~~~~~~~   81 (149)
                      |.+++.....++.++....+....+...|.+.+|+|.+..+.++..+.+.+++++++++.|++.||+|||+++..+.++.
T Consensus         4 ~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~l~~~~~~s~~~~g~~~s~~~~~~~~~~~~~g~l~dr~G~r~~~~~~~~~~   83 (412)
T TIGR02332         4 KLFRRLIIFLFILFIFSFLDRINIGFAGLTMGKDLGLSATMFGLAATLFYAAYVICGIPSNIMLAIIGARRWIAGIMVLW   83 (412)
T ss_pred             eehhHHHHHHHHHHHHHHhhhhhHHHHHHhhHhhcCCCHHHHHHHHHHHHHHHHHHHhhHHHHHHHhChHHHHHHHHHHH
Confidence            44677788888888999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhhhHHHHHHHHhhhhHHHHHHHhHHHHHhhhcccCchhhHHHHHHHHhhhhhhcccc
Q 039580           82 AAATFLVAISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGL  148 (149)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~igp~  148 (149)
                      .++.....++++++.+++.|++.|++.+...+....++.|++|+++|++..++++....+|..++|.
T Consensus        84 ~~~~~~~~~~~~~~~l~~~r~l~G~~~~~~~~~~~~~~~~~~~~~~rg~~~~~~~~~~~~g~~~~~~  150 (412)
T TIGR02332        84 GIASTATMFATGPESLYLLRILVGIAEAGFLPGILLYLTFWFPAYFRARANALFMIAMPVTMALGLI  150 (412)
T ss_pred             HHHHHHHHHhcCHHHHHHHHHHHHHHHhhHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999998888764



This protein is a part of the Major Facilitator Superfamily (Pfam family pfam07690). Member of this family are found in a number of proteobacterial genomes, but only in the context of having genes for 4-hydroxyphenylacetate (4-HPA) degradation. The protein is characterized by Prieto, et al. (PubMed:9315705) as 4-hydroxyphenylacetate permease in E. coli, where 3-HPA and 3,4-dihydroxyphenylacetate are shown to competitively inhibit 4-HPA transport and therefore also interact specificially.

>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG3880 consensus Predicted small molecule transporter involved in cellular pH homeostasis (Batten disease protein in human) [General function prediction only] Back     alignment and domain information
>KOG3810 consensus Micronutrient transporters (folate transporter family) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1479 consensus Nucleoside transporter [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information
>PF11947 DUF3464: Protein of unknown function (DUF3464); InterPro: IPR021855 This family of proteins are functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3c5y_A231 Ribose/galactose isomerase; structural genomics, j 2e-04
3ono_A214 Ribose/galactose isomerase; structural genomics, P 6e-04
>3c5y_A Ribose/galactose isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.81A {Novosphingobium aromaticivorans} Length = 231 Back     alignment and structure
 Score = 39.1 bits (91), Expect = 2e-04
 Identities = 17/74 (22%), Positives = 23/74 (31%), Gaps = 26/74 (35%)

Query: 26  PGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGA---FLWA 82
           PGV+      L  DPT                    A+L    N  + I++     F WA
Sbjct: 105 PGVF----CGLVIDPT-------------------DAFLFGQINDGNAISMPYSKGFGWA 141

Query: 83  AATFLVAISTTFFQ 96
           A   L  +    F 
Sbjct: 142 AELNLQDVYRKLFD 155


>3ono_A Ribose/galactose isomerase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.75A {Vibrio parahaemolyticus} Length = 214 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.9
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.87
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.85
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.84
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.83
2xut_A 524 Proton/peptide symporter family protein; transport 99.79
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.59
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.5
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.49
2cfq_A417 Lactose permease; transport, transport mechanism, 99.45
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.42
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.31
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.29
2xut_A524 Proton/peptide symporter family protein; transport 98.93
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.90  E-value=1.4e-22  Score=146.27  Aligned_cols=144  Identities=17%  Similarity=0.077  Sum_probs=132.5

Q ss_pred             chHHHHHHHHHHHHHhhhcccccchHHHHhhcCCCcchhhHHHHHHHHHHHhhhhhHhHhhhhccchHHHHHHHHHHHHH
Q 039580            5 TLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAA   84 (149)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~~~~~~~~~~~~~~~   84 (149)
                      ++.+..+.+..+....+.....+..|.+.+++|.+..+.+++.+.+.++..++.++.|+++||+|||+++..+....+++
T Consensus        25 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~s~~~~g~~~~~~~~~~~i~~~~~G~l~dr~g~r~~l~~~~~~~~~~  104 (438)
T 3o7q_A           25 IIPFALLCSLFFLWAVANNLNDILLPQFQQAFTLTNFQAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALG  104 (438)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCCSHHHHHHHHHHHHHHHTTHHHHHHHHHHSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHhHHHHHHHhcchHHHHHHHHHHHHH
Confidence            44555666667777777778888899999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHH---HHhhhhHHHHHHHHhhhhHHHHHHHhHHHHHhhhcccCchhhHHHHHHHHhhhhhhcccc
Q 039580           85 TFLV---AISTTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGL  148 (149)
Q Consensus        85 ~~~~---~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~igp~  148 (149)
                      .+..   .++++++.+++.|++.|++.+...+..++++.|++|+|+|++..++.+...++|..++|.
T Consensus       105 ~~~~~~~~~~~~~~~l~~~~~l~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~~g~~  171 (438)
T 3o7q_A          105 AALFWPAAEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVV  171 (438)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhccccccHHHHHHHHHHHHhhHHHhhhhHHHHHHHHcCchhHHHHHHHHHHHHHHHHHHHHH
Confidence            9888   788999999999999999999999999999999999999999999999999999998875



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.86
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.52
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.45
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.28
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.86  E-value=1.1e-21  Score=139.66  Aligned_cols=143  Identities=13%  Similarity=-0.050  Sum_probs=124.9

Q ss_pred             chHHHHHHHHHHHHHhhhcccccchHHHHhhcCCCcchhhHHHHHHHHHHHhhhhhHhHhhhhccchHHHHHHHHHHHHH
Q 039580            5 TLTMVLVNLAGIMERADESLLPGVYKEVGAALCTDPTGLGSLTLFRSIVQSSCYPLAAYLSVHHNCAHIIALGAFLWAAA   84 (149)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~~~~~~~~~~~~~~~   84 (149)
                      |..+....+.++....+....+...|.+ +|+|.|.+|.+++.+.+.+++.+++++.|+++||+|||+++..+.++.+++
T Consensus        24 w~i~~~~~~~~~~~~~~~~~~~~~~p~~-~~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~  102 (447)
T d1pw4a_          24 WQIFLGIFFGYAAYYLVRKNFALAMPYL-VEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAV  102 (447)
T ss_dssp             HHHHHHHHHHHHHHHHHHTSHHHHHHHT-TSSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHH
Confidence            4445555566666667777777777766 468999999999999999999999999999999999999999999999888


Q ss_pred             HHHHHHh----hhhHHHHHHHHhhhhHHHHHHHhHHHHHhhhcccCchhhHHHHHHHHhhhhhhcccc
Q 039580           85 TFLVAIS----TTFFQVAVSRGLNGIGLAIVTLAIQSLVADSTDESNRGMAFGWLQLTGNFGSIIGGL  148 (149)
Q Consensus        85 ~~~~~~~----~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~igp~  148 (149)
                      .+..++.    ++++.+.+.|++.|++.+...+....++.|++|+++|++.+++.+....+|..++|.
T Consensus       103 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~  170 (447)
T d1pw4a_         103 MLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPL  170 (447)
T ss_dssp             HHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHH
T ss_pred             HhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhh
Confidence            8777654    477889999999999999999999999999999999999999999999999888764



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure