Citrus Sinensis ID: 039644
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 192 | ||||||
| 392522144 | 162 | NBS-LRR disease resistance protein NBS1, | 0.838 | 0.993 | 0.552 | 5e-39 | |
| 357468659 | 1160 | TIR-NBS-LRR RCT1-like resistance protein | 0.984 | 0.162 | 0.448 | 6e-38 | |
| 147858652 | 1241 | hypothetical protein VITISV_004290 [Viti | 0.973 | 0.150 | 0.481 | 7e-38 | |
| 359493349 | 1260 | PREDICTED: TMV resistance protein N-like | 0.973 | 0.148 | 0.481 | 8e-38 | |
| 255561496 | 876 | TMV resistance protein N, putative [Rici | 0.973 | 0.213 | 0.497 | 1e-37 | |
| 154467307 | 225 | putative NBS-LRR protein, partial [Coffe | 0.979 | 0.835 | 0.448 | 2e-37 | |
| 147768286 | 1206 | hypothetical protein VITISV_033530 [Viti | 0.989 | 0.157 | 0.474 | 3e-37 | |
| 225460354 | 1174 | PREDICTED: TMV resistance protein N-like | 0.989 | 0.161 | 0.474 | 5e-37 | |
| 255564976 | 944 | TMV resistance protein N, putative [Rici | 0.958 | 0.194 | 0.492 | 5e-37 | |
| 449486541 | 1248 | PREDICTED: TMV resistance protein N-like | 1.0 | 0.153 | 0.436 | 6e-37 |
| >gi|392522144|gb|AFM77941.1| NBS-LRR disease resistance protein NBS1, partial [Dimocarpus longan] | Back alignment and taxonomy information |
|---|
Score = 166 bits (420), Expect = 5e-39, Method: Compositional matrix adjust.
Identities = 89/161 (55%), Positives = 111/161 (68%)
Query: 1 IGKTAIARAIFDKISGDFECSCFLENVREESQRPGGLACLRQKLLSNILKDKNVMPYIDL 60
+GKT +A A+F+KI FE S F NVREE ++ GGL LRQKL S +L++KNV +
Sbjct: 2 VGKTTLAEAVFNKIHRHFEGSYFALNVREEFEQRGGLNSLRQKLHSAVLREKNVDIGTSI 61
Query: 61 NFRRLSRMKVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQVLRNWGVSKIYEM 120
RRL R K+LIVFDDVT F Q+E L+GSLD L SRII+TTR+KQVL N GV IYE+
Sbjct: 62 GGRRLGRRKLLIVFDDVTDFQQIEYLIGSLDCLGSQSRIIITTRDKQVLNNCGVDCIYEV 121
Query: 121 EALEYHHALELFSQHAFKRNHPDVGYEKLSSNVTKYAQGIP 161
+ L + ALELF ++ FK+NHP Y KLS V YA G+P
Sbjct: 122 KELIHKDALELFYRYGFKQNHPTADYIKLSKRVLLYAGGLP 162
|
Source: Dimocarpus longan Species: Dimocarpus longan Genus: Dimocarpus Family: Sapindaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357468659|ref|XP_003604614.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula] gi|355505669|gb|AES86811.1| TIR-NBS-LRR RCT1-like resistance protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147858652|emb|CAN82538.1| hypothetical protein VITISV_004290 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493349|ref|XP_002277814.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255561496|ref|XP_002521758.1| TMV resistance protein N, putative [Ricinus communis] gi|223538971|gb|EEF40568.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|154467307|gb|ABS82613.1| putative NBS-LRR protein, partial [Coffea canephora] | Back alignment and taxonomy information |
|---|
| >gi|147768286|emb|CAN64759.1| hypothetical protein VITISV_033530 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255564976|ref|XP_002523481.1| TMV resistance protein N, putative [Ricinus communis] gi|223537309|gb|EEF38940.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449486541|ref|XP_004157327.1| PREDICTED: TMV resistance protein N-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 192 | ||||||
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.947 | 0.159 | 0.414 | 6.2e-29 | |
| TAIR|locus:2129670 | 1008 | AT4G14370 [Arabidopsis thalian | 0.989 | 0.188 | 0.369 | 3.3e-27 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.984 | 0.146 | 0.363 | 1.3e-26 | |
| TAIR|locus:2118106 | 1219 | AT4G12010 [Arabidopsis thalian | 0.984 | 0.155 | 0.403 | 1.5e-26 | |
| TAIR|locus:2195478 | 1031 | AT1G63870 [Arabidopsis thalian | 0.989 | 0.184 | 0.335 | 1.1e-25 | |
| TAIR|locus:2155801 | 1046 | AT5G58120 [Arabidopsis thalian | 0.984 | 0.180 | 0.352 | 1.1e-25 | |
| TAIR|locus:2167457 | 1191 | AT5G36930 [Arabidopsis thalian | 0.979 | 0.157 | 0.395 | 1.3e-25 | |
| TAIR|locus:2136108 | 1095 | AT4G11170 [Arabidopsis thalian | 0.973 | 0.170 | 0.367 | 1.5e-25 | |
| TAIR|locus:2146243 | 900 | AT5G18360 [Arabidopsis thalian | 0.984 | 0.21 | 0.386 | 1.8e-25 | |
| TAIR|locus:2195468 | 1017 | AT1G63880 [Arabidopsis thalian | 0.984 | 0.185 | 0.352 | 2.2e-25 |
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
Score = 334 (122.6 bits), Expect = 6.2e-29, P = 6.2e-29
Identities = 82/198 (41%), Positives = 117/198 (59%)
Query: 1 IGKTAIARAIFDKISG------DFECSCFLENVREESQRPGGLACLRQKLLSNILKDK-N 53
+GKT IARAIFD + G F+ +CFL++++E + G+ L+ LLS +L++K N
Sbjct: 220 VGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKENKR---GMHSLQNALLSELLREKAN 276
Query: 54 VMPYIDLNFRRLSRM---KVLIVFDDVTCFSQ-LESLMGSLDWLTPVSRIILTTRNKQVL 109
D + SR+ KVLIV DD+ LE L G LDW SRII+TTR+K ++
Sbjct: 277 YNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLI 336
Query: 110 RNWGVSKIYEMEALEYHHALELFSQHAFKRNHPDVGYEKLSSNVTKYAQGIPLALKVLSC 169
+ IYE+ AL H +++LF QHAF + P+ +EKLS V YA+G+PLALKV
Sbjct: 337 EKNDI--IYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGS 394
Query: 170 FLHKREKEVWESAIDKLQ 187
LH W+SAI+ ++
Sbjct: 395 LLHNLRLTEWKSAIEHMK 412
|
|
| TAIR|locus:2129670 AT4G14370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195478 AT1G63870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2155801 AT5G58120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195468 AT1G63880 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021883001 | SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (540 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 192 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-28 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 3e-21 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 111 bits (278), Expect = 1e-28
Identities = 71/201 (35%), Positives = 105/201 (52%), Gaps = 11/201 (5%)
Query: 1 IGKTAIARAIFDKISGDFECSCFLENVR-EESQRPGGLAC---------LRQKLLSNILK 50
IGKT IARA+F ++S F+ S F++ +S A L++ LS IL
Sbjct: 218 IGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILD 277
Query: 51 DKNV-MPYIDLNFRRLSRMKVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQVL 109
K++ + ++ RL KVLI DD+ L++L G W SRII+ T++K L
Sbjct: 278 KKDIKIYHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFL 337
Query: 110 RNWGVSKIYEMEALEYHHALELFSQHAFKRNHPDVGYEKLSSNVTKYAQGIPLALKVLSC 169
R G+ IYE+ ALE+F + AFK+N P G+ +L+S V A +PL L VL
Sbjct: 338 RAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGS 397
Query: 170 FLHKREKEVWESAIDKLQRIL 190
+L R+KE W + +L+ L
Sbjct: 398 YLRGRDKEDWMDMLPRLRNGL 418
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 192 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 100.0 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.97 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 99.05 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.97 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.95 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.77 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.64 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.54 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.53 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.44 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.37 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.3 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 98.28 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.21 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.21 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.2 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.13 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.12 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 98.12 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 98.11 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 98.1 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.08 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.05 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 98.03 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 97.96 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.95 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.95 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| PRK09087 | 226 | hypothetical protein; Validated | 97.91 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.89 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.87 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.87 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 97.86 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.85 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.84 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.83 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.82 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 97.82 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 97.82 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.81 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.8 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.8 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.77 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.77 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.77 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.75 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.75 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 97.74 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.73 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.72 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.71 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.64 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.63 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.63 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.63 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.61 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.59 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.58 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.57 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.54 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.53 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.53 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.51 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.51 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.49 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.46 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.45 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.44 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.39 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.36 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.36 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.34 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.32 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.3 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.3 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.23 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.2 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.15 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.13 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.1 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.09 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 97.02 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.0 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.99 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.97 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.96 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.95 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.94 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 96.93 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 96.92 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 96.91 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.9 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.83 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.81 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.8 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.77 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.75 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.74 | |
| PRK08181 | 269 | transposase; Validated | 96.69 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.69 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 96.66 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.65 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 96.63 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.61 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.57 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.55 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.52 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.51 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.51 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.46 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.44 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.43 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.32 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.28 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.24 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.14 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.11 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.11 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.11 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.09 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.97 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.92 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.88 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 95.84 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.69 | |
| PRK06526 | 254 | transposase; Provisional | 95.67 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.66 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.53 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 95.53 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.45 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.4 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.4 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 95.31 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.24 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 95.23 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 95.22 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 95.2 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.15 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.12 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 94.91 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 94.67 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 94.62 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.54 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.42 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.38 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.33 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 94.19 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 94.02 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 93.96 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 93.89 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 93.81 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 93.79 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 93.62 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 93.51 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 93.38 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 93.28 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 93.24 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.07 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 92.65 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 92.65 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 92.46 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 92.46 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 92.27 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 92.25 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 92.2 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 92.13 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 92.03 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 92.0 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 91.99 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 91.98 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 91.91 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 91.75 | |
| COG5635 | 824 | Predicted NTPase (NACHT family) [Signal transducti | 91.75 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 91.5 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 91.37 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 91.34 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 91.24 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 91.12 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 91.1 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 91.09 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 91.07 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 91.05 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 91.04 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 91.03 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 90.7 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 90.6 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 90.51 | |
| PTZ00202 | 550 | tuzin; Provisional | 90.49 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 90.45 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 90.43 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 90.42 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 90.3 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 90.29 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 90.27 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 90.19 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 90.13 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 90.09 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 90.08 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 90.06 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 89.82 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 89.78 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 89.75 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 89.65 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 89.61 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 89.42 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 89.37 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 89.34 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 89.29 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 88.9 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 88.48 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 88.35 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 88.32 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 88.31 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 88.09 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 88.04 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 88.02 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 87.97 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 87.9 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 86.86 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 86.83 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 86.69 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 86.64 | |
| PRK06217 | 183 | hypothetical protein; Validated | 86.56 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 86.53 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 86.41 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 86.3 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 86.28 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 86.16 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 86.14 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 85.84 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 85.67 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 85.65 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 85.4 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 85.34 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 85.22 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 85.15 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 85.05 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 84.99 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 84.96 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 84.96 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 84.94 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 84.94 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 84.82 | |
| KOG2383 | 467 | consensus Predicted ATPase [General function predi | 84.79 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 84.53 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 84.4 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 84.35 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 84.18 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 83.95 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 83.93 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 83.69 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 83.63 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 83.49 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 83.46 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 83.41 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 83.38 | |
| PF06144 | 172 | DNA_pol3_delta: DNA polymerase III, delta subunit; | 83.29 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 83.28 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 83.14 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 83.09 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 82.97 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 82.88 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 82.87 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 82.78 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 82.61 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 82.55 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 82.51 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 82.49 | |
| PRK07413 | 382 | hypothetical protein; Validated | 82.38 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 82.25 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 82.17 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 82.1 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 81.87 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 81.82 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 81.53 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 81.49 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 81.38 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 81.27 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 81.14 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 80.95 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 80.85 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 80.84 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 80.66 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 80.62 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 80.61 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 80.55 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 80.45 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 80.31 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 80.22 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 80.16 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 80.12 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 80.12 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 80.04 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.8e-33 Score=237.45 Aligned_cols=184 Identities=24% Similarity=0.336 Sum_probs=164.8
Q ss_pred CchhHHHHHHHHH---hhCCCcceEEEeeccccccCCCChHHHHHHHHHHHhcCCCC-c-----CchHHHHhhcCCceEE
Q 039644 1 IGKTAIARAIFDK---ISGDFECSCFLENVREESQRPGGLACLRQKLLSNILKDKNV-M-----PYIDLNFRRLSRMKVL 71 (192)
Q Consensus 1 iGKTtLa~~~~~~---~~~~F~~~~wv~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~-~-----~~~~~l~~~l~~~~~L 71 (192)
+||||||++++++ ++.+|+.++|+.+..+ ++..+++.+++..++...+. . +....+.+.|+.+|||
T Consensus 190 vGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~-----f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfl 264 (889)
T KOG4658|consen 190 VGKTTLARQIFNKFDEVGNHFDGVIWVVVSKE-----FTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFL 264 (889)
T ss_pred ccHHHHHHHHhcccchhcccCceEEEEEEccc-----ccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceE
Confidence 6999999999993 7899999999995443 89999999999988764443 1 2778899999999999
Q ss_pred EEEeCCCCchhHHHhhccCCCCCCCceEEEEecchhHHhh-cCCCceEecCCCCHHHHHHHHHHhhcCCC-CCCccHHHH
Q 039644 72 IVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQVLRN-WGVSKIYEMEALEYHHALELFSQHAFKRN-HPDVGYEKL 149 (192)
Q Consensus 72 lVlDdv~~~~~~~~l~~~~~~~~~~~~iivTtR~~~~~~~-~~~~~~~~l~~l~~~ea~~lf~~~~~~~~-~~~~~~~~~ 149 (192)
|||||+|+..+|+.+...+|...+||+|++|||++.++.. ++....++++.|+.+|||.||.+.++... ...+.+.++
T Consensus 265 lvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~l 344 (889)
T KOG4658|consen 265 LVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEEL 344 (889)
T ss_pred EEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHH
Confidence 9999999999999999999988889999999999999999 78888999999999999999999998764 445668999
Q ss_pred HHHHHHHhCCCchHHHHHHHHhccCC-HHHHHHHHHHHHhc
Q 039644 150 SSNVTKYAQGIPLALKVLSCFLHKRE-KEVWESAIDKLQRI 189 (192)
Q Consensus 150 ~~~i~~~~~g~Plai~~~~~~l~~~~-~~~w~~~l~~l~~~ 189 (192)
+++++++|+|+|||+.++|+.|+.+. +.+|+++...+...
T Consensus 345 ak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~ 385 (889)
T KOG4658|consen 345 AKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSS 385 (889)
T ss_pred HHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHcccccc
Confidence 99999999999999999999999987 88999999988654
|
|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >KOG2383 consensus Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF06144 DNA_pol3_delta: DNA polymerase III, delta subunit; InterPro: IPR010372 DNA polymerase III, delta subunit (2 | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07413 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 192 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 5e-19 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 2e-18 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-15 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 4e-10 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
Score = 82.7 bits (204), Expect = 5e-19
Identities = 32/204 (15%), Positives = 67/204 (32%), Gaps = 25/204 (12%)
Query: 1 IGKTAIARAIF---DKISGDFECSCFLENVREESQRPGGLACLRQKLLSNILKDKNVMPY 57
GK+ IA D++ G S + + L +L + + +++ +
Sbjct: 163 SGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPK--STFDLFTDILLMLKSEDDLLNF 220
Query: 58 ------------IDLNFRRLSRMKVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRN 105
+ + R L VFDDV Q E++ R ++TTR+
Sbjct: 221 PSVEHVTSVVLKRMICNALIDRPNTLFVFDDV---VQEETI---RWAQELRLRCLVTTRD 274
Query: 106 KQVLRNW-GVSKIYEMEALEYHHALELFSQHAFKRNHPDVGYEKLSSNVTKYAQGIPLAL 164
++ + E+ +LE + + + E + + + + G P L
Sbjct: 275 VEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEK-EEDVLNKTIELSSGNPATL 333
Query: 165 KVLSCFLHKREKEVWESAIDKLQR 188
+ + E +KL+
Sbjct: 334 MMFFKSCEPKTFEKMAQLNNKLES 357
|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 192 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.96 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.92 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.89 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.87 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 99.16 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.14 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 99.11 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.97 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.96 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.79 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.7 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.69 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.66 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.46 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.23 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.22 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 98.08 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.05 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 98.01 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.98 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.91 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.71 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.65 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.6 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.59 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.46 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.42 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.41 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.39 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.38 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.38 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.37 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.33 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.29 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.28 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.17 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.15 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 97.15 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.1 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.99 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.93 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 96.86 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.86 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.66 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.58 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 96.53 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.27 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.22 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.09 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.97 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 95.73 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 95.63 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 95.61 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.59 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 95.59 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.17 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 95.16 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 95.13 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.11 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 94.66 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.61 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 94.53 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 94.51 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.48 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 94.46 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 94.37 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 94.35 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 94.1 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 93.93 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 93.47 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 92.79 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 92.25 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 92.16 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 92.02 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.83 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 91.73 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.43 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.36 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 91.14 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 89.7 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 89.7 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 89.67 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 89.5 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 89.06 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 88.65 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 87.66 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 87.16 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 86.87 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 85.77 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 85.6 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 84.89 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 84.39 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 84.18 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 84.14 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 83.61 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 82.74 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 82.59 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 82.47 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 81.72 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 81.2 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 81.18 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 81.14 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 80.88 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 80.46 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 80.27 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 80.13 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=1.2e-28 Score=203.98 Aligned_cols=165 Identities=16% Similarity=0.185 Sum_probs=135.0
Q ss_pred CchhHHHHHHHH----HhhCCCcceEEEeeccccccCCCChHHHHHHHHHHHhcCCC--C---cC------chHHHHhhc
Q 039644 1 IGKTAIARAIFD----KISGDFECSCFLENVREESQRPGGLACLRQKLLSNILKDKN--V---MP------YIDLNFRRL 65 (192)
Q Consensus 1 iGKTtLa~~~~~----~~~~~F~~~~wv~~~~~~~~~~~~~~~~~~~l~~~~~~~~~--~---~~------~~~~l~~~l 65 (192)
+||||||+++|+ +++.+|++++|++ ++..+. ++..+++..++.++..... . .+ ....++..+
T Consensus 163 vGKTtLA~~v~~~~~~~~~~~F~~~~wv~-vs~~~~--~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L 239 (549)
T 2a5y_B 163 SGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAP--KSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL 239 (549)
T ss_dssp SSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCST--THHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH
T ss_pred CCHHHHHHHHHHhhhHHHhccCCcEEEEE-ECCCCC--CCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHH
Confidence 799999999996 6899999999997 544211 3688999999999986532 1 11 368889999
Q ss_pred CCc-eEEEEEeCCCCchhHHHhhccCCCCCCCceEEEEecchhHHhhcC-CCceEecCCCCHHHHHHHHHHhhcCCCCCC
Q 039644 66 SRM-KVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQVLRNWG-VSKIYEMEALEYHHALELFSQHAFKRNHPD 143 (192)
Q Consensus 66 ~~~-~~LlVlDdv~~~~~~~~l~~~~~~~~~~~~iivTtR~~~~~~~~~-~~~~~~l~~l~~~ea~~lf~~~~~~~~~~~ 143 (192)
.++ ||||||||+|+..++ .+.. .+||+||||||++.++..++ ....+++++|+.++|++||.+.++.... .
T Consensus 240 ~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~ 312 (549)
T 2a5y_B 240 IDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-G 312 (549)
T ss_dssp TTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---
T ss_pred cCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC-c
Confidence 996 999999999998765 2221 27899999999999988775 4467999999999999999999876543 4
Q ss_pred ccHHHHHHHHHHHhCCCchHHHHHHHHhccCC
Q 039644 144 VGYEKLSSNVTKYAQGIPLALKVLSCFLHKRE 175 (192)
Q Consensus 144 ~~~~~~~~~i~~~~~g~Plai~~~~~~l~~~~ 175 (192)
+.+.+.+.+|+++|+|+||||+++|+.|+.+.
T Consensus 313 ~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~ 344 (549)
T 2a5y_B 313 EKEEDVLNKTIELSSGNPATLMMFFKSCEPKT 344 (549)
T ss_dssp CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS
T ss_pred hhHHHHHHHHHHHhCCChHHHHHHHHHhccch
Confidence 67788999999999999999999999998874
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 192 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-21 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 87.2 bits (215), Expect = 1e-21
Identities = 32/202 (15%), Positives = 64/202 (31%), Gaps = 21/202 (10%)
Query: 1 IGKTAIARAIFDK----ISGDFECSCFLENVREESQRP------GGLACLRQKLLSNILK 50
GK+ IA K I +++ +L++ + L + L N
Sbjct: 55 SGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPS 114
Query: 51 DKNVMPYIDLNF---RRLSRMKVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQ 107
++V + + R L VFDDV R ++TTR+ +
Sbjct: 115 VEHVTSVVLKRMICNALIDRPNTLFVFDDV------VQEETIRWAQELRLRCLVTTRDVE 168
Query: 108 VLRN-WGVSKIYEMEALEYHHALELFSQHAFKRNHPDVGYEKLSSNVTKYAQGIPLALKV 166
+ + E+ +LE + + + E + + + + G P L +
Sbjct: 169 ISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGE-KEEDVLNKTIELSSGNPATLMM 227
Query: 167 LSCFLHKREKEVWESAIDKLQR 188
+ E +KL+
Sbjct: 228 FFKSCEPKTFEKMAQLNNKLES 249
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 192 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 100.0 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.76 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.16 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.9 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.9 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.88 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.75 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.7 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.59 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.5 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.44 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.28 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.28 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.26 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.99 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.98 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.68 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 96.66 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.14 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.07 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.6 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.28 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.86 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.2 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 93.38 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.14 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 91.49 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 91.36 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 91.36 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 91.34 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 91.3 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.86 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 90.41 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 89.64 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 89.29 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.72 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 88.31 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 87.67 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 87.19 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.1 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 87.03 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 86.85 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 86.84 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 86.54 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 86.48 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 86.41 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 85.87 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 85.73 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 85.19 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 83.96 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 83.71 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 83.67 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 82.94 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 82.94 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 82.49 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 80.96 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=100.00 E-value=2.9e-32 Score=205.96 Aligned_cols=177 Identities=17% Similarity=0.158 Sum_probs=137.2
Q ss_pred CchhHHHHHHHHH----hhCCCcceEEEeeccccccCCCChHHHHHHH---HHHHhcCCCC-----cC------chHHHH
Q 039644 1 IGKTAIARAIFDK----ISGDFECSCFLENVREESQRPGGLACLRQKL---LSNILKDKNV-----MP------YIDLNF 62 (192)
Q Consensus 1 iGKTtLa~~~~~~----~~~~F~~~~wv~~~~~~~~~~~~~~~~~~~l---~~~~~~~~~~-----~~------~~~~l~ 62 (192)
|||||||+++|++ ...+|++++|+++.+. ++...+...+ +......... .+ ....+.
T Consensus 55 iGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~-----~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 129 (277)
T d2a5yb3 55 SGKSVIASQALSKSDQLIGINYDSIVWLKDSGT-----APKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICN 129 (277)
T ss_dssp SSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCC-----STTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHH
T ss_pred CCHHHHHHHHHHhhhhhhhhcCceEEEEEecCC-----CCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHH
Confidence 7999999999985 5667999999985443 3444444444 3333322111 11 233466
Q ss_pred hhcCCceEEEEEeCCCCchhHHHhhccCCCCCCCceEEEEecchhHHhhcCC-CceEecCCCCHHHHHHHHHHhhcCCCC
Q 039644 63 RRLSRMKVLIVFDDVTCFSQLESLMGSLDWLTPVSRIILTTRNKQVLRNWGV-SKIYEMEALEYHHALELFSQHAFKRNH 141 (192)
Q Consensus 63 ~~l~~~~~LlVlDdv~~~~~~~~l~~~~~~~~~~~~iivTtR~~~~~~~~~~-~~~~~l~~l~~~ea~~lf~~~~~~~~~ 141 (192)
..+.++++|+||||+|+..+|+.+. ..+|+||||||++.++..+.. .+.+++++|+.+||++||...++....
T Consensus 130 ~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~ 203 (277)
T d2a5yb3 130 ALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV 203 (277)
T ss_dssp HHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC-
T ss_pred HHhccCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccC
Confidence 7778999999999999999888764 247899999999999887643 468999999999999999998876544
Q ss_pred CCccHHHHHHHHHHHhCCCchHHHHHHHHhccCCHHHHHHHHHHHHhc
Q 039644 142 PDVGYEKLSSNVTKYAQGIPLALKVLSCFLHKREKEVWESAIDKLQRI 189 (192)
Q Consensus 142 ~~~~~~~~~~~i~~~~~g~Plai~~~~~~l~~~~~~~w~~~l~~l~~~ 189 (192)
.+...+.+++|+++|+|+|||++++|+.|+.++.+.|.+..+++++.
T Consensus 204 -~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~ 250 (277)
T d2a5yb3 204 -GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESR 250 (277)
T ss_dssp --CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHH
T ss_pred -chhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcC
Confidence 34567888999999999999999999999998899999998888753
|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|