Citrus Sinensis ID: 039822

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-
GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDEEQAGRRENEEDEDERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
cccHHHHHHHHHccHHHHHcccccEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHccccccEEEEEcccHHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccccHHHHHccccccccccHHHHHcccccccccEEcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccEEEEEEcHHHHHHHHHHHHcEEEEEEEcccccccccccccccEEEEEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEccccccccccHHcccccccccEEEccccccccccccccccccccccccEEEEEEcccccccHHHcccccccccHHHHHHHcccccccccEEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccHHHHHccccccccccccccccEEEc
cccHHHHHHHHHccHHHHHHccEEEEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHccHccccccccccHHHHHEcHHcccHHHHHHHHEEEEccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEEEEEccccccccccHHHHccccEEEEEcccccccccHHcccHHccccccEEccccccccccccEEEEEcccccHHcccHHHcccccccEEEEccccccccccccccccccccEEEEEcccccccccccHHHHccHHHccccEccccccccccHHHHHccccccccccEEEEccccccccccHHHHHHHcccccHHHHHHHccccccccEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccEccHHHcccccccccccccccccccEEEEcccHcHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHccccccccccccccccEEEEc
GIGKTTLAQLAYNNDDVKNHFEKRIWVcvsdpfdeFRIARSIIEAltgsapdvAEFQSLMQHIQEFVEGEKFLLVLDDvwnedyckwepfyyclknclygskiLITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYyelpskvkQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQdfaksgdgeivcckMHDLVHDFARyissnecstieihggeesamspfgeKKILHLMLTLYsgalvpisIWDNVKGLRSLLvdcdeyswssevlpqLFDKLTCLRALKLKTLCELYNLQRLDVTYcknleelppgigKLRKLmyldnrwthSLRFLSVGIGELIRLRGVSrfvlgggndracgleSLKKLNLLRACSiyglggvsdggkAAKAELEKKKYLFYLRLRfddlrdgdeeqagrreneedederlldalgpppnlknlairkyrgrrnvvprnwvMSLTNLRALVLKncrncehlpplgklpsledlevcRMESVKRVgheflgvesdtdgssviafpklkhlkfydmeeleewdygtaikgeiiimprlsfleiggcrklkalpdhllqkttlqrldihgcpifeqrcrketganwpmlrhtpdifid
gigkttlaqlaynnddvknHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIAsllrskntekeWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVtycknleelppgigKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGlggvsdggkAAKAELEKKKYLFYLrlrfddlrdgdeeqagrreneedederlldalgpppnlknlairkyrgrrnvvprnwvMSLTNLRALVLKNCRNCEHlpplgklpsledLEVCRMESVKRVGHEFlgvesdtdgssviafpklkhlkfYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQrcrketganwpmlrhtpdifid
GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNileseiweleeveKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGkaakaelekkkylfylrlrfddlrdGDEEQAGrreneedederlldalGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
******LAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGE**AMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDD********************************KNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDI***
GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALT***********LMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGN**EER*NLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIH*********FGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDE**********DEDERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDT*GS*VIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDG*****************LLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
*IGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDEEQAGRRENEEDEDERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVLPQLFDKLTCLRALKLKTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDEEQAGRRENEEDEDERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWPMLRHTPDIFID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query711 2.2.26 [Sep-21-2011]
Q7XA40 992 Putative disease resistan N/A no 0.874 0.627 0.355 1e-93
Q7XA39 988 Putative disease resistan N/A no 0.880 0.633 0.369 8e-93
Q7XA42 979 Putative disease resistan N/A no 0.827 0.600 0.363 3e-92
Q7XBQ9970 Disease resistance protei N/A no 0.846 0.620 0.355 5e-92
Q9LRR4 1054 Putative disease resistan yes no 0.936 0.631 0.3 1e-80
Q9LRR5 1424 Putative disease resistan no no 0.919 0.459 0.309 2e-78
Q38834852 Disease resistance RPP13- no no 0.745 0.622 0.302 2e-56
Q39214926 Disease resistance protei no no 0.935 0.718 0.268 2e-46
Q8W3K3910 Putative disease resistan no no 0.915 0.715 0.267 3e-44
P0DI18 1049 Probable disease resistan no no 0.862 0.584 0.271 2e-41
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function desciption
 Score =  344 bits (883), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 252/708 (35%), Positives = 361/708 (50%), Gaps = 86/708 (12%)

Query: 1   GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLM 60
           G+GKTTLAQ+ +N+  +  HF  +IWVCVSD FDE R+ ++I+E++ G +    +   L 
Sbjct: 185 GLGKTTLAQMVFNDQRITEHFNLKIWVCVSDDFDEKRLIKAIVESIEGKSLGDMDLAPLQ 244

Query: 61  QHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTD 120
           + +QE + G+++ LVLDDVWNED  KW+     LK    G+ ILITTR E +  IMG+  
Sbjct: 245 KKLQELLNGKRYFLVLDDVWNEDQEKWDNLRAVLKIGASGASILITTRLEKIGSIMGTLQ 304

Query: 121 VISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLRSK 180
           +  ++ LS+ +CW +F+  AF  +  E    L +IG+EI++KC G+PLAAKT+  LLR K
Sbjct: 305 LYQLSNLSQEDCWLLFKQRAF-CHQTETSPKLMEIGKEIVKKCGGVPLAAKTLGGLLRFK 363

Query: 181 NTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYDL 240
             E EW+++ +SEIW L + E  +L  L LSY+ LP  ++QCFAYCAVFPKD +I K  L
Sbjct: 364 REESEWEHVRDSEIWNLPQDENSVLPALRLSYHHLPLDLRQCFAYCAVFPKDTKIEKEYL 423

Query: 241 IELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDF-AKSGDGEIVCCKMHDLVHDF- 298
           I LWMA  +   KG  E++D+G + +N L  RSFFQ+   KSG       KMHDL+HD  
Sbjct: 424 IALWMAHSFLLSKGNMELEDVGNEVWNELYLRSFFQEIEVKSGKTYF---KMHDLIHDLA 480

Query: 299 ----ARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRS 354
               +   SS     I +   E+        K ++ +  +    +  P S++     LR 
Sbjct: 481 TSMFSASASSRSIRQINVKDDEDMMFIVTNYKDMMSIGFSEVVSSYSP-SLFKRFVSLRV 539

Query: 355 LLVDCDEYSWSSEVLPQLFDKLTCLRALKL---------KTLCELYNLQRLDVTYCKNLE 405
           L +   E+    E LP     L  LR L L         K LC+L NLQ LD+  C++L 
Sbjct: 540 LNLSNSEF----EQLPSSVGDLVHLRYLDLSGNKICSLPKRLCKLQNLQTLDLYNCQSLS 595

Query: 406 ELPPGIGKLRKL--MYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLK 463
            LP    KL  L  + LD+     L  +   IG L  L+ +  FV+  G  +   L  L+
Sbjct: 596 CLPKQTSKLCSLRNLVLDH---CPLTSMPPRIGLLTCLKTLGYFVV--GERKGYQLGELR 650

Query: 464 KLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDEEQAGRRENEEDE 523
            LNL  A SI  L  V +  +A +A L  K  L  L + +D           R    E E
Sbjct: 651 NLNLRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWD-----------RPNRYESE 699

Query: 524 DERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMS--LTNLRALVLKNCRNCEHLPPLG 581
           + ++L+AL P PNLK L I  + G    +P +W+    L N+ ++++  C NC  LPP G
Sbjct: 700 EVKVLEALKPHPNLKYLEIIDFCGF--CLP-DWMNHSVLKNVVSILISGCENCSCLPPFG 756

Query: 582 KLPSLEDLEVCRMESVKRVGHEFLGVESDTDGSSVIAFPKLKHLKFYDMEELEEWDYGTA 641
           +LP LE LE+                    DGS              ++E +E+  + T 
Sbjct: 757 ELPCLESLEL-------------------QDGS-------------VEVEYVEDSGFLTR 784

Query: 642 IKGEIIIMPRLSFLEIGGCRKLKALP--DHLLQKTTLQRLDIHGCPIF 687
            +      P L  L IGG   LK L       Q   L+ + I  CP+F
Sbjct: 785 RR-----FPSLRKLHIGGFCNLKGLQRMKGAEQFPVLEEMKISDCPMF 827
Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q38834|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2 Back     alignment and function description
>sp|Q39214|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1 Back     alignment and function description
>sp|Q8W3K3|DRL8_ARATH Putative disease resistance protein At1g58400 OS=Arabidopsis thaliana GN=At1g58400 PE=3 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query711
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.962 0.710 0.462 1e-165
224114824 941 cc-nbs-lrr resistance protein [Populus t 0.962 0.726 0.435 1e-156
224115686 938 cc-nbs-lrr resistance protein [Populus t 0.939 0.712 0.437 1e-154
359482769 904 PREDICTED: putative disease resistance p 0.952 0.748 0.423 1e-153
359482784 919 PREDICTED: putative disease resistance p 0.947 0.733 0.426 1e-152
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.957 0.720 0.428 1e-150
359482792 922 PREDICTED: putative disease resistance p 0.946 0.729 0.425 1e-150
359482790 923 PREDICTED: putative disease resistance p 0.949 0.731 0.423 1e-149
224134406 987 cc-nbs-lrr resistance protein [Populus t 0.970 0.699 0.430 1e-149
255549784786 leucine-rich repeat containing protein, 0.976 0.882 0.430 1e-148
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  589 bits (1519), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 350/756 (46%), Positives = 463/756 (61%), Gaps = 72/756 (9%)

Query: 1   GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLM 60
           GIGKTTLAQL YN+ +V+ HF+KRIWVCVSDPFDE +IA++I+EAL GSA D+ E Q+L+
Sbjct: 206 GIGKTTLAQLVYNDHEVEIHFDKRIWVCVSDPFDETKIAKAILEALKGSASDLIELQTLL 265

Query: 61  QHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGS-- 118
           ++IQ  + G+KFLLVLDDVWNED  KWE   Y L   L GS IL+TTRK  VA  MGS  
Sbjct: 266 ENIQPLIRGKKFLLVLDDVWNEDSTKWEQLKYSLMCGLPGSSILVTTRKRNVASRMGSSP 325

Query: 119 TDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLR 178
           TD++ + +LS  ECWS+F  LAFF  +  ER +LE IGR+I  KCKGLPLAAK++ SLLR
Sbjct: 326 TDILELGLLSTDECWSLFSRLAFFEKNSRERGDLEDIGRQIAAKCKGLPLAAKSLGSLLR 385

Query: 179 SKNTEKEWKNILESEIWE-LEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILK 237
            K+  +EW+++L S +WE  EE E  +LAPL LSYY+LPS +++CF+YCAVFPKD    +
Sbjct: 386 FKSRIEEWESVLNSHVWESAEEAESKILAPLWLSYYDLPSDMRRCFSYCAVFPKDFTFER 445

Query: 238 YDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAK-SGDGEIVCCKMHDLVH 296
             L++LWMAQG+  E   KEM+ IG + F  LA+RSFFQDF K +GDG I  CKMHD+VH
Sbjct: 446 DTLVKLWMAQGFLRETHNKEMEVIGRQCFEALAARSFFQDFQKETGDGSIYACKMHDMVH 505

Query: 297 DFARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLL 356
           D A+ ++ NECS+++I G  E  +  F      H M+   +    P +I  ++K LRSL+
Sbjct: 506 DLAQNLTKNECSSVDIDGPTELKIDSFS-INARHSMVVFRNYNSFPATI-HSLKKLRSLI 563

Query: 357 VDCDEYSWSSEVLPQLFDKLTCLRALKL-------------------------------- 384
           VD D  S ++  LP L   L+CLR LKL                                
Sbjct: 564 VDGDPSSMNA-ALPNLIANLSCLRTLKLSGCGIEEVPSNIGKLIHLRHVDFSWNENIKEL 622

Query: 385 -KTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSV-GIGELIRLR 442
            + + ELYN+  LDV++C  LE LP  IG+L KL +L       L F+ + G+  L  LR
Sbjct: 623 PEEMFELYNMLTLDVSFCNKLERLPDNIGRLAKLRHLSIHDWRDLSFVKMRGVKGLTSLR 682

Query: 443 GVSRFVLGGGNDRACGLESLKKLNLLR-ACSIYGLGGVSDGGKAAKAELEKKKYLFYLRL 501
            +  F +  G+D+   +  L+ LN L+ +  I  LG V D  +  KAEL  KK+L +L L
Sbjct: 683 ELDDFHV-SGSDKESNIGDLRNLNHLQGSLMISWLGDVKDPDEVKKAELNSKKHLAHLGL 741

Query: 502 RFDDLRDGDEEQAGRRENEEDEDERLLDALGPPPNLKNLAIRKYRGRRNVVPRNWVMSLT 561
            F            R + E+  D+ +L+AL PPPN+ +  I  Y+G   ++ R +   + 
Sbjct: 742 NFQ----------SRTDREKIHDDEVLEALEPPPNIYSSRIGYYQGV--ILLRVFPGWIN 789

Query: 562 NLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVESDTD--------- 612
            LRA+ L++ R  E+LPPLGKLPSLE L V  ME V RVG EFLG+  D+D         
Sbjct: 790 KLRAVELRDWRKIENLPPLGKLPSLEALHVIGMECVGRVGREFLGLGDDSDISIGEMTSS 849

Query: 613 -GSSVIAFPKLKHLKFYDMEELEEW-------DYGTAIKGEIIIMPRLSFLEIGGCRKLK 664
             +++IAFPKLK L F+DMEE EEW       +  T I    IIMP L  LEI  C KLK
Sbjct: 850 SSNTIIAFPKLKSLSFWDMEEWEEWEGGEGGNEDKTNISISTIIMPSLRSLEIWDCPKLK 909

Query: 665 ALPDHLLQKTTLQRLDIHGCPIFEQRCRKETGANWP 700
           ALPD++LQ TTL++L I G PI  ++  KE G  WP
Sbjct: 910 ALPDYVLQSTTLEQLKIRGSPILGEQYLKEGGKGWP 945

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224114824|ref|XP_002332291.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832453|gb|EEE70930.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115686|ref|XP_002332117.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874937|gb|EEF12068.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482769|ref|XP_003632834.1| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482784|ref|XP_002269044.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482792|ref|XP_002268589.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482790|ref|XP_002268671.2| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134406|ref|XP_002321815.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222868811|gb|EEF05942.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255549784|ref|XP_002515943.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544848|gb|EEF46363.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query711
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.652 0.325 0.306 1.3e-66
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.600 0.405 0.324 4.9e-66
UNIPROTKB|O48647 1802 O48647 "XA1" [Oryza sativa (ta 0.445 0.175 0.333 4.1e-51
TAIR|locus:2077572926 RPM1 "RESISTANCE TO P. SYRINGA 0.609 0.467 0.301 7.5e-47
TAIR|locus:2078012852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.648 0.541 0.298 1e-45
TAIR|locus:2176486908 RPP8 "RECOGNITION OF PERONOSPO 0.609 0.476 0.291 2.7e-41
TAIR|locus:2169523901 AT5G35450 [Arabidopsis thalian 0.526 0.415 0.298 1.1e-40
TAIR|locus:2037623899 AT1G58410 [Arabidopsis thalian 0.652 0.516 0.288 9.6e-40
TAIR|locus:504956182 1049 AT1G58848 [Arabidopsis thalian 0.576 0.390 0.277 1.5e-39
TAIR|locus:2826978 1049 AT1G59218 [Arabidopsis thalian 0.576 0.390 0.277 1.5e-39
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 547 (197.6 bits), Expect = 1.3e-66, Sum P(2) = 1.3e-66
 Identities = 153/500 (30%), Positives = 245/500 (49%)

Query:     1 GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVAEFQSLM 60
             G+GKTTL ++ +N+  V  HFE ++W+     F+ F + +++++ +T SA +  +  SL 
Sbjct:   203 GVGKTTLTEIVFNDYRVTEHFEVKMWISAGINFNVFTVTKAVLQDITSSAVNTEDLPSLQ 262

Query:    61 QHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGSTD 120
               +++ + G++FLLVLDD W+E   +WE F     +   GSKI++TTR E V+ +  +  
Sbjct:   263 IQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTVAKAEK 322

Query:   121 VISVNVLSEMECWSVFESLAFFGNSMEE-RENLEKIGREIIRKCKGLPLAAKTIASLLRS 179
             +  + +++  ECW +    AF   S+    + LE IG+ I  +CKGLPLAA+ IAS LRS
Sbjct:   323 IYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKRIAEQCKGLPLAARAIASHLRS 382

Query:   180 KNTEKEWKNXXXXXXXXXXXXXKGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEILKYD 239
             K    +W                 +L  L LSY  LP ++K+CFA C++FPK H   + +
Sbjct:   383 KPNPDDW----YAVSKNFSSYTNSILPVLKLSYDSLPPQLKRCFALCSIFPKGHVFDREE 438

Query:   240 LIELWMAQGY-FSEKGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDF 298
             L+ LWMA    +  +  + ++DIG  Y   L ++SFFQ      D  +    MHDL++D 
Sbjct:   439 LVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRL----DITMTSFVMHDLMNDL 494

Query:   299 ARYISSNECSTIEIHGGEESAMSPFGEKKILHLMLTLYS-GALVPISIWDNVKGLRSLL- 356
             A+ +S + C  +E    +++   P       H   +     A V        + LR++L 
Sbjct:   495 AKAVSGDFCFRLE----DDNI--PEIPSTTRHFSFSRSQCDASVAFRSICGAEFLRTILP 548

Query:   357 ----VDCDEYSWSSEVLPQLFDKLTCLRALKL---------KTLCELYNLQRLDVTYCKN 403
                    +    + +VL  L + L+ LR L L         K+L  L  L+ LD++  K 
Sbjct:   549 FNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLDLSSTK- 607

Query:   404 LEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGNDRACGLESLK 463
             ++ELP  +  L  L  L       L  L   I ELI LR +       G         +K
Sbjct:   608 IKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLV----GTPLVEMPPGIK 663

Query:   464 KLNLLRACSIYGLGGVSDGG 483
             KL  L+  S + +G +S  G
Sbjct:   664 KLRSLQKLSNFVIGRLSGAG 683
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2826978 AT1G59218 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 5e-67
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  221 bits (566), Expect = 5e-67
 Identities = 99/254 (38%), Positives = 145/254 (57%), Gaps = 8/254 (3%)

Query: 1   GIGKTTLAQLAYNNDDVKNHFEKRIWVCVSDPFDEFRIARSIIEAL--TGSAPDVAEFQS 58
           G+GKTTLA+  YN+D V  HF+   WV VS  + EFR+ + I++ L    S         
Sbjct: 29  GVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESE 88

Query: 59  LMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGS 118
           L   I+E +  ++FLLVLDDVW ++   W+       +   GS++++TTR E+VA  MG 
Sbjct: 89  LAVKIKEALLRKRFLLVLDDVWEKN--DWDKIGVPFPDGENGSRVIVTTRSESVAGRMGG 146

Query: 119 T-DVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLL 177
           T     V  L   E W +F +  F          LE++ +EI+ KCKGLPLA K +  LL
Sbjct: 147 TSKPHEVESLEPEESWELFSNKVFEKEL-PPCPELEEVAKEIVEKCKGLPLALKVLGGLL 205

Query: 178 RSKNTEKEWKNILESEIWELEEVE--KGLLAPLMLSYYELPSKVKQCFAYCAVFPKDHEI 235
             K+T +EW+++LE    EL   +    +L+ L LSY  LP  +K+CF Y A+FP+D+ I
Sbjct: 206 AFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSYDNLPMHLKRCFLYLALFPEDYNI 265

Query: 236 LKYDLIELWMAQGY 249
            K  LI+LW+A+G+
Sbjct: 266 RKEQLIKLWIAEGF 279

Length = 285
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 711
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.87
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.79
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.75
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.72
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.72
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.6
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.55
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.51
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.35
KOG0617264 consensus Ras suppressor protein (contains leucine 99.27
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.26
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.22
KOG0617264 consensus Ras suppressor protein (contains leucine 99.16
KOG4237498 consensus Extracellular matrix protein slit, conta 99.14
PRK04841 903 transcriptional regulator MalT; Provisional 99.1
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.08
KOG4341483 consensus F-box protein containing LRR [General fu 99.05
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.03
KOG4237498 consensus Extracellular matrix protein slit, conta 98.99
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
KOG4341483 consensus F-box protein containing LRR [General fu 98.8
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.75
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.66
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.65
PF05729166 NACHT: NACHT domain 98.6
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.46
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.45
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.42
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.37
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.35
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.32
COG3903414 Predicted ATPase [General function prediction only 98.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.24
PRK06893229 DNA replication initiation factor; Validated 98.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.16
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.1
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.07
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.05
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.04
PF13173128 AAA_14: AAA domain 98.0
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.99
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.97
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.92
PRK15386 426 type III secretion protein GogB; Provisional 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.73
PRK15386 426 type III secretion protein GogB; Provisional 97.69
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.65
PTZ001121164 origin recognition complex 1 protein; Provisional 97.62
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.56
PRK13342413 recombination factor protein RarA; Reviewed 97.52
cd01128249 rho_factor Transcription termination factor rho is 97.51
PRK05564313 DNA polymerase III subunit delta'; Validated 97.5
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 97.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.48
PRK08727233 hypothetical protein; Validated 97.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.44
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.41
PLN03150623 hypothetical protein; Provisional 97.41
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.39
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.39
PRK09087226 hypothetical protein; Validated 97.38
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.38
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 97.37
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 97.34
PRK08084235 DNA replication initiation factor; Provisional 97.3
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 97.3
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.28
PRK12402337 replication factor C small subunit 2; Reviewed 97.28
PRK09376416 rho transcription termination factor Rho; Provisio 97.27
PRK05642234 DNA replication initiation factor; Validated 97.27
PLN03150623 hypothetical protein; Provisional 97.25
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 97.24
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.21
PRK07940394 DNA polymerase III subunit delta'; Validated 97.2
PRK14087450 dnaA chromosomal replication initiation protein; P 97.19
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.15
COG3899849 Predicted ATPase [General function prediction only 97.1
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 97.1
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.08
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.01
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 96.99
PRK07471365 DNA polymerase III subunit delta'; Validated 96.98
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 96.98
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.97
PRK05707328 DNA polymerase III subunit delta'; Validated 96.96
COG0593408 DnaA ATPase involved in DNA replication initiation 96.95
PRK04195482 replication factor C large subunit; Provisional 96.95
PLN03025319 replication factor C subunit; Provisional 96.95
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.93
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.87
PF14516331 AAA_35: AAA-like domain 96.85
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 96.84
PRK09112351 DNA polymerase III subunit delta'; Validated 96.84
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.84
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.83
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.83
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 96.83
PRK12422445 chromosomal replication initiation protein; Provis 96.79
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.77
TIGR00767415 rho transcription termination factor Rho. Members 96.75
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 96.74
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.74
PRK00440319 rfc replication factor C small subunit; Reviewed 96.73
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.72
PRK13341725 recombination factor protein RarA/unknown domain f 96.71
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.68
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.67
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.64
PRK08116268 hypothetical protein; Validated 96.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.6
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.58
PRK14088440 dnaA chromosomal replication initiation protein; P 96.56
KOG2028554 consensus ATPase related to the helicase subunit o 96.54
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 96.52
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 96.52
CHL00181287 cbbX CbbX; Provisional 96.51
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.5
PRK06620214 hypothetical protein; Validated 96.49
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 96.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.45
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 96.4
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.4
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 96.38
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 96.3
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 96.27
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 96.25
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.24
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 96.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.22
PRK14086617 dnaA chromosomal replication initiation protein; P 96.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.2
PRK00149450 dnaA chromosomal replication initiation protein; R 96.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.19
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.16
smart00382148 AAA ATPases associated with a variety of cellular 96.13
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 96.1
PRK04132846 replication factor C small subunit; Provisional 96.07
PRK08769319 DNA polymerase III subunit delta'; Validated 96.05
PF00004132 AAA: ATPase family associated with various cellula 95.97
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 95.92
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.89
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.81
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.78
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.77
PRK06871325 DNA polymerase III subunit delta'; Validated 95.73
KOG2543438 consensus Origin recognition complex, subunit 5 [R 95.64
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 95.62
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.59
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 95.52
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.45
PRK07399314 DNA polymerase III subunit delta'; Validated 95.44
PRK06090319 DNA polymerase III subunit delta'; Validated 95.43
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.37
PRK08058329 DNA polymerase III subunit delta'; Validated 95.36
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.32
PRK06964342 DNA polymerase III subunit delta'; Validated 95.28
PHA02544316 44 clamp loader, small subunit; Provisional 95.22
PRK07993334 DNA polymerase III subunit delta'; Validated 95.11
PRK08181269 transposase; Validated 95.08
PRK06921266 hypothetical protein; Provisional 95.07
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.06
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 94.98
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 94.95
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 94.94
PRK07952244 DNA replication protein DnaC; Validated 94.91
PRK12608380 transcription termination factor Rho; Provisional 94.82
PRK12377248 putative replication protein; Provisional 94.82
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.75
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.74
PRK08939306 primosomal protein DnaI; Reviewed 94.73
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.71
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 94.63
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 94.56
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.5
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.35
PRK04296190 thymidine kinase; Provisional 94.22
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.02
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.97
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 93.93
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.87
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.8
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.68
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.68
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 93.68
PRK09183259 transposase/IS protein; Provisional 93.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.61
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 93.59
PRK03992389 proteasome-activating nucleotidase; Provisional 93.53
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.49
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 93.45
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.19
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.16
PRK10536262 hypothetical protein; Provisional 93.13
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 93.08
PRK08699325 DNA polymerase III subunit delta'; Validated 92.92
PRK10865857 protein disaggregation chaperone; Provisional 92.86
cd01394218 radB RadB. The archaeal protein radB shares simila 92.85
PTZ00202550 tuzin; Provisional 92.7
PRK06526254 transposase; Provisional 92.67
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 92.67
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 92.55
cd01393226 recA_like RecA is a bacterial enzyme which has rol 92.39
PRK05541176 adenylylsulfate kinase; Provisional 92.35
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.33
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.25
PRK06835329 DNA replication protein DnaC; Validated 92.21
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 92.19
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 92.13
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 91.94
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 91.91
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 91.86
PRK08118167 topology modulation protein; Reviewed 91.81
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.63
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 91.59
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 91.56
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 91.55
KOG1514767 consensus Origin recognition complex, subunit 1, a 91.55
CHL00095821 clpC Clp protease ATP binding subunit 91.42
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 91.35
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 91.04
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 90.84
PLN03186342 DNA repair protein RAD51 homolog; Provisional 90.64
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 90.63
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 90.56
cd00983325 recA RecA is a bacterial enzyme which has roles in 90.47
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 90.42
PRK07132299 DNA polymerase III subunit delta'; Validated 90.39
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 89.76
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 89.73
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.66
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 89.44
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 89.36
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 89.28
COG2255332 RuvB Holliday junction resolvasome, helicase subun 89.1
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.05
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 88.97
PRK04301317 radA DNA repair and recombination protein RadA; Va 88.79
CHL00176638 ftsH cell division protein; Validated 88.78
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 88.72
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 88.71
TIGR02012321 tigrfam_recA protein RecA. This model describes or 88.66
CHL00095821 clpC Clp protease ATP binding subunit 88.5
PRK09354349 recA recombinase A; Provisional 88.39
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 88.29
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 88.27
PRK07261171 topology modulation protein; Provisional 88.19
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 88.17
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 87.82
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 87.74
smart0037026 LRR Leucine-rich repeats, outliers. 87.67
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.67
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 87.52
TIGR02236310 recomb_radA DNA repair and recombination protein R 87.49
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 87.36
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 87.32
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 87.29
PRK06067234 flagellar accessory protein FlaH; Validated 87.15
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 86.84
PRK07276290 DNA polymerase III subunit delta'; Validated 86.75
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 86.69
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 86.47
PTZ00035337 Rad51 protein; Provisional 86.38
PHA00729226 NTP-binding motif containing protein 86.32
COG1484254 DnaC DNA replication protein [DNA replication, rec 86.3
cd03216163 ABC_Carb_Monos_I This family represents the domain 86.28
CHL00195489 ycf46 Ycf46; Provisional 86.01
PF00154322 RecA: recA bacterial DNA recombination protein; In 85.96
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 85.95
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 85.81
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.65
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.64
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 85.52
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 85.38
cd03246173 ABCC_Protease_Secretion This family represents the 84.94
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 84.7
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 84.53
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 84.43
TIGR00763775 lon ATP-dependent protease La. This protein is ind 84.38
KOG2228408 consensus Origin recognition complex, subunit 4 [R 84.24
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 83.86
smart0037026 LRR Leucine-rich repeats, outliers. 83.77
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.77
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 83.66
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 83.55
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 83.27
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 83.21
cd03115173 SRP The signal recognition particle (SRP) mediates 83.09
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 83.04
PF07726131 AAA_3: ATPase family associated with various cellu 82.91
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 82.67
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 82.65
PRK08233182 hypothetical protein; Provisional 82.54
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 82.52
PRK13695174 putative NTPase; Provisional 82.33
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 82.29
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 82.28
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 82.17
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 81.94
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 81.93
CHL00060494 atpB ATP synthase CF1 beta subunit 81.92
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 81.68
PRK08972444 fliI flagellum-specific ATP synthase; Validated 81.64
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 81.4
PRK09280463 F0F1 ATP synthase subunit beta; Validated 81.36
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 81.21
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 81.13
PRK09519790 recA DNA recombination protein RecA; Reviewed 81.1
PTZ00185574 ATPase alpha subunit; Provisional 80.79
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 80.76
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 80.75
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 80.63
COG2842297 Uncharacterized ATPase, putative transposase [Gene 80.61
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 80.58
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 80.1
PRK12678672 transcription termination factor Rho; Provisional 80.08
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-70  Score=613.28  Aligned_cols=635  Identities=30%  Similarity=0.435  Sum_probs=476.6

Q ss_pred             CccHHHHHHHHhcChh-hhccCCceEEEEeCCCCCHHHHHHHHHHHhcCCCCChh--hHHHHHHHHHHHcCCceEEEEEe
Q 039822            1 GIGKTTLAQLAYNNDD-VKNHFEKRIWVCVSDPFDEFRIARSIIEALTGSAPDVA--EFQSLMQHIQEFVEGEKFLLVLD   77 (711)
Q Consensus         1 GiGKTtla~~~~~~~~-~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l~~~~~~~~--~~~~~~~~~~~~l~~~r~LlvlD   77 (711)
                      |+||||||++++++.. +..+|+.++||.+|+.++...++..|++.++.......  ..++....+.+.|+++||+||+|
T Consensus       189 GvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllvLD  268 (889)
T KOG4658|consen  189 GVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLVLD  268 (889)
T ss_pred             cccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEEEe
Confidence            8999999999999977 99999999999999999999999999999976544322  23688889999999999999999


Q ss_pred             CCCCCCccCchhhHhhhccCCCCCEEEEEecchhhhhh-hCCcCeEECCCCChhhHHHHHHHHhcCCCCcchhhhHHHHH
Q 039822           78 DVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACI-MGSTDVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIG  156 (711)
Q Consensus        78 dv~~~~~~~~~~~~~~l~~~~~~s~iivTtR~~~~~~~-~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~~~~~~~~~~  156 (711)
                      |||+..  +|+.+..++|....||||++|||++.|+.. +++...++++.|+.+|||.||.+.+|.... ..++.+.++|
T Consensus       269 DIW~~~--dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~-~~~~~i~~la  345 (889)
T KOG4658|consen  269 DIWEEV--DWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTL-GSHPDIEELA  345 (889)
T ss_pred             cccccc--cHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccc-cccccHHHHH
Confidence            999975  699999999988889999999999999988 788899999999999999999999987644 3345589999


Q ss_pred             HHHHHhcCCChHHHHHHHHHhcCCCCHHHHHHHHHhhhhh----hhhhcccchhhHHhhhhcCChhhhhHhhhhcCCCCC
Q 039822          157 REIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWE----LEEVEKGLLAPLMLSYYELPSKVKQCFAYCAVFPKD  232 (711)
Q Consensus       157 ~~i~~~~~g~Plai~~~a~~l~~~~~~~~w~~~l~~~~~~----~~~~~~~i~~~l~~sy~~L~~~~~~~~~~~~~f~~~  232 (711)
                      ++++++|+|+|||+.++|+.|+.+.+..+|+++.+...+.    ..+..+.++.+++.||+.|+++.|.||+|||.||+|
T Consensus       346 k~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED  425 (889)
T KOG4658|consen  346 KEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPED  425 (889)
T ss_pred             HHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcc
Confidence            9999999999999999999999999999999999865444    233457899999999999998899999999999999


Q ss_pred             cccCHHHHHHHHHHcCCccc-CCCchHHHHHHHHHHHHHhcccccccccCCCccEEEEEechHHHHHHHHhhc-----cc
Q 039822          233 HEILKYDLIELWMAQGYFSE-KGYKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHDLVHDFARYISS-----NE  306 (711)
Q Consensus       233 ~~i~~~~l~~~w~~~g~~~~-~~~~~~~~~~~~~l~~L~~~sLl~~~~~~~~~~~~~~~mh~li~~~~~~~~~-----~~  306 (711)
                      +.|+++.|+.+|+||||+.+ ..+..+++.++.++.+|++++|++.....  ++...|+|||++|++|.+++.     ++
T Consensus       426 ~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~~~e  503 (889)
T KOG4658|consen  426 YEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGKQEE  503 (889)
T ss_pred             cccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhcccccccc
Confidence            99999999999999999999 44678999999999999999999865443  566789999999999999998     56


Q ss_pred             ceeeecc-CCccccCCCCCCCcEEEEEEEecCCCcccccccccCCcccEEEeccCCCCcccccc-chhhhccCccCCcCc
Q 039822          307 CSTIEIH-GGEESAMSPFGEKKILHLMLTLYSGALVPISIWDNVKGLRSLLVDCDEYSWSSEVL-PQLFDKLTCLRALKL  384 (711)
Q Consensus       307 ~~~~~~~-~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~l-p~~~~~l~~L~~L~l  384 (711)
                      ++++..+ +....+....| ..+|++++.++.+..++...  .+++|++|.+..|..  .+..+ +..|..|+.|++|||
T Consensus       504 ~~iv~~~~~~~~~~~~~~~-~~~rr~s~~~~~~~~~~~~~--~~~~L~tLll~~n~~--~l~~is~~ff~~m~~LrVLDL  578 (889)
T KOG4658|consen  504 NQIVSDGVGLSEIPQVKSW-NSVRRMSLMNNKIEHIAGSS--ENPKLRTLLLQRNSD--WLLEISGEFFRSLPLLRVLDL  578 (889)
T ss_pred             ceEEECCcCccccccccch-hheeEEEEeccchhhccCCC--CCCccceEEEeecch--hhhhcCHHHHhhCcceEEEEC
Confidence            6555543 33334433444 58999999999999888776  678999999998742  12233 445778888888888


Q ss_pred             ----------cccccccCCcEEecCCCCCCccCCccccCCccCceeccCCCCccccccccCCCccccCccCeeEecccCC
Q 039822          385 ----------KTLCELYNLQRLDVTYCKNLEELPPGIGKLRKLMYLDNRWTHSLRFLSVGIGELIRLRGVSRFVLGGGND  454 (711)
Q Consensus       385 ----------~~i~~L~~L~~L~l~~~~~l~~lP~~i~~L~~L~~L~l~~~~~l~~lp~~i~~l~~L~~L~~~~~~~~~~  454 (711)
                                ++|++|.+|+||+++++. +..+|.++++|.+|.+|++.++..+..+|..+..|++|++|.++... ...
T Consensus       579 s~~~~l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~-~~~  656 (889)
T KOG4658|consen  579 SGNSSLSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSA-LSN  656 (889)
T ss_pred             CCCCccCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeeccc-ccc
Confidence                      457778888888888765 88888888888888888888877666665555668888888776554 222


Q ss_pred             CCcCcchhhcCccCCCeeecCcCCCCChhhhhHhhhcCCCCCceEEEEeecCCCCCcccccCCCCchhhHHHHhhccCCC
Q 039822          455 RACGLESLKKLNLLRACSIYGLGGVSDGGKAAKAELEKKKYLFYLRLRFDDLRDGDEEQAGRRENEEDEDERLLDALGPP  534 (711)
Q Consensus       455 ~~~~~~~L~~l~~L~~L~i~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  534 (711)
                      ....+.++..+.+|+.+.+.....      .....+..+..|..+......              ...........+..+
T Consensus       657 ~~~~l~el~~Le~L~~ls~~~~s~------~~~e~l~~~~~L~~~~~~l~~--------------~~~~~~~~~~~~~~l  716 (889)
T KOG4658|consen  657 DKLLLKELENLEHLENLSITISSV------LLLEDLLGMTRLRSLLQSLSI--------------EGCSKRTLISSLGSL  716 (889)
T ss_pred             chhhHHhhhcccchhhheeecchh------HhHhhhhhhHHHHHHhHhhhh--------------cccccceeecccccc
Confidence            345566666677676666643211      111122222222221111000              000112234566778


Q ss_pred             CCccEEEEeccCCCCCCcCcchhh-----c-CcCccEEeEeCCCCCCCCCCCCCCCCCCeeeecccccceEeccccccCC
Q 039822          535 PNLKNLAIRKYRGRRNVVPRNWVM-----S-LTNLRALVLKNCRNCEHLPPLGKLPSLEDLEVCRMESVKRVGHEFLGVE  608 (711)
Q Consensus       535 ~~L~~L~L~~~~~~~~~~~~~~~~-----~-l~~L~~L~l~~~~~l~~l~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~  608 (711)
                      .+|+.|.+.+|...+..  ..|..     . ++++.++.+.+|.....+.+.-..|+|+.|.+..|..++.+-...-...
T Consensus       717 ~~L~~L~i~~~~~~e~~--~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~~e~~i~~~k~~~  794 (889)
T KOG4658|consen  717 GNLEELSILDCGISEIV--IEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRLLEDIIPKLKALL  794 (889)
T ss_pred             cCcceEEEEcCCCchhh--cccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccccccCCCHHHHhh
Confidence            89999999998886521  22321     2 6677777888887777777777788999999999887766543221111


Q ss_pred             CCCCCCcccCCCcccee-ecccCcccccccccCccccccccCCcccEEeecCCCCCcCCCcCCCCCCCccEEEEecC
Q 039822          609 SDTDGSSVIAFPKLKHL-KFYDMEELEEWDYGTAIKGEIIIMPRLSFLEIGGCRKLKALPDHLLQKTTLQRLDIHGC  684 (711)
Q Consensus       609 ~~~~~~~~~~~~~L~~L-~l~~~~~L~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~~~~~~~~L~~l~l~~c  684 (711)
                      .+..  .+..|.++..+ -+.+.++++++...      -..+++|+.+.+..||++..+|       .+.++.+.+|
T Consensus       795 ~l~~--~i~~f~~~~~l~~~~~l~~l~~i~~~------~l~~~~l~~~~ve~~p~l~~~P-------~~~~~~i~~~  856 (889)
T KOG4658|consen  795 ELKE--LILPFNKLEGLRMLCSLGGLPQLYWL------PLSFLKLEELIVEECPKLGKLP-------LLSTLTIVGC  856 (889)
T ss_pred             hccc--EEecccccccceeeecCCCCceeEec------ccCccchhheehhcCcccccCc-------cccccceecc
Confidence            1000  12345556666 35554555444322      1245568888888888887766       3445555665

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 5e-05
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 6e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-04
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 4e-04
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 54/107 (50%), Gaps = 14/107 (13%)
Query: 73  LLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVA-CIMGSTDVISVNVLSEME 131
           LL+LDDVW+          + LK      +IL+TTR ++V   +MG   V+ V   S + 
Sbjct: 239 LLILDDVWDS---------WVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVE--SSLG 287
Query: 132 CWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPLAAKTIASLLR 178
                E L+ F N   ++ +L +    II++CKG PL    I +LLR
Sbjct: 288 KEKGLEILSLFVNM--KKADLPEQAHSIIKECKGSPLVVSLIGALLR 332
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query711
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-96
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-85
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-40
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score =  309 bits (794), Expect = 1e-96
 Identities = 57/329 (17%), Positives = 120/329 (36%), Gaps = 49/329 (14%)

Query: 1   GIGKTTLAQLAYNNDD-VKNHFEKRI-WVCVSDPFDEFRIA--RSIIEALTGSAPDVAEF 56
           G GK+ LA  A  +   ++  F   + WV V        +   +++   L          
Sbjct: 157 GCGKSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRL 216

Query: 57  QSLMQHIQEFV------EGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKE 110
              ++  ++ +      +  + LL+LDDVW+    K         +     +IL+TTR +
Sbjct: 217 PLNIEEAKDRLRILMLRKHPRSLLILDDVWDSWVLKA------FDS---QCQILLTTRDK 267

Query: 111 TVACIMGSTDVISV--NVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLPL 168
           +V   +     +    + L + +   +            ++ +L +    II++CKG PL
Sbjct: 268 SVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN-----MKKADLPEQAHSIIKECKGSPL 322

Query: 169 AAKTIASLLRSKNTE-KEWKNILESEIWELEEVEK-----GLLAPLMLSYYELPSKVKQC 222
               I +LLR      + +   L+++ ++            L   + +S   L   +K  
Sbjct: 323 VVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEAMSISVEMLREDIKDY 382

Query: 223 FAYCAVFPKDHEILKYDLIELWMAQGYFSEKGYKEMKDIGEKYFNILASRSFFQDFAKSG 282
           +   ++  KD ++    L  LW  +            +  E       ++S         
Sbjct: 383 YTDLSILQKDVKVPTKVLCILWDMET-----------EEVEDILQEFVNKSLLF---CDR 428

Query: 283 DGEIVCCKMHDLVHDFARYISSNECSTIE 311
           +G+     +HDL  D   +++   CS ++
Sbjct: 429 NGKSFRYYLHDLQVD---FLTEKNCSQLQ 454
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query711
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.97
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.96
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.88
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.88
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.86
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.85
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.85
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.84
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.84
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.83
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.81
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.81
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.8
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.8
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.8
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.79
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.73
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.71
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.7
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.69
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.65
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.65
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.65
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.63
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.61
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.61
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.6
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.59
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.57
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.56
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.56
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.56
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.55
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.53
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.53
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.51
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.5
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.5
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.47
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.47
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.46
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.46
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.44
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.44
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.44
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.41
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.39
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.35
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.31
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.28
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.26
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.26
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.25
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.25
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.24
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.22
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.14
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.13
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.1
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.09
2fna_A357 Conserved hypothetical protein; structural genomic 99.08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.01
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.0
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.98
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.98
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.97
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.97
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.94
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.94
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.91
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.9
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.9
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.87
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.87
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.85
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.85
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.84
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.76
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.75
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.67
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.6
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.58
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.58
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.38
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.36
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.13
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.01
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 98.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.98
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.86
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.76
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.71
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.67
3bos_A242 Putative DNA replication factor; P-loop containing 97.55
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.52
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 97.49
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.45
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 97.41
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.37
2chq_A319 Replication factor C small subunit; DNA-binding pr 97.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.92
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 96.8
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 96.76
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.75
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.74
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.67
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.66
3pvs_A447 Replication-associated recombination protein A; ma 96.63
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.62
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 96.48
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 96.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.43
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.41
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.37
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.35
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.23
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.06
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.81
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.79
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.76
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.72
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.63
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.63
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.62
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.53
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.15
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.09
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.78
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.56
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 94.45
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 94.44
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.27
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.95
2qgz_A308 Helicase loader, putative primosome component; str 93.35
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 92.86
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 92.66
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.55
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.41
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 92.34
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 92.19
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 92.12
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 92.02
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.83
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 91.69
3co5_A143 Putative two-component system transcriptional RES 91.61
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.43
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.17
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 91.09
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.02
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 90.84
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 90.75
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.71
1xp8_A366 RECA protein, recombinase A; recombination, radior 90.64
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 90.44
3io5_A333 Recombination and repair protein; storage dimer, i 90.2
1ojl_A304 Transcriptional regulatory protein ZRAR; response 89.96
2z43_A324 DNA repair and recombination protein RADA; archaea 89.88
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 89.87
2r62_A268 Cell division protease FTSH homolog; ATPase domain 89.86
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 89.79
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 89.5
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 89.28
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 89.27
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.24
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 88.99
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 88.91
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 88.74
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.72
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.71
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 88.4
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 87.99
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 87.98
1u94_A356 RECA protein, recombinase A; homologous recombinat 87.76
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 87.62
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 86.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 86.26
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 85.54
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 84.78
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 83.91
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 82.84
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 81.87
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 81.73
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 80.97
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=2.5e-39  Score=356.66  Aligned_cols=284  Identities=18%  Similarity=0.279  Sum_probs=224.9

Q ss_pred             CccHHHHHHHHhc--ChhhhccCCceEEEEeCCCC--CHHHHHHHHHHHhcCCCC-------ChhhHHHHHHHHHHHcCC
Q 039822            1 GIGKTTLAQLAYN--NDDVKNHFEKRIWVCVSDPF--DEFRIARSIIEALTGSAP-------DVAEFQSLMQHIQEFVEG   69 (711)
Q Consensus         1 GiGKTtla~~~~~--~~~~~~~F~~~~wv~~~~~~--~~~~~~~~i~~~l~~~~~-------~~~~~~~~~~~~~~~l~~   69 (711)
                      |+||||||+++|+  +.+++.+|++++||+++...  +...+++.|+.++.....       +..+.+.....+++.+++
T Consensus       162 GvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L~~  241 (549)
T 2a5y_B          162 GSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID  241 (549)
T ss_dssp             TSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTT
T ss_pred             CCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHHcC
Confidence            9999999999997  67899999999999999875  799999999999975421       122345678889999999


Q ss_pred             c-eEEEEEeCCCCCCccCchhhHhhhccCCCCCEEEEEecchhhhhhhC-CcCeEECCCCChhhHHHHHHHHhcCCCCcc
Q 039822           70 E-KFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMG-STDVISVNVLSEMECWSVFESLAFFGNSME  147 (711)
Q Consensus        70 ~-r~LlvlDdv~~~~~~~~~~~~~~l~~~~~~s~iivTtR~~~~~~~~~-~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~  147 (711)
                      + ||||||||||+.++..|.       . .+||+||||||++.++..++ ...+|+|++|+.+|||+||.+.++....  
T Consensus       242 ~kr~LlVLDdv~~~~~~~~~-------~-~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~--  311 (549)
T 2a5y_B          242 RPNTLFVFDDVVQEETIRWA-------Q-ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV--  311 (549)
T ss_dssp             STTEEEEEEEECCHHHHHHH-------H-HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---
T ss_pred             CCcEEEEEECCCCchhhccc-------c-cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC--
Confidence            6 999999999985432222       1 16999999999999998876 3468999999999999999999876532  


Q ss_pred             hhhhHHHHHHHHHHhcCCChHHHHHHHHHhcCCCCHHHHHHHHHhhhhhhhhhcccchhhHHhhhhcCChhhhhHhh---
Q 039822          148 ERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFA---  224 (711)
Q Consensus       148 ~~~~~~~~~~~i~~~~~g~Plai~~~a~~l~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~~~~~---  224 (711)
                       ++...+++.+|+++|+|+||||+++|+.++.+. . .|...+....+..  ....+..++.+||+.|+.+.|.||.   
T Consensus       312 -~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~-w-~~~~~l~~~l~~~--~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls  386 (549)
T 2a5y_B          312 -GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-F-EKMAQLNNKLESR--GLVGVECITPYSYKSLAMALQRCVEVLS  386 (549)
T ss_dssp             --CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS-H-HHHHHHHHHHHHH--CSSTTCCCSSSSSSSHHHHHHHHHHTSC
T ss_pred             -chhHHHHHHHHHHHhCCChHHHHHHHHHhccch-H-HHHHHhHHHhhcc--cHHHHHHHHhcccccccHHHHHHHhccc
Confidence             467788999999999999999999999997762 2 3333333322211  2456889999999999999999999   


Q ss_pred             --------hhcCCCCCcccCHHHHHHHHHHc--CCcccCC-CchHHHHHHHHHHHHHhcccccccccCCCccEEEEEech
Q 039822          225 --------YCAVFPKDHEILKYDLIELWMAQ--GYFSEKG-YKEMKDIGEKYFNILASRSFFQDFAKSGDGEIVCCKMHD  293 (711)
Q Consensus       225 --------~~~~f~~~~~i~~~~l~~~w~~~--g~~~~~~-~~~~~~~~~~~l~~L~~~sLl~~~~~~~~~~~~~~~mh~  293 (711)
                              |||+||+++.++    +..|+++  ||+.+.. ....++.++ ++++|+++||++....+   ...+|+|||
T Consensus       387 ~~er~l~~~ls~fp~~~~i~----i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~---~~~~~~mHd  458 (549)
T 2a5y_B          387 DEDRSALAFAVVMPPGVDIP----VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRM---PVLTFKIDH  458 (549)
T ss_dssp             HHHHHHTTGGGSSCTTCCEE----HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECS---SSCEEECCH
T ss_pred             hhhhhHhhheeeeCCCCeee----eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCC---CceEEEeCh
Confidence                    999999999988    7899999  9998766 455667777 99999999999976543   233689999


Q ss_pred             HHHHHHHHhhcccc
Q 039822          294 LVHDFARYISSNEC  307 (711)
Q Consensus       294 li~~~~~~~~~~~~  307 (711)
                      +++++++.++.+++
T Consensus       459 lv~~~a~~~~~~~~  472 (549)
T 2a5y_B          459 IIHMFLKHVVDAQT  472 (549)
T ss_dssp             HHHHHHHTTSCTHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            99999998887654
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 711
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 7e-40
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  146 bits (368), Expect = 7e-40
 Identities = 46/240 (19%), Positives = 74/240 (30%), Gaps = 32/240 (13%)

Query: 1   GIGKTTLAQLAYNNDD--VKNHFEKRIWVCVSDPFDEFRIARSIIEALT----------G 48
           G GK+ +A  A +  D  +  +++  +W+  S    +          L            
Sbjct: 54  GSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFP 113

Query: 49  SAPDVAEFQSLMQHIQEFVEGEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTR 108
           S   V             ++    L V DDV  E+  +W              + L+TTR
Sbjct: 114 SVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQEL--------RLRCLVTTR 165

Query: 109 KETVACIMGST-DVISVNVLSEMECWSVFESLAFFGNSMEERENLEKIGREIIRKCKGLP 167
              ++     T + I V  L   EC+   E+       M   E  E +  + I    G P
Sbjct: 166 DVEISNAASQTCEFIEVTSLEIDECYDFLEAYGM---PMPVGEKEEDVLNKTIELSSGNP 222

Query: 168 LAAKTIASLLRSKNTE--KEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAY 225
                       K  E   +  N LES          G+      SY  L   +++C   
Sbjct: 223 ATLMMFFKSCEPKTFEKMAQLNNKLESRGLV------GVECITPYSYKSLAMALQRCVEV 276

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query711
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.72
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.63
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.6
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.56
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.47
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.42
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.4
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.36
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.29
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.28
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.17
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.1
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.95
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.84
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.8
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.75
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.51
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.3
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.25
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.11
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.96
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.59
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.34
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.31
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.31
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.2
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.96
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 96.94
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.93
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.06
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.95
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 95.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.62
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.6
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.55
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.77
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.69
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.61
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 94.55
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.33
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.3
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.17
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.43
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 92.08
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.39
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.13
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 90.53
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.99
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.15
d1ls1a2207 GTPase domain of the signal sequence recognition p 87.39
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.97
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.54
d1okkd2207 GTPase domain of the signal recognition particle r 84.37
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 82.5
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 82.33
d2qy9a2211 GTPase domain of the signal recognition particle r 81.69
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 81.63
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 81.16
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 81.12
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 80.87
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.97  E-value=6.1e-31  Score=259.80  Aligned_cols=211  Identities=18%  Similarity=0.193  Sum_probs=162.9

Q ss_pred             CccHHHHHHHHhcChh--hhccCCceEEEEeCCCCCHHHHHHHHHHHhc---CCC----C---ChhhHHHHHHHHHHHcC
Q 039822            1 GIGKTTLAQLAYNNDD--VKNHFEKRIWVCVSDPFDEFRIARSIIEALT---GSA----P---DVAEFQSLMQHIQEFVE   68 (711)
Q Consensus         1 GiGKTtla~~~~~~~~--~~~~F~~~~wv~~~~~~~~~~~~~~i~~~l~---~~~----~---~~~~~~~~~~~~~~~l~   68 (711)
                      |+||||||+++|++.+  ...+|++++||+++..++...+...+...+.   ...    +   ...........+.+.+.
T Consensus        54 GiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~  133 (277)
T d2a5yb3          54 GSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALID  133 (277)
T ss_dssp             TSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTT
T ss_pred             CCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhc
Confidence            9999999999997533  6778999999999998887777666655442   111    1   12233444556788899


Q ss_pred             CceEEEEEeCCCCCCccCchhhHhhhccCCCCCEEEEEecchhhhhhhCC-cCeEECCCCChhhHHHHHHHHhcCCCCcc
Q 039822           69 GEKFLLVLDDVWNEDYCKWEPFYYCLKNCLYGSKILITTRKETVACIMGS-TDVISVNVLSEMECWSVFESLAFFGNSME  147 (711)
Q Consensus        69 ~~r~LlvlDdv~~~~~~~~~~~~~~l~~~~~~s~iivTtR~~~~~~~~~~-~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~  147 (711)
                      ++|+|+||||||+...  |..+.      ..|||||||||++.++..+.. .+.|+|++|+.+||++||.+.+|....  
T Consensus       134 ~kr~LlVLDDv~~~~~--~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~--  203 (277)
T d2a5yb3         134 RPNTLFVFDDVVQEET--IRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV--  203 (277)
T ss_dssp             STTEEEEEEEECCHHH--HHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---
T ss_pred             cCCeeEecchhhHHhh--hhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccC--
Confidence            9999999999998643  33221      238999999999999987654 368999999999999999998876543  


Q ss_pred             hhhhHHHHHHHHHHhcCCChHHHHHHHHHhcCCCCHHHHHHHHHhhhhhhhhhcccchhhHHhhhhcCChhhhhHhhhh
Q 039822          148 ERENLEKIGREIIRKCKGLPLAAKTIASLLRSKNTEKEWKNILESEIWELEEVEKGLLAPLMLSYYELPSKVKQCFAYC  226 (711)
Q Consensus       148 ~~~~~~~~~~~i~~~~~g~Plai~~~a~~l~~~~~~~~w~~~l~~~~~~~~~~~~~i~~~l~~sy~~L~~~~~~~~~~~  226 (711)
                       .+...+++++|+++|+|+||||+++|+.++.+ +.+.|.+..+....   ....++..++..||+.||++.|.||.++
T Consensus       204 -~~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k-~~~~~~~~~~~L~~---~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         204 -GEKEEDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLES---RGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             --CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHH---HCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             -chhhHHHHHHHHHHhCCCHHHHHHHHHHhccC-CHHHHHHHHHHHhc---CcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence             24557889999999999999999999999876 47788765554321   2236788999999999999999999764
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure