Citrus Sinensis ID: 039821

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----
VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
cccccccccccccEEEEEcccHHHHHHcccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccccccccEEEcHHHHHHHHHHHHHHHHHcccEEEEccccccccccccccccEEEEEEEcccccccccccccccEEEEEccccccHHccHHHHHcccccccEEEcccccccccccccccHHHHHHHHccEEcccccccccccHHHHccccccccccccccccccccHHHHHcccccEEcccccccHHHcccccHHHHcccccccEEEEcccccccccccccccccEEEEEEEEcccccccccccccccccEEEEEEcccccEEccccccccHHHHcccccccccccEEEEEcccccccccccccccccEEEEEEEcccccccccccccccccccEEEEcccccccccccccccccccccccccccc
cccccccccccccEEEEEEccHHHHHHHcccccEEEccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHcHHHccccccccHHHHEEcHcccccHHHHHHHHEHEcccccccEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHccccccEEEEcccccEccccccccHHEEEEEEcccccccccccccccccEEEEEEcccccccccHHHHccccccEEEEEccccccccHHHccccHcccHHHHHEEEccccccccccccccccccccEEEEcccccHHcccccccccccccEEEEcccccHccccccccccccccccccEccccccccHHccccccccccccEEEEcccccHHccccccccccccEEEEEccccHHHcccccccccHHHHHHcccccccccEEEEcccccccccccccccccccEEEEEccccccccccccccccHHcEEEEcccHHHHHHcccccHHHHHHccccccccc
vgiplpspqnttskVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFaglgkevyPLLKFSYDslqndtirscflycclypedydilkwdlidcwigegflgesdrfgaenqgydILDTLVRACLLeeveddkvKMHDVIRDMALWITGEIEKEKRNFLVCAgaglneapdvkgweNVRRLSLMQNQIetlsevptcphllTLFLDFNEDVEMIADGFFqfmpslkvlkmsncgkswsnfqlpvgmselgsslelldISHTSIRELPEELKKLVNLKCLNLRRTELLNKIprqlisnssrdttsvIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRkrrepfvfrslHCVTIHicqklkdttflvfapnlkslslfHCGAMEEIisvgkfaevpemmghispfeNLRLLRLshlpnlksiywkplpfthLKEMVVRGCdqleklpldsnsakeRKFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
vgiplpspqnttskvvFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEveddkvkmhDVIRDMALWITGEIEKEKRNFLVCAGAGlneapdvkgwENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELlnkiprqlisnssrdttSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQleklpldsnsakerkFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMselgsslellDISHTSIRELPEElkklvnlkclnlRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFEnlrllrlshlpnlKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
*************KVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNF***************************EELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPL******ERKFVIRGEEDWWNLLQWEDESTQIAFRSC*****
VGIPLP*PQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRR*********KEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAF*******ELWIDRAKELELLKID*****************HCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVG********MGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCFQP**
VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRxxxxxxxxxxxxxxxxxxxxxASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSELGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRREPFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRGEEDWWNLLQWEDESTQIAFRSCFQPRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query555 2.2.26 [Sep-21-2011]
O82484892 Putative disease resistan yes no 0.965 0.600 0.409 1e-105
Q8RXS5888 Probable disease resistan no no 0.963 0.602 0.380 1e-104
P60838894 Probable disease resistan no no 0.978 0.607 0.376 3e-98
O64973889 Disease resistance protei no no 0.969 0.605 0.400 6e-98
Q9C8T9898 Putative disease resistan no no 0.974 0.602 0.394 5e-96
Q9SH22884 Probable disease resistan no no 0.969 0.608 0.397 6e-96
O22727967 Probable disease resistan no no 0.974 0.559 0.394 6e-95
Q9SI85893 Probable disease resistan no no 0.969 0.602 0.387 2e-94
O64790762 Probable disease resistan no no 0.965 0.703 0.390 2e-94
O64789925 Probable disease resistan no no 0.960 0.576 0.377 8e-91
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function desciption
 Score =  382 bits (982), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 254/620 (40%), Positives = 343/620 (55%), Gaps = 84/620 (13%)

Query: 1   VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESD 60
           +GIP  + +N   KVVFTTR +DVC  M  H   EV CLS  DAWELF+EKVGQ +L S 
Sbjct: 273 IGIPSQTRENKC-KVVFTTRSLDVCARMGVHDPMEVQCLSTNDAWELFQEKVGQISLGSH 331

Query: 61  HEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYP 120
            +I+ELA+ VA +C GLPLAL  IG  MA ++  ++W  A++ L   A+EF+G+   +  
Sbjct: 332 PDILELAKKVAGKCRGLPLALNVIGETMAGKRAVQEWHHAVDVLTSYAAEFSGMDDHILL 391

Query: 121 LLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFL-GESDRFGAENQGYD 179
           +LK+SYD+L +  +RSCF YC LYPEDY I K+ LID WI EGF+ G   +  A NQGY+
Sbjct: 392 ILKYSYDNLNDKHVRSCFQYCALYPEDYSIKKYRLIDYWICEGFIDGNIGKERAVNQGYE 451

Query: 180 ILDTLVRACLLEEVEDDK--VKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVK 237
           IL TLVRACLL E   +K  VKMHDV+R+MALW   ++ K K   +V AG+GL + P V+
Sbjct: 452 ILGTLVRACLLSEEGKNKLEVKMHDVVREMALWTLSDLGKNKERCIVQAGSGLRKVPKVE 511

Query: 238 GWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMSNC 297
            W  VRRLSLM N IE +S  P CP L TLFL  N+ +  I+  FF+ M  L VL +S  
Sbjct: 512 DWGAVRRLSLMNNGIEEISGSPECPELTTLFLQENKSLVHISGEFFRHMRKLVVLDLS-- 569

Query: 298 GKSWSNFQ---LPVGMSELGSSLELLDISHTSIRELP---EELKKLVNLKCLNLRRTELL 351
                N Q   LP  +SEL  +L  LD+SHT+I  LP   ++LK L++L    +RR   +
Sbjct: 570 ----ENHQLDGLPEQISEL-VALRYLDLSHTNIEGLPACLQDLKTLIHLNLECMRRLGSI 624

Query: 352 NKIP-----RQL---ISNSSRDTTSV-------------------------IDATAFADL 378
             I      R L    SN   D  SV                         IDA     +
Sbjct: 625 AGISKLSSLRTLGLRNSNIMLDVMSVKELHLLEHLEILTIDIVSTMVLEQMIDAGTL--M 682

Query: 379 NHLNELWI------------------DRAKELELLKIDYTEIVRKR-------REPFVFR 413
           N + E+ I                  D  + L +   + +EI  +R         P  F 
Sbjct: 683 NCMQEVSIRCLIYDQEQDTKLRLPTMDSLRSLTMWNCEISEIEIERLTWNTNPTSPCFF- 741

Query: 414 SLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPE----MMGHIS 469
           +L  V IH+C  LKD T+L+FAPN+  L +     ++E+IS  K   V E     +  I 
Sbjct: 742 NLSQVIIHVCSSLKDLTWLLFAPNITYLMIEQLEQLQELISHAKATGVTEEEQQQLHKII 801

Query: 470 PFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAK-ERKFVIRG 528
           PF+ L++L LS LP LKSIYW  L F  L  + V  C +L KLPLDS +    +KFV++ 
Sbjct: 802 PFQKLQILHLSSLPELKSIYWISLSFPCLSGIYVERCPKLRKLPLDSKTGTVGKKFVLQY 861

Query: 529 EE-DWWNLLQWEDESTQIAF 547
           +E +W   ++W+DE+T++ F
Sbjct: 862 KETEWIESVEWKDEATKLHF 881
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|O64790|DRL17_ARATH Probable disease resistance protein At1g61300 OS=Arabidopsis thaliana GN=At1g61300 PE=2 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query555
24461863 889 NBS-LRR type disease resistance protein 0.989 0.617 0.617 0.0
24461866 890 NBS-LRR type disease resistance protein 0.971 0.605 0.528 1e-163
24461864 899 NBS-LRR type disease resistance protein 0.987 0.609 0.509 1e-158
24461865 892 NBS-LRR type disease resistance protein 0.974 0.606 0.500 1e-143
24461861 890 NBS-LRR type disease resistance protein 0.978 0.610 0.494 1e-142
147852651 882 hypothetical protein VITISV_017542 [Viti 0.980 0.616 0.462 1e-132
297741956 696 unnamed protein product [Vitis vinifera] 0.972 0.775 0.445 1e-127
15080718479 putative disease resistance gene protein 0.648 0.751 0.648 1e-127
359482674 991 PREDICTED: probable disease resistance p 0.971 0.543 0.425 1e-121
225442867 893 PREDICTED: probable disease resistance p 0.987 0.613 0.429 1e-121
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/625 (61%), Positives = 437/625 (69%), Gaps = 76/625 (12%)

Query: 1   VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESD 60
           VG+P+P    + SKVVFTTR  +VC  M +H+KF V CLS  DAWELFR+ VG+ETL SD
Sbjct: 267 VGVPIPPRDKSASKVVFTTRSAEVCVWMGAHKKFGVGCLSANDAWELFRQNVGEETLTSD 326

Query: 61  HEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYP 120
           H+I ELAQ VA+ECGGLPLALITIG+AMAY+K  E+WR AIE LRRSASEF G    V  
Sbjct: 327 HDIAELAQIVAEECGGLPLALITIGQAMAYKKTVEEWRHAIEVLRRSASEFPGF-DNVLR 385

Query: 121 LLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDI 180
           + KFSYDSL +DT RSCFLYCCLYP+DY ILKWDLIDCWIGEGFL ES RF AENQGY I
Sbjct: 386 VFKFSYDSLPDDTTRSCFLYCCLYPKDYGILKWDLIDCWIGEGFLEESARFVAENQGYCI 445

Query: 181 LDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWE 240
           + TLV ACLLEE+EDDKVKMHDV+R MALWI  EIE+EKRNFLV AGAGL +AP VK WE
Sbjct: 446 VGTLVDACLLEEIEDDKVKMHDVVRYMALWIVCEIEEEKRNFLVRAGAGLEQAPAVKEWE 505

Query: 241 NVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSL----------- 289
           NVRRLSLMQN I+ LSEVPTCP L TLFL  N +++ I DGFF+FMPSL           
Sbjct: 506 NVRRLSLMQNDIKILSEVPTCPDLHTLFLASNNNLQRITDGFFKFMPSLKVLKMSHCGDL 565

Query: 290 KVLK----MSNCGK-----------------------------SWSNF--QLPVGMSELG 314
           KVLK    MS  G                               W+ +  ++P  +    
Sbjct: 566 KVLKLPLGMSMLGSLELLDISQTSIGELPEELKLLVNLKCLNLRWATWLSKIPRQLISNS 625

Query: 315 SSLELLDI-----SHTSIRE----------LPEELKKLVNLKCL--NLRRTELL------ 351
           S L +L +     SH+   E          L +EL  L  L+ L   LR +  L      
Sbjct: 626 SRLHVLRMFATGCSHSEASEDSVLFGGGEVLIQELLGLKYLEVLELTLRSSHALQLFFSS 685

Query: 352 NKIP---RQLISNSSRDTTSVIDATAFADLNHLNELWIDRAKELELLKIDYTEIVRKRRE 408
           NK+    R L+ +  R T S+IDATAFADLNHLNEL ID   E+E LKIDYTEIVRKRRE
Sbjct: 686 NKLKSCIRSLLLDEVRGTKSIIDATAFADLNHLNELRIDSVAEVEELKIDYTEIVRKRRE 745

Query: 409 PFVFRSLHCVTIHICQKLKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHI 468
           PFVF SLH VT+  C KLKD TFLVFAPNLKSL L +C AMEEIISVGKFAEVPE+MGHI
Sbjct: 746 PFVFGSLHRVTLGQCLKLKDLTFLVFAPNLKSLQLLNCRAMEEIISVGKFAEVPEVMGHI 805

Query: 469 SPFENLRLLRLSHLPNLKSIYWKPLPFTHLKEMVVRGCDQLEKLPLDSNSAKERKFVIRG 528
           SPFENL+ L L  LP LKSIYWKPLPFTHLKEM V GC+QL+KLPLDSNSA   KFVIRG
Sbjct: 806 SPFENLQRLHLFDLPRLKSIYWKPLPFTHLKEMRVHGCNQLKKLPLDSNSA---KFVIRG 862

Query: 529 EEDWWNLLQWEDESTQIAFRSCFQP 553
           E + WN LQWED++TQIAFRSCFQP
Sbjct: 863 EAEGWNRLQWEDDATQIAFRSCFQP 887

Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|147852651|emb|CAN80649.1| hypothetical protein VITISV_017542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741956|emb|CBI33401.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15080718|gb|AAK83559.1|AF278857_1 putative disease resistance gene protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|359482674|ref|XP_002281708.2| PREDICTED: probable disease resistance protein At1g12280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225442867|ref|XP_002281592.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query555
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.526 0.328 0.491 8.8e-96
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.585 0.426 0.469 4.4e-90
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.693 0.428 0.408 4.4e-90
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.699 0.438 0.402 1.5e-89
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.706 0.405 0.416 1.3e-88
TAIR|locus:2031356884 AT1G63360 [Arabidopsis thalian 0.733 0.460 0.384 1.5e-87
TAIR|locus:2203881893 AT1G62630 [Arabidopsis thalian 0.697 0.433 0.399 1.9e-85
TAIR|locus:2171589 948 AT5G47260 [Arabidopsis thalian 0.518 0.303 0.424 1.7e-79
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.508 0.322 0.436 5.5e-78
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.585 0.381 0.447 6.6e-77
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 753 (270.1 bits), Expect = 8.8e-96, Sum P(2) = 8.8e-96
 Identities = 145/295 (49%), Positives = 205/295 (69%)

Query:     1 VGIPLPSPQNTTSKVVFTTRFIDVCGSMESHRKFEVACLSEEDAWELFREKVGQETLESD 60
             VG+P PS +N   K+VFTTR  ++CG M      EV CL+ +DAW+LF +KVG+ TL S 
Sbjct:   274 VGVPFPSRENGC-KIVFTTRLKEICGRMGVDSDMEVRCLAPDDAWDLFTKKVGEITLGSH 332

Query:    61 HEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYP 120
              EI  +A+TVAK+C GLPLAL  IG  MAY++  ++WR AI+ L  SA+EF+G+  E+ P
Sbjct:   333 PEIPTVARTVAKKCRGLPLALNVIGETMAYKRTVQEWRSAIDVLTSSAAEFSGMEDEILP 392

Query:   121 LLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDI 180
             +LK+SYD+L+++ ++ CF YC L+PED++I K DL+D WIGEGF+ + ++  AENQGY+I
Sbjct:   393 ILKYSYDNLKSEQLKLCFQYCALFPEDHNIEKNDLVDYWIGEGFI-DRNKGKAENQGYEI 451

Query:   181 LDTLVRACLLEEVEDDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEAPDVKGWE 240
             +  LVR+CLL E   + VKMHDV+R+MALWI  +  K+K NF+V AG      P+++ W+
Sbjct:   452 IGILVRSCLLMEENQETVKMHDVVREMALWIASDFGKQKENFIVQAGLQSRNIPEIEKWK 511

Query:   241 NVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNEDVEMIADGFFQFMPSLKVLKMS 295
               RR+SLM N IE++ + P  P L+TL L  N  +  I+  FF+ MP L VL +S
Sbjct:   512 VARRVSLMFNNIESIRDAPESPQLITLLLRKNF-LGHISSSFFRLMPMLVVLDLS 565
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query555
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-46
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 9e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  163 bits (414), Expect = 3e-46
 Identities = 67/170 (39%), Positives = 100/170 (58%), Gaps = 4/170 (2%)

Query: 1   VGIPLPSPQNTTSKVVFTTRFIDVCGSM-ESHRKFEVACLSEEDAWELFREKVGQETLES 59
           +G+P P  +N  S+V+ TTR   V G M  + +  EV  L  E++WELF  KV ++ L  
Sbjct: 118 IGVPFPDGENG-SRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKELPP 176

Query: 60  DHEIVELAQTVAKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVY 119
             E+ E+A+ + ++C GLPLAL  +G  +A++   ++W   +E+L    +   GL  EV 
Sbjct: 177 CPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGL-NEVL 235

Query: 120 PLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESD 169
            +L  SYD+L    ++ CFLY  L+PEDY+I K  LI  WI EGF+  SD
Sbjct: 236 SILSLSYDNL-PMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPSD 284

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 555
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.8
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.72
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.62
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.53
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.52
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.35
KOG0617264 consensus Ras suppressor protein (contains leucine 99.3
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.28
KOG0617264 consensus Ras suppressor protein (contains leucine 99.25
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.17
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.15
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.91
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.88
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.88
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.68
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG4341483 consensus F-box protein containing LRR [General fu 98.56
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.54
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.54
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.51
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.51
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.49
PRK15386 426 type III secretion protein GogB; Provisional 98.39
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.38
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.15
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
PLN03150623 hypothetical protein; Provisional 98.05
PRK15386 426 type III secretion protein GogB; Provisional 98.03
PLN03150623 hypothetical protein; Provisional 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG4341483 consensus F-box protein containing LRR [General fu 97.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.62
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.51
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.38
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.33
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.1
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.07
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.06
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.85
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.75
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.58
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.46
PRK04841 903 transcriptional regulator MalT; Provisional 96.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.21
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.56
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.13
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.18
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.83
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.45
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.25
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 91.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 91.8
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.61
PRK06893229 DNA replication initiation factor; Validated 90.45
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.76
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.64
smart0037026 LRR Leucine-rich repeats, outliers. 87.64
smart0037026 LRR Leucine-rich repeats, outliers. 87.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.31
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.63
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 86.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.77
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 80.75
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-66  Score=556.68  Aligned_cols=538  Identities=42%  Similarity=0.707  Sum_probs=432.2

Q ss_pred             CCCCCCCCCCCCcEEEEEeCchhhhcc-cCCcceEEcCCCCHHHHHHHHHHHhCCCCcCCchhHHHHHHHHHHHhCCCch
Q 039821            1 VGIPLPSPQNTTSKVVFTTRFIDVCGS-MESHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPL   79 (555)
Q Consensus         1 ~~~p~~~~~~~gsrIivTTR~~~v~~~-~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPL   79 (555)
                      ||+||| ....||||++|||++.||.. +++...++++.|+.+|||.||.+.||.......+.+.++|++|+++|+|+||
T Consensus       279 I~~~~p-~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPL  357 (889)
T KOG4658|consen  279 IGVPFP-SRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPL  357 (889)
T ss_pred             cCCCCC-CccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHH
Confidence            789999 88889999999999999998 8888999999999999999999999988656666699999999999999999


Q ss_pred             HHHHHHHHHhcCCCHHHHHHHHHHHhhh-hhhccCCchhhhhhhhhhccCCChhhHhHHHhHhcCCCCCcccchHHHHHH
Q 039821           80 ALITIGRAMAYRKKAEQWRRAIEELRRS-ASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDC  158 (555)
Q Consensus        80 ai~~~~~~L~~~~~~~~w~~~l~~l~~~-~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~~s~Fp~~~~i~~~~li~~  158 (555)
                      |++++|+.|+.+.+.++|+++.+.+... ..+++...+.+++++++||+.||. ++|.||+|||.||+||.|++++|+..
T Consensus       358 Al~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~-~lK~CFLycalFPED~~I~~e~Li~y  436 (889)
T KOG4658|consen  358 ALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPE-ELKSCFLYCALFPEDYEIKKEKLIEY  436 (889)
T ss_pred             HHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhH-HHHHHHHhhccCCcccccchHHHHHH
Confidence            9999999999999999999999999876 555555567899999999999996 99999999999999999999999999


Q ss_pred             HHHhCCCCC-CcccChHHhHHHHHHHHHHhccccccC----CCeEEechhhHHHHHHHHhhhhcccccEEEEcCCCCCCC
Q 039821          159 WIGEGFLGE-SDRFGAENQGYDILDTLVRACLLEEVE----DDKVKMHDVIRDMALWITGEIEKEKRNFLVCAGAGLNEA  233 (555)
Q Consensus       159 w~aeg~~~~-~~~~~~~~~~~~~l~~Lv~~sli~~~~----~~~~~mhdl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  233 (555)
                      |+||||+.+ .++..+++.|++|+++|+.++++...+    ..+|+|||+|||+|.+++.+.+...++.++..+.+....
T Consensus       437 WiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~  516 (889)
T KOG4658|consen  437 WIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEI  516 (889)
T ss_pred             HHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCcccc
Confidence            999999988 568899999999999999999998753    478999999999999999987777788888777777888


Q ss_pred             CCccCccceeEeeccccccccccCCCCCCcceEEEcccCcc-hhccchhHhccCCcccEEEecCCCCCccccccChhHhh
Q 039821          234 PDVKGWENVRRLSLMQNQIETLSEVPTCPHLLTLFLDFNED-VEMIADGFFQFMPSLKVLKMSNCGKSWSNFQLPVGMSE  312 (555)
Q Consensus       234 ~~~~~~~~l~~L~l~~~~~~~l~~~~~~~~L~~L~l~~~~~-~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~lp~~~~~  312 (555)
                      +....+..+|++++.++.+..++....+++|++|.+.++.. +..++..+|..|+.|++||+++|..   ..++|.+|++
T Consensus       517 ~~~~~~~~~rr~s~~~~~~~~~~~~~~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~---l~~LP~~I~~  593 (889)
T KOG4658|consen  517 PQVKSWNSVRRMSLMNNKIEHIAGSSENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSS---LSKLPSSIGE  593 (889)
T ss_pred             ccccchhheeEEEEeccchhhccCCCCCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCc---cCcCChHHhh
Confidence            89999999999999999999998888899999999997763 7788888899999999999999966   9999999999


Q ss_pred             hhccccEEEcCCCCCcccchhhhCCCCCcEEccCCCccccccchHHHhccccc-cccccCcc---------ccCCCcccc
Q 039821          313 LGSSLELLDISHTSIRELPEELKKLVNLKCLNLRRTELLNKIPRQLISNSSRD-TTSVIDAT---------AFADLNHLN  382 (555)
Q Consensus       313 l~~~L~~L~l~~~~i~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~i~~l~~L-~L~~~~~~---------~l~~l~~L~  382 (555)
                      +. +||||+++++.+..+|.++++|++|.+||+..+..+..+|. ++..|.+| +|.+....         ++..+.+|+
T Consensus       594 Li-~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~-i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~  671 (889)
T KOG4658|consen  594 LV-HLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPG-ILLELQSLRVLRLPRSALSNDKLLLKELENLEHLE  671 (889)
T ss_pred             hh-hhhcccccCCCccccchHHHHHHhhheeccccccccccccc-hhhhcccccEEEeeccccccchhhHHhhhcccchh
Confidence            99 99999999999999999999999999999999977777754 36668887 55444322         334444555


Q ss_pred             ccccccccc--cc-------------eeeecccccccccccccccccccEEEEeecCC----------------------
Q 039821          383 ELWIDRAKE--LE-------------LLKIDYTEIVRKRREPFVFRSLHCVTIHICQK----------------------  425 (555)
Q Consensus       383 ~L~l~~~~~--l~-------------~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~----------------------  425 (555)
                      .+.+.....  ++             .+.+..............+.+|+.|.+.+|..                      
T Consensus       672 ~ls~~~~s~~~~e~l~~~~~L~~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~~~~f~~l~~  751 (889)
T KOG4658|consen  672 NLSITISSVLLLEDLLGMTRLRSLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIVLLCFPNLSK  751 (889)
T ss_pred             hheeecchhHhHhhhhhhHHHHHHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccchhhhHHHHHH
Confidence            444432221  00             00000011111222333566666666666644                      


Q ss_pred             --------CCcccccccCCCCceEEeecCCcchhhhccCcccccccccCCCCCCccccee-ecCcccccccccccccCCC
Q 039821          426 --------LKDTTFLVFAPNLKSLSLFHCGAMEEIISVGKFAEVPEMMGHISPFENLRLL-RLSHLPNLKSIYWKPLPFT  496 (555)
Q Consensus       426 --------l~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~L~~L-~l~~~~~L~~l~~~~~~~~  496 (555)
                              ...+.|....|+|+.|.+..|..++++++....  ...+......|.+++.+ .+.+...++.+.+....++
T Consensus       752 ~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~--~~~l~~~i~~f~~~~~l~~~~~l~~l~~i~~~~l~~~  829 (889)
T KOG4658|consen  752 VSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKA--LLELKELILPFNKLEGLRMLCSLGGLPQLYWLPLSFL  829 (889)
T ss_pred             HHhhccccccccchhhccCcccEEEEecccccccCCCHHHH--hhhcccEEecccccccceeeecCCCCceeEecccCcc
Confidence                    333334445799999999999999988663211  11111123345566666 4666666776666666778


Q ss_pred             CcceEEEcCCCCCCccCCCCCccc--c-cceEEechhhhhhccccCchhhhhhc
Q 039821          497 HLKEMVVRGCDQLEKLPLDSNSAK--E-RKFVIRGEEDWWNLLQWEDESTQIAF  547 (555)
Q Consensus       497 ~L~~L~l~~C~~L~~lp~~~~~~~--L-~~l~i~~~~~~~~~~~~~~~~~~~~~  547 (555)
                      +|+.+.+..||++.++|.......  . ..+....+.++.++++|+++++...+
T Consensus       830 ~l~~~~ve~~p~l~~~P~~~~~~i~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~  883 (889)
T KOG4658|consen  830 KLEELIVEECPKLGKLPLLSTLTIVGCEEKLKEYPDGEWLEGVYWEDELTKLRF  883 (889)
T ss_pred             chhheehhcCcccccCccccccceeccccceeecCCccceeeEEehhhhhhhhc
Confidence            899999999999999998765432  2 23444466778999999999988765

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query555
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-39
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-12
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  149 bits (378), Expect = 6e-39
 Identities = 41/222 (18%), Positives = 79/222 (35%), Gaps = 29/222 (13%)

Query: 13  SKVVFTTRFIDVCGSMES--HRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTV 70
            +++ TTR   V  S+    +     + L +E   E+    V  +      ++ E A ++
Sbjct: 258 CQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMK----KADLPEQAHSI 313

Query: 71  AKECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGK-----EVYPLLKFS 125
            KEC G PL +  IG  +  R    +W   +++L+    +            +   +  S
Sbjct: 314 IKECKGSPLVVSLIGALL--RDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSIS 371

Query: 126 YDSLQNDTIRSCFLYCCLYPEDYDILKWDLIDCWIGEGFLGESDRFGAENQGYDILDTLV 185
            + L+ D I+  +    +  +D  +    L   W  E    E           DIL   V
Sbjct: 372 VEMLRED-IKDYYTDLSILQKDVKVPTKVLCILWDMETEEVE-----------DILQEFV 419

Query: 186 RACLLEEVEDDKV---KMHDVIRDMALWITG-EIEKEKRNFL 223
              LL    + K     +HD+  D        +++   +  +
Sbjct: 420 NKSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKII 461
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query555
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.81
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.8
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.8
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.8
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.8
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.79
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.79
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.79
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.79
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.78
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.78
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.78
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.77
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.76
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.75
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.74
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.73
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.73
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.73
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.72
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.71
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.7
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.69
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.68
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.67
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.64
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.64
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.62
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.61
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.6
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.57
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.56
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.51
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.47
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.42
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.41
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.41
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.39
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.39
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.39
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.36
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.34
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.33
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.33
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.32
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.31
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.27
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.23
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.19
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.19
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.18
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.01
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.01
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.0
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.94
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.89
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.89
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.84
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.79
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.71
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.71
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.62
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.61
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.46
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.02
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.42
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.27
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.21
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.0
2fna_A357 Conserved hypothetical protein; structural genomic 96.86
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 96.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.51
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.5
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 94.93
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.77
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.35
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.35
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.86
2gkw_B26 Tumor necrosis factor receptor superfamily member; 85.93
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.48
2v1u_A387 Cell division control protein 6 homolog; DNA repli 81.28
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.95  E-value=1.8e-28  Score=257.77  Aligned_cols=190  Identities=13%  Similarity=0.179  Sum_probs=154.5

Q ss_pred             CCcEEEEEeCchhhhcccC-CcceEEcCCCCHHHHHHHHHHHhCCCCcCCchhHHHHHHHHHHHhCCCchHHHHHHHHHh
Q 039821           11 TTSKVVFTTRFIDVCGSME-SHRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMA   89 (555)
Q Consensus        11 ~gsrIivTTR~~~v~~~~~-~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~~~~L~   89 (555)
                      +||+||||||++.|+..++ ...+|+|++|+++|||+||.++||...  .++++.+++++|+++|+|+||||+++|+.|+
T Consensus       264 ~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~--~~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~  341 (549)
T 2a5y_B          264 LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCE  341 (549)
T ss_dssp             TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCC
T ss_pred             CCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC--CchhHHHHHHHHHHHhCCChHHHHHHHHHhc
Confidence            7999999999999998876 446899999999999999999998754  2467889999999999999999999999997


Q ss_pred             cCCCHHHHHHHHHHHhhhhhhccCCchhhhhhhhhhccCCChhhHhHHHh-----------HhcCCCCCcccchHHHHHH
Q 039821           90 YRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFL-----------YCCLYPEDYDILKWDLIDC  158 (555)
Q Consensus        90 ~~~~~~~w~~~l~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl-----------~~s~Fp~~~~i~~~~li~~  158 (555)
                      .+ +   |..+ +.+....+...  ..++..++.+||++||. ++|.||+           |||+||+++.|+    +++
T Consensus       342 ~~-~---w~~~-~~l~~~l~~~~--~~~i~~~l~~Sy~~L~~-~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----i~~  409 (549)
T 2a5y_B          342 PK-T---FEKM-AQLNNKLESRG--LVGVECITPYSYKSLAM-ALQRCVEVLSDEDRSALAFAVVMPPGVDIP----VKL  409 (549)
T ss_dssp             SS-S---HHHH-HHHHHHHHHHC--SSTTCCCSSSSSSSHHH-HHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----HHH
T ss_pred             cc-h---HHHH-HHhHHHhhccc--HHHHHHHHhcccccccH-HHHHHHhccchhhhhHhhheeeeCCCCeee----eee
Confidence            63 3   4433 34444333221  24789999999999998 9999999           999999999999    889


Q ss_pred             HHHh--CCCCCCc-ccChHHhHHHHHHHHHHhcccccc---CCCeEEechhhHHHHHHHHhhh
Q 039821          159 WIGE--GFLGESD-RFGAENQGYDILDTLVRACLLEEV---EDDKVKMHDVIRDMALWITGEI  215 (555)
Q Consensus       159 w~ae--g~~~~~~-~~~~~~~~~~~l~~Lv~~sli~~~---~~~~~~mhdl~~~~~~~~~~~~  215 (555)
                      |+|+  ||+...+ ....++++. ++++|++++|++..   ....|+|||++|++|+.++.+.
T Consensus       410 w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~  471 (549)
T 2a5y_B          410 WSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQ  471 (549)
T ss_dssp             HHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTH
T ss_pred             eeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHH
Confidence            9999  9998755 667788887 99999999999876   3457999999999999887653
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2gkw_B Tumor necrosis factor receptor superfamily member; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 555
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 77.2 bits (189), Expect = 2e-16
 Identities = 18/127 (14%), Positives = 42/127 (33%), Gaps = 11/127 (8%)

Query: 13  SKVVFTTRFIDVCGSMES-HRKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVA 71
            + + TTR +++  +        EV  L  ++ ++               +  ++     
Sbjct: 158 LRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTI 215

Query: 72  KECGGLPLALITIGRAMAYRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQN 131
           +   G P  L+   ++    K  E+  +   +L             V  +  +SY SL  
Sbjct: 216 ELSSGNPATLMMFFKSCE-PKTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAM 268

Query: 132 DTIRSCF 138
             ++ C 
Sbjct: 269 A-LQRCV 274
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query555
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.69
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.53
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.48
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.47
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.38
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.29
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.24
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.13
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.12
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.93
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.8
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.38
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.12
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.0
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.08
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.9
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.1
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 88.37
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 85.35
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.83  E-value=3.5e-21  Score=181.13  Aligned_cols=121  Identities=15%  Similarity=0.202  Sum_probs=103.9

Q ss_pred             CCcEEEEEeCchhhhcccCCc-ceEEcCCCCHHHHHHHHHHHhCCCCcCCchhHHHHHHHHHHHhCCCchHHHHHHHHHh
Q 039821           11 TTSKVVFTTRFIDVCGSMESH-RKFEVACLSEEDAWELFREKVGQETLESDHEIVELAQTVAKECGGLPLALITIGRAMA   89 (555)
Q Consensus        11 ~gsrIivTTR~~~v~~~~~~~-~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPLai~~~~~~L~   89 (555)
                      .|||||||||++.|+..+... ..|+|++|+.+|||+||.+++|...  ..+..++++++|+++|+|+||||+++|+.|+
T Consensus       156 ~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~--~~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~  233 (277)
T d2a5yb3         156 LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP--VGEKEEDVLNKTIELSSGNPATLMMFFKSCE  233 (277)
T ss_dssp             TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTTCC
T ss_pred             cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCcc--CchhhHHHHHHHHHHhCCCHHHHHHHHHHhc
Confidence            589999999999999886654 6899999999999999999998765  3345688999999999999999999999997


Q ss_pred             cCCCHHHHHHHHHHHhhhhhhccCCchhhhhhhhhhccCCChhhHhHHHhHh
Q 039821           90 YRKKAEQWRRAIEELRRSASEFAGLGKEVYPLLKFSYDSLQNDTIRSCFLYC  141 (555)
Q Consensus        90 ~~~~~~~w~~~l~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~k~cfl~~  141 (555)
                      . ++.++|.+..+.+.....      .++..++.+||++||. ++|.||.++
T Consensus       234 ~-k~~~~~~~~~~~L~~~~~------~~v~~il~~sY~~L~~-~lk~c~~~l  277 (277)
T d2a5yb3         234 P-KTFEKMAQLNNKLESRGL------VGVECITPYSYKSLAM-ALQRCVEVL  277 (277)
T ss_dssp             S-SSHHHHHHHHHHHHHHCS------STTCCCSSSSSSSHHH-HHHHHHHTS
T ss_pred             c-CCHHHHHHHHHHHhcCcH------HHHHHHHHHHHhcccH-HHHHHHHhC
Confidence            6 678899998887765322      3799999999999999 999999763
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure