Citrus Sinensis ID: 039636

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKRGQNARCSASKHETPRENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVLEPDSH
cccEEEEEcccHHHHHHHHHHcccccccccccHHHHHHHHHcccEEEEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEHHHHHHcHHHHHHHccccccccEEEEEEcccccccccccc
cccEEEEEcccHHHHHHHHHHccccHHEcccccccHHHHHHHccEEEHHHHHHccccccccccccccHHHHHHHHHHHHHcccEEEEEcHHHHHHccHHHHHHHHcccccccEEEEEcccEEEEccccc
mgcyvvgsagskEKIERLKNkfafddafnyKEEQDLVTALKRgqnarcsaskhetprencsmwndltyskFLDVVLPliregkivYVEDIVEGLENAPAALLGlfsgrnvgkqaldldsclvvlepdsh
mgcyvvgsagskekiERLKNKFAFDDAFNYKEEQDLVTALKRGQNarcsaskhetprencsmwnDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSclvvlepdsh
MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKRGQNARCSASKHETPRENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVLEPDSH
*****************LKNKFAFDDAFNYKEEQDLVTA*******************NCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVL*****
MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKRGQNARCSASKHETPRENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSC*********
***********KEKIERLKNKFAFDDAFNYKEEQDLVTAL*****************ENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVLEPDSH
MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKRGQNARCSASKHETPRENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVLEP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKRGQNARCSASKHETPRENCSMWNDLTYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDSCLVVLEPDSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q39172345 NADP-dependent alkenal do no no 0.883 0.330 0.453 2e-27
Q6WAU0342 (+)-pulegone reductase OS N/A no 0.891 0.336 0.438 5e-27
Q39173343 NADP-dependent alkenal do no no 0.883 0.332 0.441 2e-26
Q29073329 Prostaglandin reductase 1 yes no 0.852 0.334 0.318 2e-10
Q28719349 Prostaglandin reductase 1 yes no 0.953 0.352 0.311 9e-10
Q3SZJ4329 Prostaglandin reductase 1 yes no 0.852 0.334 0.318 2e-09
P97584329 Prostaglandin reductase 1 yes no 0.852 0.334 0.306 3e-09
Q14914329 Prostaglandin reductase 1 yes no 0.852 0.334 0.3 3e-08
Q9EQZ5329 Prostaglandin reductase 1 yes no 0.852 0.334 0.306 5e-08
Q91YR9329 Prostaglandin reductase 1 yes no 0.852 0.334 0.287 7e-08
>sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 Back     alignment and function desciption
 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 86/163 (52%), Gaps = 49/163 (30%)

Query: 1   MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR------------------ 42
           MGCYVVGSAGSKEK++ LK KF FDDAFNYKEE DL  ALKR                  
Sbjct: 179 MGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKML 238

Query: 43  ----------GQNARCSASKHETPRENCSMWNDLT--------------------YSKFL 72
                     G+ A C         EN    ++L+                    YSKFL
Sbjct: 239 DAVLVNMNMHGRIAVCGMISQYN-LENQEGVHNLSNIIYKRIRIQGFVVSDFYDKYSKFL 297

Query: 73  DVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQAL 115
           + VLP IREGKI YVED+ +GLE AP AL+GLF G+NVGKQ +
Sbjct: 298 EFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV 340
Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)H homeostasis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 7EC: 4
>sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 Back     alignment and function description
>sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 Back     alignment and function description
>sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 Back     alignment and function description
>sp|Q28719|PTGR1_RABIT Prostaglandin reductase 1 OS=Oryctolagus cuniculus GN=PTGR1 PE=2 SV=1 Back     alignment and function description
>sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 Back     alignment and function description
>sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 Back     alignment and function description
>sp|Q14914|PTGR1_HUMAN Prostaglandin reductase 1 OS=Homo sapiens GN=PTGR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 Back     alignment and function description
>sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
224092844 352 predicted protein [Populus trichocarpa] 0.906 0.332 0.481 1e-29
255577885 332 alcohol dehydrogenase, putative [Ricinus 0.891 0.346 0.503 2e-29
224117766 359 predicted protein [Populus trichocarpa] 0.891 0.320 0.481 1e-28
224117774 359 predicted protein [Populus trichocarpa] 0.891 0.320 0.481 1e-28
224107939 359 predicted protein [Populus trichocarpa] 0.906 0.325 0.475 2e-28
224092846 351 predicted protein [Populus trichocarpa] 0.899 0.330 0.472 6e-28
225434189 345 PREDICTED: NADP-dependent alkenal double 0.891 0.333 0.462 1e-27
225434197 345 PREDICTED: NADP-dependent alkenal double 0.891 0.333 0.444 1e-27
255577879 352 alcohol dehydrogenase, putative [Ricinus 0.883 0.323 0.484 2e-27
255577881 368 alcohol dehydrogenase, putative [Ricinus 0.891 0.312 0.475 2e-27
>gi|224092844|ref|XP_002309720.1| predicted protein [Populus trichocarpa] gi|222852623|gb|EEE90170.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 90/164 (54%), Gaps = 47/164 (28%)

Query: 1   MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR------------------ 42
           MGCYVVGSAGSKEK+E LK+KF FDDAFNYKEE DLV ALKR                  
Sbjct: 186 MGCYVVGSAGSKEKVELLKSKFGFDDAFNYKEEHDLVAALKRYFPEGIDIYFENVGGKML 245

Query: 43  ----------GQNARCSASKHETPRENCSMWNDLT-------------------YSKFLD 73
                     G+ A C        ++   + N  T                   Y KFLD
Sbjct: 246 DAVLLNMRFHGRIAACGMISQYNLQQPEGLQNLTTVVFKRIRLEGFIIFDYFDQYPKFLD 305

Query: 74  VVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDL 117
            VLP IREGKIVYVEDI EGLE+ P+AL+GLFSGRNVGKQ + +
Sbjct: 306 FVLPYIREGKIVYVEDITEGLEHGPSALVGLFSGRNVGKQVVKV 349

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577885|ref|XP_002529815.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530692|gb|EEF32564.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224117766|ref|XP_002331626.1| predicted protein [Populus trichocarpa] gi|222874022|gb|EEF11153.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117774|ref|XP_002331628.1| predicted protein [Populus trichocarpa] gi|222874024|gb|EEF11155.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224107939|ref|XP_002333452.1| predicted protein [Populus trichocarpa] gi|222836645|gb|EEE75038.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224092846|ref|XP_002309721.1| predicted protein [Populus trichocarpa] gi|118487031|gb|ABK95346.1| unknown [Populus trichocarpa] gi|222852624|gb|EEE90171.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225434189|ref|XP_002279359.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147792339|emb|CAN61471.1| hypothetical protein VITISV_043825 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225434197|ref|XP_002279529.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147783628|emb|CAN68149.1| hypothetical protein VITISV_035666 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577879|ref|XP_002529812.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530689|gb|EEF32561.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255577881|ref|XP_002529813.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223530690|gb|EEF32562.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2097795350 AT3G03080 [Arabidopsis thalian 0.356 0.131 0.782 1.8e-30
TAIR|locus:2148131345 AER "alkenal reductase" [Arabi 0.325 0.121 0.809 2e-30
TAIR|locus:2148116346 AT5G16960 [Arabidopsis thalian 0.325 0.121 0.809 4e-30
TAIR|locus:2153799353 AT5G37940 [Arabidopsis thalian 0.387 0.141 0.68 6.3e-30
TAIR|locus:2028736351 AT1G26320 [Arabidopsis thalian 0.356 0.131 0.760 9.3e-30
TAIR|locus:2148166343 AT5G16990 [Arabidopsis thalian 0.325 0.122 0.809 1.1e-29
UNIPROTKB|Q6WAU0342 Q6WAU0 "(+)-pulegone reductase 0.317 0.119 0.829 1.7e-29
TAIR|locus:2153759353 AT5G37980 [Arabidopsis thalian 0.356 0.130 0.739 2.8e-29
TAIR|locus:2148186345 AT5G17000 [Arabidopsis thalian 0.372 0.139 0.687 4.1e-29
TAIR|locus:2154041353 AT5G38000 [Arabidopsis thalian 0.387 0.141 0.66 4.9e-29
TAIR|locus:2097795 AT3G03080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 188 (71.2 bits), Expect = 1.8e-30, Sum P(2) = 1.8e-30
 Identities = 36/46 (78%), Positives = 40/46 (86%)

Query:    70 KFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQAL 115
             KFLD VLP IREGKI YVED+VEGLEN P+ALLGLF G+NVGKQ +
Sbjct:   300 KFLDFVLPYIREGKITYVEDVVEGLENGPSALLGLFHGKNVGKQLI 345
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0030036 "actin cytoskeleton organization" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
TAIR|locus:2148131 AER "alkenal reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148116 AT5G16960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153799 AT5G37940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028736 AT1G26320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148166 AT5G16990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6WAU0 Q6WAU0 "(+)-pulegone reductase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2153759 AT5G37980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148186 AT5G17000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154041 AT5G38000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_VII0401
hypothetical protein (353 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PLN03154348 PLN03154, PLN03154, putative allyl alcohol dehydro 7e-34
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 7e-27
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis a 7e-22
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun 1e-17
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis a 2e-17
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 1e-13
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 1e-12
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 4e-07
cd08293345 cd08293, PTGR2, Prostaglandin reductase 4e-07
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 1e-05
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 0.004
>gnl|CDD|215606 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information 
 Score =  119 bits (301), Expect = 7e-34
 Identities = 64/161 (39%), Positives = 87/161 (54%), Gaps = 47/161 (29%)

Query: 2   GCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR------------------- 42
           GCYVVGSAGS +K++ LKNK  FD+AFNYKEE DL  ALKR                   
Sbjct: 183 GCYVVGSAGSSQKVDLLKNKLGFDEAFNYKEEPDLDAALKRYFPEGIDIYFDNVGGDMLD 242

Query: 43  ---------GQNARC---SASKHETPRENCSMWNDLT----------------YSKFLDV 74
                    G+ A C   S +     +   +++N ++                + +FL+ 
Sbjct: 243 AALLNMKIHGRIAVCGMVSLNSLSASQGIHNLYNLISKRIRMQGFLQSDYLHLFPQFLEN 302

Query: 75  VLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQAL 115
           V    ++GKIVY+ED+ EGLE+APAAL+GLFSG+NVGKQ +
Sbjct: 303 VSRYYKQGKIVYIEDMSEGLESAPAALVGLFSGKNVGKQVI 343

Length = 348
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.79
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 99.68
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.67
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 99.61
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.54
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 99.54
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 99.5
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.42
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.37
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.35
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 99.33
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 99.33
PLN02178375 cinnamyl-alcohol dehydrogenase 99.31
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.3
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.29
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.27
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.26
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.25
PLN02514357 cinnamyl-alcohol dehydrogenase 99.22
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.21
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.19
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.18
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.17
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.16
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.16
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.14
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.13
PLN02827378 Alcohol dehydrogenase-like 99.09
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.0
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 98.99
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 98.99
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 98.96
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 98.96
PRK10083339 putative oxidoreductase; Provisional 98.96
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 98.95
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 98.94
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 98.94
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 98.92
PLN02740381 Alcohol dehydrogenase-like 98.92
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 98.9
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 98.9
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 98.9
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 98.9
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 98.89
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 98.89
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 98.86
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 98.86
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 98.81
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 98.81
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 98.8
PTZ00354334 alcohol dehydrogenase; Provisional 98.8
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 98.79
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 98.78
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 98.77
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 98.77
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 98.76
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 98.75
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 98.74
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 98.73
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 98.73
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 98.72
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 98.69
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 98.69
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 98.68
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 98.68
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 98.68
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 98.67
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 98.67
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 98.67
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 98.67
cd08251303 polyketide_synthase polyketide synthase. Polyketid 98.67
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 98.66
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 98.65
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 98.65
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 98.64
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 98.64
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 98.63
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 98.63
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 98.62
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 98.61
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 98.61
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 98.61
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 98.61
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 98.6
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 98.59
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 98.59
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 98.57
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 98.55
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 98.54
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 98.53
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 98.52
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 98.51
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 98.49
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 98.49
PRK13771334 putative alcohol dehydrogenase; Provisional 98.47
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 98.46
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 98.46
cd08252336 AL_MDR Arginate lyase and other MDR family members 98.45
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 98.44
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 98.43
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 98.42
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 98.4
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 98.38
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 98.38
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 98.36
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 98.36
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 98.36
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 98.35
PLN02702364 L-idonate 5-dehydrogenase 98.35
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 98.34
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 98.32
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 98.28
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 98.27
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 98.23
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 98.23
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 98.17
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 98.13
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 98.1
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 98.02
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 97.98
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 97.89
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 97.76
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 97.57
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 97.56
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 97.55
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 96.75
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 96.22
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.35
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 90.48
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 85.74
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information 
Probab=99.79  E-value=1.4e-18  Score=123.07  Aligned_cols=118  Identities=38%  Similarity=0.623  Sum_probs=99.4

Q ss_pred             CCcEEEEEeCChHHHHHHHHhcCCCEEEeCCCcccHHHHhcc----------------------------ccEEEecC--
Q 039636            1 MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR----------------------------GQNARCSA--   50 (129)
Q Consensus         1 ~Ga~Vi~t~~s~~k~~~~~~~lGad~vi~~~~~~~~~~~v~~----------------------------G~~v~~G~--   50 (129)
                      .||+|++++++++|.+++++.+|.|.+|||++ +++.+.+.+                            ||++.||.  
T Consensus       174 kG~rVVGiaGg~eK~~~l~~~lGfD~~idyk~-~d~~~~L~~a~P~GIDvyfeNVGg~v~DAv~~~ln~~aRi~~CG~IS  252 (340)
T COG2130         174 KGCRVVGIAGGAEKCDFLTEELGFDAGIDYKA-EDFAQALKEACPKGIDVYFENVGGEVLDAVLPLLNLFARIPVCGAIS  252 (340)
T ss_pred             hCCeEEEecCCHHHHHHHHHhcCCceeeecCc-ccHHHHHHHHCCCCeEEEEEcCCchHHHHHHHhhccccceeeeeehh
Confidence            48999999999999999996699999999999 899999887                            89999998  


Q ss_pred             -CCCCCCC---CC--cceeccc-------------chHHHHHHHHHHHHcCCceeeeeeecCcccHHHHHHHHHcCCccc
Q 039636           51 -SKHETPR---EN--CSMWNDL-------------TYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVG  111 (129)
Q Consensus        51 -~~~~~~~---~~--~l~~~~~-------------~~~~~~~~~~~~~~~g~i~~~~~~~~~l~~~~~a~~~~~~~~~~G  111 (129)
                       |+...++   ++  .++.++.             ...++.+++..|+.+|+|+...+++..|+++++||.-+.+|+++|
T Consensus       253 ~YN~~~~~~gp~~l~~l~~kr~~v~Gfiv~~~~~~~~~e~~~~l~~wv~~GKi~~~eti~dGlEnaP~Af~gLl~G~N~G  332 (340)
T COG2130         253 QYNAPELPPGPRRLPLLMAKRLRVQGFIVASDYDQRFPEALRELGGWVKEGKIQYRETIVDGLENAPEAFIGLLSGKNFG  332 (340)
T ss_pred             hcCCCCCCCCcchhhHHHhhhheeEEEEechhhhhhhHHHHHHHHHHHHcCceeeEeeehhhhhccHHHHHHHhcCCccc
Confidence             5544221   11  2232222             456899999999999999999988779999999999999999999


Q ss_pred             eEEEEeCC
Q 039636          112 KQALDLDS  119 (129)
Q Consensus       112 kvvv~~~~  119 (129)
                      |.|+++.+
T Consensus       333 K~vvKv~~  340 (340)
T COG2130         333 KLVVKVAD  340 (340)
T ss_pred             eEEEEecC
Confidence            99999864

>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2j3h_A345 Crystal Structure Of Arabidopsis Thaliana Double Bo 1e-28
4hfj_A351 X-ray Crystal Structure Of A Double Bond Reductase 2e-27
2y05_A328 Crystal Structure Of Human Leukotriene B4 12-Hydrox 2e-09
1zsv_A349 Crystal Structure Of Human Nadp-Dependent Leukotrie 3e-09
1v3t_A333 Crystal Structure Of Leukotriene B4 12- Hydroxydehy 4e-09
4b7c_A336 Crystal Structure Of Hypothetical Protein Pa1648 Fr 1e-04
>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond Reductase (At5g16970)-Apo Form Length = 345 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 86/163 (52%), Gaps = 49/163 (30%)
Query: 1   MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR------------------ 42
           MGCYVVGSAGSKEK++ LK KF FDDAFNYKEE DL  ALKR                  
Sbjct: 179 MGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKML 238
Query: 43  ----------GQNARCSASKHETPRENCSMWNDLT--------------------YSKFL 72
                     G+ A C         EN    ++L+                    YSKFL
Sbjct: 239 DAVLVNMNMHGRIAVCGMISQYN-LENQEGVHNLSNIIYKRNRIQGFVVSDFYDKYSKFL 297
Query: 73  DVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQAL 115
           + VLP IREGKI YVED+ +GLE AP AL+GLF G+NVGKQ +
Sbjct: 298 EFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQVV 340
>pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum Length = 351 Back     alignment and structure
>pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 Back     alignment and structure
>pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 Back     alignment and structure
>pdb|1V3T|A Chain A, Crystal Structure Of Leukotriene B4 12- Hydroxydehydrogenase15-Oxo-Prostaglandin 13-Reductase Length = 333 Back     alignment and structure
>pdb|4B7C|A Chain A, Crystal Structure Of Hypothetical Protein Pa1648 From Pseudomonas Aeruginosa. Length = 336 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 3e-34
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 3e-31
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 9e-20
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 7e-15
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 1e-19
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 1e-04
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-04
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 3e-04
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 7e-04
4eye_A342 Probable oxidoreductase; structural genomics, niai 8e-04
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
 Score =  120 bits (303), Expect = 3e-34
 Identities = 67/163 (41%), Positives = 79/163 (48%), Gaps = 53/163 (32%)

Query: 1   MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKE----EQDLVTALKRG------------- 43
           MGCYVVGSAGSKEK++ LK KF FDDAFNYKE       L      G             
Sbjct: 179 MGCYVVGSAGSKEKVDLLKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKML 238

Query: 44  --------QNAR---C------SASKHETPRENCSMWNDLT----------------YSK 70
                    + R   C      +    E      ++ N +                 YSK
Sbjct: 239 DAVLVNMNMHGRIAVCGMISQYNLENQEGVH---NLSNIIYKRNRIQGFVVSDFYDKYSK 295

Query: 71  FLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQ 113
           FL+ VLP IREGKI YVED+ +GLE AP AL+GLF G+NVGKQ
Sbjct: 296 FLEFVLPHIREGKITYVEDVADGLEKAPEALVGLFHGKNVGKQ 338
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.69
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 99.63
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 99.61
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 99.57
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 99.55
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.55
3fbg_A346 Putative arginate lyase; structural genomics, unkn 99.54
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 99.53
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.52
3gms_A340 Putative NADPH:quinone reductase; structural genom 99.51
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.51
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.49
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.48
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 99.48
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.48
4eye_A342 Probable oxidoreductase; structural genomics, niai 99.48
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.47
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.47
3krt_A456 Crotonyl COA reductase; structural genomics, prote 99.47
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.46
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 99.46
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 99.46
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 99.45
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.45
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.45
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.45
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 99.44
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.43
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 99.43
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.43
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.42
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 99.42
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.41
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.41
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.41
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.4
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 99.4
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.39
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.38
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.38
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 99.38
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 99.37
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.37
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.36
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.36
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.35
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.35
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.34
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.34
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 99.33
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.32
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.32
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 99.31
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 99.31
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 99.29
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.28
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.27
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 99.23
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.22
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 99.21
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.2
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.2
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.2
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.19
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.19
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.18
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 99.18
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 99.11
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.07
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 98.96
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.97
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
Probab=99.69  E-value=1.5e-16  Score=115.31  Aligned_cols=115  Identities=17%  Similarity=0.242  Sum_probs=87.9

Q ss_pred             CcEEEEEeCChHHHHHHHHhcCCCEEEeCCCcccHHHHhcc------------------------------ccEEEecCC
Q 039636            2 GCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR------------------------------GQNARCSAS   51 (129)
Q Consensus         2 Ga~Vi~t~~s~~k~~~~~~~lGad~vi~~~~~~~~~~~v~~------------------------------G~~v~~G~~   51 (129)
                      |++||+++++++|+++++ ++|+++++||++ .++.+.+++                              |+++.+|..
T Consensus       188 g~~Vi~~~~~~~r~~~~~-~~Ga~~~i~~~~-~~~~~~v~~~t~g~g~d~~~~~~~~~~~~~~~~~~l~~~G~~v~~g~~  265 (348)
T 4eez_A          188 GAKVIAVDINQDKLNLAK-KIGADVTINSGD-VNPVDEIKKITGGLGVQSAIVCAVARIAFEQAVASLKPMGKMVAVAVP  265 (348)
T ss_dssp             CCEEEEEESCHHHHHHHH-HTTCSEEEEC-C-CCHHHHHHHHTTSSCEEEEEECCSCHHHHHHHHHTEEEEEEEEECCCC
T ss_pred             CCEEEEEECcHHHhhhhh-hcCCeEEEeCCC-CCHHHHhhhhcCCCCceEEEEeccCcchhheeheeecCCceEEEEecc
Confidence            679999999999999998 999999999998 788887766                              666666542


Q ss_pred             CCCCC-CCCcceeccc-------chHHHHHHHHHHHHcCCceeeeeeecCcccHHHHHHHHHcCCccceEEEEeCC
Q 039636           52 KHETP-RENCSMWNDL-------TYSKFLDVVLPLIREGKIVYVEDIVEGLENAPAALLGLFSGRNVGKQALDLDS  119 (129)
Q Consensus        52 ~~~~~-~~~~l~~~~~-------~~~~~~~~~~~~~~~g~i~~~~~~~~~l~~~~~a~~~~~~~~~~Gkvvv~~~~  119 (129)
                      ..... ..+.++.++.       ...+.++++++++.+|.|+|.+. +|||+++++||+.+++++..||+||+++.
T Consensus       266 ~~~~~~~~~~~~~~~~~i~gs~~~~~~~~~~~~~l~~~g~i~p~~~-~~~l~~~~~A~~~l~~g~~~GKvVl~~sk  340 (348)
T 4eez_A          266 NTEMTLSVPTVVFDGVEVAGSLVGTRLDLAEAFQFGAEGKVKPIVA-TRKLEEINDIIDEMKAGKIEGRMVIDFTK  340 (348)
T ss_dssp             SCEEEECHHHHHHSCCEEEECCSCCHHHHHHHHHHHHTTSCCCCEE-EECGGGHHHHHHHHHTTCCSSEEEEECC-
T ss_pred             CCCCccCHHHHHhCCeEEEEEecCCHHHHHHHHHHHHcCCCEEEEE-EEeHHHHHHHHHHHHCCCCccEEEEEccc
Confidence            11110 0012222221       44667899999999999998764 58999999999999999999999999963
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.07
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.01
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 98.97
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 98.96
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 98.9
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 98.83
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 98.82
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 98.78
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 98.75
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 98.66
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 98.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 98.63
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 98.6
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 98.59
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 98.55
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 98.47
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.45
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 98.44
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.37
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 98.27
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.24
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 98.24
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 98.21
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 98.18
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 98.14
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 98.1
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 98.04
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 97.88
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Putative enoyl reductase domain of polyketide synthase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.07  E-value=2.1e-10  Score=74.45  Aligned_cols=86  Identities=19%  Similarity=0.286  Sum_probs=63.5

Q ss_pred             CCcEEEEEeCChHHHHHHHHhcCCCEEEeCCCcccHHHHhcc-----------------------------ccEEEecCC
Q 039636            1 MGCYVVGSAGSKEKIERLKNKFAFDDAFNYKEEQDLVTALKR-----------------------------GQNARCSAS   51 (129)
Q Consensus         1 ~Ga~Vi~t~~s~~k~~~~~~~lGad~vi~~~~~~~~~~~v~~-----------------------------G~~v~~G~~   51 (129)
                      +|++|++++++++|.++++ ++|+++++++++ +++.+.+++                             |+++.+|..
T Consensus        49 ~g~~vi~~~~~~~~~~~l~-~~Ga~~vi~~~~-~~~~~~v~~~t~~~g~d~v~d~~g~~~~~~~~~~l~~~G~~v~~G~~  126 (183)
T d1pqwa_          49 IGARIYTTAGSDAKREMLS-RLGVEYVGDSRS-VDFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKK  126 (183)
T ss_dssp             HTCEEEEEESSHHHHHHHH-TTCCSEEEETTC-STHHHHHHHHTTTCCEEEEEECCCTHHHHHHHHTEEEEEEEEECSCG
T ss_pred             ccccceeeecccccccccc-cccccccccCCc-cCHHHHHHHHhCCCCEEEEEecccchHHHHHHHHhcCCCEEEEEccC
Confidence            3899999999999999998 999999999988 889888866                             888888762


Q ss_pred             CCCCCC--------CC-cceeccc---------chHHHHHHHHHHHHcCCceeee
Q 039636           52 KHETPR--------EN-CSMWNDL---------TYSKFLDVVLPLIREGKIVYVE   88 (129)
Q Consensus        52 ~~~~~~--------~~-~l~~~~~---------~~~~~~~~~~~~~~~g~i~~~~   88 (129)
                      +.....        ++ .+.....         ..++.++++++++++|+|+|.+
T Consensus       127 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~i~~G~i~p~P  181 (183)
T d1pqwa_         127 DVYADASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVLP  181 (183)
T ss_dssp             GGTTTCEEEGGGGTTTCEEEECCHHHHHHHCHHHHHHHHHHHHHHHHTTSSCCCC
T ss_pred             CCCCCcccchHHHhCCcEEEEEEccceeccCHHHHHHHHHHHHHHHHCCCCceeC
Confidence            111100        11 1111111         3467899999999999999863
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure