Citrus Sinensis ID: 039859

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MEPENTCVLSGDGTILSLPSRKPYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI
cccccEEEEEccccEEEccccccccccccccccccccEEEEccccHHHHHHcccccccccccccccccEEEEccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccEEccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccccHHHHHHHHHHccEEEEEEcccccccccccccccccccccc
cccccEEEEEccccEEccccccccccccHHHHccccEEEEcccHHHHHHHEccccccccEEccccccEEEEEEcccccccEEEEHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHcccEEEEEcHHHHHHHHccccccccccHHHHHHHHHHccccEEEEEccccccccccccccEEccHccc
mepentcvlsgdgtilslpsrkpyphkptyetsnagagihgHGIEYFLVTMINLMSKEFqikaypkttavlvpnhvwrAGEVISRQlngltsasadsnKVEKHLSathetagtkgdiKILQSQVEDDlkqgvagavpippsdagkEEVIAALVANVDAMIKADRKITALKQLQGHiwrtgfesnelegevfddVPEALEKWHSlgtkcngvsSLTSTFISLAASYFLSKEIDVYFGLIYRFGLdaiisvqpgngplpesrgfktinsfagi
mepentcvlsgdgtilslpsrkpYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSathetagtkgdiKILQSQVEDDLKQGVAGAvpippsdagKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQpgngplpesrgfktinsfagi
MEPENTCVLSGDGTILSLPSRKPYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI
**********************************AGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQL**********************************************************EEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQ*********************
*EPENTCVLSGDGTILSLPSR**YPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI
**********GDGTILSLPSRKPYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI
****NTCVLSGDGTILSLPSRKPYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPENTCVLSGDGTILSLPSRKPYPHKPTYETSNAGAGIHGHGIEYFLVTMINLMSKEFQIKAYPKTTAVLVPNHVWRAGEVISRQLNGLTSASADSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFISLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query271 2.2.26 [Sep-21-2011]
B9N1F9504 Probable bifunctional met yes no 0.642 0.345 0.532 1e-53
E0CSI1517 Probable bifunctional met yes no 0.642 0.336 0.509 3e-52
B9SQI7527 Probable bifunctional met N/A no 0.642 0.330 0.509 4e-50
B8BKI7518 Probable bifunctional met N/A no 0.642 0.335 0.476 3e-46
Q2R483518 Probable bifunctional met yes no 0.642 0.335 0.476 3e-46
Q9FN41507 Probable bifunctional met yes no 0.634 0.339 0.476 4e-45
E0CTF3531 Probable bifunctional met no no 0.638 0.325 0.469 1e-44
C6JS30517 Probable bifunctional met N/A no 0.642 0.336 0.458 2e-44
B4G0F3517 Probable bifunctional met N/A no 0.642 0.336 0.453 3e-43
A9RBS1505 Probable bifunctional met N/A no 0.612 0.328 0.383 5e-30
>sp|B9N1F9|MTBC_POPTR Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Populus trichocarpa GN=POPTRDRAFT_827604 PE=3 SV=1 Back     alignment and function desciption
 Score =  209 bits (533), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 141/216 (65%), Gaps = 42/216 (19%)

Query: 98  NKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVD 157
           + V +HLSAT++TA TK DI +L++QVEDDL QGV GA+PIP  DAGKEEVIAALVANV+
Sbjct: 289 DNVGRHLSATYDTAETKDDINLLRTQVEDDLAQGVDGAIPIPTDDAGKEEVIAALVANVE 348

Query: 158 AMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSS---- 213
           AMIKADRKITALKQLQGHIWRTG+E+NELEG V+DDVPEALEKWH+LG K    SS    
Sbjct: 349 AMIKADRKITALKQLQGHIWRTGYENNELEGVVYDDVPEALEKWHALGIKVYIYSSGSRL 408

Query: 214 ------------------------------LTSTFISLAASYFLSKEIDVYFGL-IYR-- 240
                                          T ++I ++ S  + K  D+ F   +++  
Sbjct: 409 AQRLIFGKTNYGDLRKYLSGFFDTTVGNKKETRSYIEISESLGVDKPSDILFVTDVFQEA 468

Query: 241 -----FGLDAIISVQPGNGPLPESRGFKTINSFAGI 271
                 GLD +IS++PGN PLPE+ GFKTI SFA I
Sbjct: 469 FAAKGAGLDVMISIRPGNAPLPENHGFKTITSFAEI 504

Populus trichocarpa (taxid: 3694)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 7EC: 7
>sp|E0CSI1|MTBC1_VITVI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1 OS=Vitis vinifera GN=VIT_19s0014g02480 PE=2 SV=2 Back     alignment and function description
>sp|B9SQI7|MTBC_RICCO Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Ricinus communis GN=RCOM_0591060 PE=3 SV=1 Back     alignment and function description
>sp|B8BKI7|MTBC_ORYSI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Oryza sativa subsp. indica GN=OsI_36120 PE=2 SV=1 Back     alignment and function description
>sp|Q2R483|MTBC_ORYSJ Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Oryza sativa subsp. japonica GN=Os11g0484000 PE=2 SV=1 Back     alignment and function description
>sp|Q9FN41|MTBC_ARATH Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Arabidopsis thaliana GN=At5g53850 PE=2 SV=1 Back     alignment and function description
>sp|E0CTF3|MTBC2_VITVI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 2 OS=Vitis vinifera GN=VIT_12s0028g03470 PE=2 SV=2 Back     alignment and function description
>sp|C6JS30|MTBC_SORBI Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Sorghum bicolor GN=SORBIDRAFT_0019s002010 PE=3 SV=1 Back     alignment and function description
>sp|B4G0F3|MTBC_MAIZE Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|A9RBS1|MTBC_PHYPA Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_111231 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
224128103 504 predicted protein [Populus trichocarpa] 0.642 0.345 0.532 7e-52
356544052 522 PREDICTED: probable bifunctional methylt 0.642 0.333 0.523 2e-51
356549714 522 PREDICTED: probable bifunctional methylt 0.642 0.333 0.518 2e-51
388513301 523 unknown [Medicago truncatula] 0.642 0.332 0.523 9e-51
378405187 517 RecName: Full=Probable bifunctional meth 0.642 0.336 0.509 2e-50
225461486 544 PREDICTED: probable bifunctional methylt 0.642 0.319 0.509 2e-50
302142985 507 unnamed protein product [Vitis vinifera] 0.642 0.343 0.509 2e-50
255574694 527 catalytic, putative [Ricinus communis] g 0.642 0.330 0.509 3e-48
449446923 512 PREDICTED: probable bifunctional methylt 0.642 0.339 0.495 4e-46
449528071 398 PREDICTED: probable bifunctional methylt 0.642 0.437 0.495 4e-46
>gi|224128103|ref|XP_002329082.1| predicted protein [Populus trichocarpa] gi|296439678|sp|B9N1F9.1|MTBC_POPTR RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase gi|222869751|gb|EEF06882.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 141/216 (65%), Gaps = 42/216 (19%)

Query: 98  NKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVD 157
           + V +HLSAT++TA TK DI +L++QVEDDL QGV GA+PIP  DAGKEEVIAALVANV+
Sbjct: 289 DNVGRHLSATYDTAETKDDINLLRTQVEDDLAQGVDGAIPIPTDDAGKEEVIAALVANVE 348

Query: 158 AMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSS---- 213
           AMIKADRKITALKQLQGHIWRTG+E+NELEG V+DDVPEALEKWH+LG K    SS    
Sbjct: 349 AMIKADRKITALKQLQGHIWRTGYENNELEGVVYDDVPEALEKWHALGIKVYIYSSGSRL 408

Query: 214 ------------------------------LTSTFISLAASYFLSKEIDVYFGL-IYR-- 240
                                          T ++I ++ S  + K  D+ F   +++  
Sbjct: 409 AQRLIFGKTNYGDLRKYLSGFFDTTVGNKKETRSYIEISESLGVDKPSDILFVTDVFQEA 468

Query: 241 -----FGLDAIISVQPGNGPLPESRGFKTINSFAGI 271
                 GLD +IS++PGN PLPE+ GFKTI SFA I
Sbjct: 469 FAAKGAGLDVMISIRPGNAPLPENHGFKTITSFAEI 504

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356544052|ref|XP_003540469.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like [Glycine max] Back     alignment and taxonomy information
>gi|356549714|ref|XP_003543236.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1-like [Glycine max] Back     alignment and taxonomy information
>gi|388513301|gb|AFK44712.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|378405187|sp|E0CSI1.2|MTBC1_VITVI RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and taxonomy information
>gi|225461486|ref|XP_002285049.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142985|emb|CBI20280.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574694|ref|XP_002528256.1| catalytic, putative [Ricinus communis] gi|296439679|sp|B9SQI7.1|MTBC_RICCO RecName: Full=Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1; Includes: RecName: Full=Methylthioribulose-1-phosphate dehydratase; Short=MTRu-1-P dehydratase; Includes: RecName: Full=Enolase-phosphatase E1; AltName: Full=2,3-diketo-5-methylthio-1-phosphopentane phosphatase gi|223532342|gb|EEF34141.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449446923|ref|XP_004141220.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449528071|ref|XP_004171030.1| PREDICTED: probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 1-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query271
TAIR|locus:2154664507 AT5G53850 [Arabidopsis thalian 0.597 0.319 0.517 4.8e-52
UNIPROTKB|Q28C69259 enoph1 "Enolase-phosphatase E1 0.391 0.409 0.418 8.1e-19
ZFIN|ZDB-GENE-040704-73261 enoph1 "enolase-phosphatase 1" 0.505 0.524 0.364 1e-18
UNIPROTKB|E1C489261 ENOPH1 "Uncharacterized protei 0.398 0.413 0.438 1.1e-18
UNIPROTKB|Q0VD27261 ENOPH1 "Enolase-phosphatase E1 0.413 0.429 0.406 4.1e-17
RGD|1309016261 Enoph1 "enolase-phosphatase 1" 0.391 0.406 0.394 1.1e-16
UNIPROTKB|F1RVD2261 ENOPH1 "Uncharacterized protei 0.413 0.429 0.389 3.7e-16
UNIPROTKB|E2QU97260 ENOPH1 "Uncharacterized protei 0.391 0.407 0.392 9.8e-16
MGI|MGI:1915120257 Enoph1 "enolase-phosphatase 1" 0.391 0.412 0.385 2e-15
UNIPROTKB|Q9UHY7261 ENOPH1 "Enolase-phosphatase E1 0.391 0.406 0.383 2.6e-15
TAIR|locus:2154664 AT5G53850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 395 (144.1 bits), Expect = 4.8e-52, Sum P(2) = 4.8e-52
 Identities = 89/172 (51%), Positives = 116/172 (67%)

Query:   100 VEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAALVANVDAM 159
             V KHL+ T+ TA T+ DIK+L++QVE+DL++GV GAVPIP +D GKE+VIAA+V+NV+AM
Sbjct:   294 VGKHLNLTYHTAETQEDIKLLRAQVEEDLREGVTGAVPIPHADEGKEKVIAAMVSNVEAM 353

Query:   160 IKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTSTFI 219
             I+ADRKITALK+LQGHIWRTGFE +EL+  VF+DV +ALEKWHS G K    SS      
Sbjct:   354 IRADRKITALKELQGHIWRTGFECDELKAIVFEDVADALEKWHSSGIKVYIYSSG----- 408

Query:   220 SLAASYFLSKEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFAGI 271
             S  A   L    D  +G + ++ +        GN    ESR +K I    G+
Sbjct:   409 SRLAQKLLFGNTD--YGDLRKY-ISGFFDTTIGNKK--ESRSYKEIKETLGV 455
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008967 "phosphoglycolate phosphatase activity" evidence=IEA
GO:0016787 "hydrolase activity" evidence=ISS
GO:0019509 "L-methionine salvage from methylthioadenosine" evidence=IEA
GO:0043167 "ion binding" evidence=IEA
GO:0043874 "acireductone synthase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0071267 "L-methionine salvage" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|Q28C69 enoph1 "Enolase-phosphatase E1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-73 enoph1 "enolase-phosphatase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C489 ENOPH1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VD27 ENOPH1 "Enolase-phosphatase E1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1309016 Enoph1 "enolase-phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVD2 ENOPH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU97 ENOPH1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915120 Enoph1 "enolase-phosphatase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHY7 ENOPH1 "Enolase-phosphatase E1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.77LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_1070035
hypothetical protein (504 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_VIII2401
hypothetical protein (190 aa)
• •  •• 0.973
estExt_Genewise1_v1.C_LG_VIII0915
hypothetical protein (200 aa)
• •  •• 0.973
estExt_fgenesh4_pm.C_LG_VI0635
hypothetical protein (384 aa)
• •• •• 0.812
eugene3.79220002
Predicted protein (212 aa)
•    •  0.426

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
COG4229229 COG4229, COG4229, Predicted enolase-phosphatase [E 4e-15
TIGR01691220 TIGR01691, enolase-ppase, 2,3-diketo-5-methylthio- 1e-13
>gnl|CDD|226682 COG4229, COG4229, Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information 
 Score = 72.2 bits (177), Expect = 4e-15
 Identities = 51/174 (29%), Positives = 73/174 (41%), Gaps = 49/174 (28%)

Query: 141 SDAGKEEVIAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEK 200
           S+ G      ALVA +   I  D K T LK LQG IW  G+ES EL+  ++ D  +A+++
Sbjct: 55  SEFGIANSEEALVALLLEWIAEDSKDTPLKALQGMIWAHGYESGELKAHLYPDAVQAIKR 114

Query: 201 WHSLGTKCNGVSS-----------------LTSTF-----------------------IS 220
           W +LG +    SS                 L S F                       I 
Sbjct: 115 WKALGMRVYIYSSGSVKAQKLFFGHSDAGDLNSLFSGYFDTTIGKKRESQSYAKIAGDIG 174

Query: 221 LAAS--YFLS---KEIDVYFGLIYRFGLDAIISVQPGNGPLPESRGFKTINSFA 269
           L  +   FLS   +E+    G+    GL   ++V+PGN P+P+ +GF    SF 
Sbjct: 175 LPPAEILFLSDNPEELKAAAGV----GLATGLAVRPGNAPVPDGQGFLVYKSFE 224

Length = 229
>gnl|CDD|233533 TIGR01691, enolase-ppase, 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 271
COG4229229 Predicted enolase-phosphatase [Energy production a 100.0
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 100.0
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 100.0
KOG2631238 consensus Class II aldolase/adducin N-terminal dom 99.8
PRK06755209 hypothetical protein; Validated 99.71
PRK06754208 mtnB methylthioribulose-1-phosphate dehydratase; R 99.59
PRK06833214 L-fuculose phosphate aldolase; Provisional 99.54
PRK08087215 L-fuculose phosphate aldolase; Provisional 99.49
TIGR03328193 salvage_mtnB methylthioribulose-1-phosphate dehydr 99.48
PRK05874217 L-fuculose-phosphate aldolase; Validated 99.48
PRK08193231 araD L-ribulose-5-phosphate 4-epimerase; Reviewed 99.47
PRK07490245 hypothetical protein; Provisional 99.45
cd00398209 Aldolase_II Class II Aldolase and Adducin head (N- 99.44
PRK08660181 L-fuculose phosphate aldolase; Provisional 99.44
PRK08333184 L-fuculose phosphate aldolase; Provisional 99.44
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.43
PRK06557221 L-ribulose-5-phosphate 4-epimerase; Validated 99.43
PRK06357216 hypothetical protein; Provisional 99.43
TIGR01086214 fucA L-fuculose phosphate aldolase. Members of thi 99.43
PRK13288214 pyrophosphatase PpaX; Provisional 99.42
PRK08130213 putative aldolase; Validated 99.42
COG0546220 Gph Predicted phosphatases [General function predi 99.42
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.42
PRK09220204 methylthioribulose-1-phosphate dehydratase; Provis 99.41
PRK05834194 hypothetical protein; Provisional 99.41
PRK06661231 hypothetical protein; Provisional 99.41
PRK13213231 araD L-ribulose-5-phosphate 4-epimerase; Reviewed 99.4
PRK06486262 hypothetical protein; Provisional 99.4
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.4
PRK12348228 sgaE L-ribulose-5-phosphate 4-epimerase; Reviewed 99.4
PRK12347231 sgbE L-ribulose-5-phosphate 4-epimerase; Reviewed 99.39
PRK07090260 class II aldolase/adducin domain protein; Provisio 99.39
COG0235219 AraD Ribulose-5-phosphate 4-epimerase and related 99.39
PRK13145234 araD L-ribulose-5-phosphate 4-epimerase; Provision 99.37
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.37
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.36
PRK07044252 aldolase II superfamily protein; Provisional 99.35
TIGR00760231 araD L-ribulose-5-phosphate 4-epimerase. The homol 99.35
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.35
PF00596184 Aldolase_II: Class II Aldolase and Adducin N-termi 99.34
PRK06208274 hypothetical protein; Provisional 99.33
PRK13226229 phosphoglycolate phosphatase; Provisional 99.31
PRK11587218 putative phosphatase; Provisional 99.31
PLN02575381 haloacid dehalogenase-like hydrolase 99.29
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.28
PRK13222226 phosphoglycolate phosphatase; Provisional 99.26
PRK13223272 phosphoglycolate phosphatase; Provisional 99.26
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.26
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.24
PRK03634274 rhamnulose-1-phosphate aldolase; Provisional 99.24
PLN02940 382 riboflavin kinase 99.23
PRK13225273 phosphoglycolate phosphatase; Provisional 99.2
TIGR02624270 rhamnu_1P_ald rhamnulose-1-phosphate aldolase. Mem 99.19
PRK09449224 dUMP phosphatase; Provisional 99.19
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.18
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.18
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.17
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.16
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.13
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.06
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.04
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.0
PRK14988224 GMP/IMP nucleotidase; Provisional 98.97
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 98.96
PLN02779286 haloacid dehalogenase-like hydrolase family protei 98.95
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.95
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.93
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 98.91
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.89
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.86
PLN02811220 hydrolase 98.8
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.75
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.74
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.63
PHA02597197 30.2 hypothetical protein; Provisional 98.63
PRK08324 681 short chain dehydrogenase; Validated 98.62
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 98.56
PRK06769173 hypothetical protein; Validated 98.52
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.45
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 98.44
PLN02954224 phosphoserine phosphatase 98.34
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 98.29
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.28
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 98.15
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.1
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.01
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 97.96
PRK11590211 hypothetical protein; Provisional 97.95
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.93
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 97.93
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 97.93
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 97.92
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.89
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 97.87
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.77
PRK13582205 thrH phosphoserine phosphatase; Provisional 97.71
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 97.65
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 97.61
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.48
PHA02530300 pseT polynucleotide kinase; Provisional 97.39
PRK11133322 serB phosphoserine phosphatase; Provisional 97.31
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.24
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 97.19
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 96.99
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 96.9
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 96.84
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 96.82
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 96.75
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 96.74
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 96.7
COG0241181 HisB Histidinol phosphatase and related phosphatas 96.51
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 96.44
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 96.06
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 95.93
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 95.87
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 95.67
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 95.64
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 95.0
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 94.98
TIGR01459 242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 94.97
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 94.95
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 94.93
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 94.58
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 94.56
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 94.43
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 94.38
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 94.33
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 94.32
KOG3699 598 consensus Cytoskeletal protein Adducin [Signal tra 94.24
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 93.92
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 93.68
PHA03398303 viral phosphatase superfamily protein; Provisional 93.6
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 93.58
TIGR01684301 viral_ppase viral phosphatase. These proteins also 92.73
COG3347404 Uncharacterized conserved protein [Function unknow 92.04
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 91.68
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 91.47
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 91.37
COG0647 269 NagD Predicted sugar phosphatases of the HAD super 91.29
KOG3040 262 consensus Predicted sugar phosphatase (HAD superfa 90.98
PRK08238 479 hypothetical protein; Validated 90.63
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 90.25
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 89.78
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 89.62
COG5663194 Uncharacterized conserved protein [Function unknow 89.21
PLN02645311 phosphoglycolate phosphatase 88.76
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 88.55
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 88.2
PTZ00445219 p36-lilke protein; Provisional 88.09
COG4996164 Predicted phosphatase [General function prediction 87.37
PLN02645 311 phosphoglycolate phosphatase 87.0
COG4359220 Uncharacterized conserved protein [Function unknow 86.94
TIGR01458 257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 86.05
TIGR01452 279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 84.77
PRK10671834 copA copper exporting ATPase; Provisional 84.19
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 82.96
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 81.33
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-45  Score=315.22  Aligned_cols=169  Identities=30%  Similarity=0.460  Sum_probs=151.8

Q ss_pred             cceecccCcch-HHH--------HHHHHHHHHhhccCCcchHHHHHHHHHhhHHHhhcccCCCCCCCCCCCchHHHHHHH
Q 039859           82 VISRQLNGLTS-ASA--------DSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKEEVIAAL  152 (271)
Q Consensus        82 vil~DiEGTt~-is~--------~~~~l~~~l~~~~~~~e~~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  152 (271)
                      .||+||||||| |||        +++++++|+++||++++++.++++++.+.              +... +.    |++
T Consensus         6 aiLlDIEGTv~~iSFVkdvlFPYa~~~lp~fv~e~~e~~~v~~~v~~v~~e~--------------g~~~-s~----E~l   66 (229)
T COG4229           6 AILLDIEGTVSPISFVKDVLFPYAARKLPDFVRENTEDSEVKKIVDEVLSEF--------------GIAN-SE----EAL   66 (229)
T ss_pred             hheeeccccccchhHHHhhhhHHHHHHhHHHHHhhccCChhhHHHHHHHHHh--------------Cccc-hH----HHH
Confidence            38999999999 996        99999999999999999999998888753              2211 12    556


Q ss_pred             HHHHHHhhhhccchhhHHHHHHHHHHHhhhcCcccccCCCCHHHHHHHHHHcCCeEEEEeCCCC----------------
Q 039859          153 VANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTS----------------  216 (271)
Q Consensus       153 ~~~v~~~i~~DrK~~~LK~LQG~iw~~~y~~g~~~~~~ypdv~~~L~~l~~~G~~l~i~Ssgs~----------------  216 (271)
                      ++.+..|+++|+|+|+||+|||+||.+||++|++++|+|||+.++|++|+++|+++|||||||+                
T Consensus        67 va~~~~wiaed~K~t~lK~lQG~iWa~Gy~sgelkahlypDav~~ik~wk~~g~~vyiYSSGSV~AQkL~Fghs~agdL~  146 (229)
T COG4229          67 VALLLEWIAEDSKDTPLKALQGMIWAHGYESGELKAHLYPDAVQAIKRWKALGMRVYIYSSGSVKAQKLFFGHSDAGDLN  146 (229)
T ss_pred             HHHHHHHHhcccccchHHHHHhHHHHhccccCccccccCHhHHHHHHHHHHcCCcEEEEcCCCchhHHHhhcccccccHH
Confidence            6666678999999999999999999999999999999999999999999999999999999999                


Q ss_pred             ----Cccc-------cccccc-----cC-CCC------CCHHHH--HHHhCCeEEEEeCCCCCCCCCCCCceeeCCCC
Q 039859          217 ----TFIS-------LAASYF-----LS-KEI------DVYFGL--IYRFGLDAIISVQPGNGPLPESRGFKTINSFA  269 (271)
Q Consensus       217 ----~yFD-------~~~sy~-----l~-~p~------D~~~d~--A~~AG~~t~~v~R~gn~~~~~~~~~~~i~sf~  269 (271)
                          ||||       |.+||.     ++ +|.      |++.|+  |+.+||+|.+++||||.|.++...+.++.||+
T Consensus       147 ~lfsGyfDttiG~KrE~~SY~kIa~~iGl~p~eilFLSDn~~EL~AA~~vGl~t~l~~R~g~~P~~d~~~~~~~~sf~  224 (229)
T COG4229         147 SLFSGYFDTTIGKKRESQSYAKIAGDIGLPPAEILFLSDNPEELKAAAGVGLATGLAVRPGNAPVPDGQGFLVYKSFE  224 (229)
T ss_pred             hhhcceeeccccccccchhHHHHHHhcCCCchheEEecCCHHHHHHHHhcchheeeeecCCCCCCCCCcCceeeechh
Confidence                8999       889997     55 554      999999  99999999999999999998877899999997

>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>KOG2631 consensus Class II aldolase/adducin N-terminal domain protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06755 hypothetical protein; Validated Back     alignment and domain information
>PRK06754 mtnB methylthioribulose-1-phosphate dehydratase; Reviewed Back     alignment and domain information
>PRK06833 L-fuculose phosphate aldolase; Provisional Back     alignment and domain information
>PRK08087 L-fuculose phosphate aldolase; Provisional Back     alignment and domain information
>TIGR03328 salvage_mtnB methylthioribulose-1-phosphate dehydratase Back     alignment and domain information
>PRK05874 L-fuculose-phosphate aldolase; Validated Back     alignment and domain information
>PRK08193 araD L-ribulose-5-phosphate 4-epimerase; Reviewed Back     alignment and domain information
>PRK07490 hypothetical protein; Provisional Back     alignment and domain information
>cd00398 Aldolase_II Class II Aldolase and Adducin head (N-terminal) domain Back     alignment and domain information
>PRK08660 L-fuculose phosphate aldolase; Provisional Back     alignment and domain information
>PRK08333 L-fuculose phosphate aldolase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK06557 L-ribulose-5-phosphate 4-epimerase; Validated Back     alignment and domain information
>PRK06357 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01086 fucA L-fuculose phosphate aldolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK08130 putative aldolase; Validated Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK09220 methylthioribulose-1-phosphate dehydratase; Provisional Back     alignment and domain information
>PRK05834 hypothetical protein; Provisional Back     alignment and domain information
>PRK06661 hypothetical protein; Provisional Back     alignment and domain information
>PRK13213 araD L-ribulose-5-phosphate 4-epimerase; Reviewed Back     alignment and domain information
>PRK06486 hypothetical protein; Provisional Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK12348 sgaE L-ribulose-5-phosphate 4-epimerase; Reviewed Back     alignment and domain information
>PRK12347 sgbE L-ribulose-5-phosphate 4-epimerase; Reviewed Back     alignment and domain information
>PRK07090 class II aldolase/adducin domain protein; Provisional Back     alignment and domain information
>COG0235 AraD Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13145 araD L-ribulose-5-phosphate 4-epimerase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK07044 aldolase II superfamily protein; Provisional Back     alignment and domain information
>TIGR00760 araD L-ribulose-5-phosphate 4-epimerase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PF00596 Aldolase_II: Class II Aldolase and Adducin N-terminal domain; InterPro: IPR001303 This entry represents the alpha/beta/alpha domain found in class II aldolases and adducin, usually at the N terminus Back     alignment and domain information
>PRK06208 hypothetical protein; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PRK03634 rhamnulose-1-phosphate aldolase; Provisional Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02624 rhamnu_1P_ald rhamnulose-1-phosphate aldolase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>KOG3699 consensus Cytoskeletal protein Adducin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>COG3347 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1yns_A261 Crystal Structure Of Human Enolase-Phosphatase E1 A 1e-15
1zs9_A261 Crystal Structure Of Human Enolase-Phosphatase E1 L 3e-14
>pdb|1YNS|A Chain A, Crystal Structure Of Human Enolase-Phosphatase E1 And Its Complex With A Substrate Analog Length = 261 Back     alignment and structure 
Iteration: 1

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 65/118 (55%), Gaps = 6/118 (5%)
Query: 100 VEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGK----EEVIAALVAN 155
           V+++L    E    + D+ +L+ Q E+D    + GAVPIP +        +++I A+V N
Sbjct: 39  VKEYLQTHWEEEECQQDVSLLRKQAEEDAH--LDGAVPIPAASGNGVDDLQQMIQAVVDN 96
Query: 156 VDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSS 213
           V   +  DRK TALKQLQGH+WR  F +  ++ E F DV  A+ KW   G K    SS
Sbjct: 97  VCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSS 154
>pdb|1ZS9|A Chain A, Crystal Structure Of Human Enolase-Phosphatase E1 Length = 261 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query271
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 6e-24
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 1e-21
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 Back     alignment and structure
 Score = 96.4 bits (239), Expect = 6e-24
 Identities = 52/218 (23%), Positives = 85/218 (38%), Gaps = 45/218 (20%)

Query: 99  KVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAG--KEEVIAALVANV 156
            V+++L    E    + D+ +L+ Q E+D     A  +P    +     +++I A+V NV
Sbjct: 38  NVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNV 97

Query: 157 DAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTS 216
              +  DRK TALKQLQGH+WR  F +  ++ E F DV  A+ KW   G K    SS + 
Sbjct: 98  CWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSV 157

Query: 217 TFISLAASYF----LSKEIDVYFGLIYR-------------------------------- 240
               L   +     + + +D +F                                     
Sbjct: 158 EAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREA 217

Query: 241 -----FGLDAIISVQPGNGPLPE--SRGFKTINSFAGI 271
                  +   + V+PGN  L +     +  I SF+ +
Sbjct: 218 SAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSEL 255
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Length = 253 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.84
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.74
1e4c_P215 L-fuculose 1-phosphate aldolase; aldolase (class I 99.52
2opi_A212 L-fuculose-1-phosphate aldolase; L-fuculose-1-phos 99.49
2irp_A208 Putative aldolase class 2 protein AQ_1979; aldehyd 99.46
1k0w_A231 L-ribulose 5 phosphate 4-epimerase; aldolase, isom 99.42
3ocr_A273 Class II aldolase/adducin domain protein; PSI-2, m 99.41
2fk5_A200 Fuculose-1-phosphate aldolase; class II aldolase, 99.35
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.33
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.28
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.26
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.26
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.24
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.24
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 99.24
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.23
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.22
2z7b_A270 MLR6791 protein; class II aldolase superfamily, ly 99.22
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.21
1pvt_A238 Sugar-phosphate aldolase; structural genomics, PSI 99.2
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.2
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.2
2v9l_A274 Rhamnulose-1-phosphate aldolase; entropy index, me 99.19
3m4r_A222 Uncharacterized protein; short chain dehydrogenase 99.19
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.18
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.17
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.17
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.16
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.16
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.14
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.14
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.13
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.12
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.12
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.12
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.11
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.1
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.09
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.09
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.08
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.07
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.04
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.04
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.03
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.0
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.0
2p11_A231 Hypothetical protein; putative haloacid dehalogena 98.98
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.98
1te2_A226 Putative phosphatase; structural genomics, phospha 98.98
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.95
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 98.94
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.94
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.89
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.89
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 98.87
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.87
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.86
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.86
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.85
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.84
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.83
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.82
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.8
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.79
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.77
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.69
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.69
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.68
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.66
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.59
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.59
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 98.57
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.57
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.42
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.36
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.33
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.29
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.18
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.18
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.14
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.14
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 97.4
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 98.1
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.02
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 97.97
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.94
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.88
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.87
3fvv_A232 Uncharacterized protein; unknown function, structu 97.86
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 97.85
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.81
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.69
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 97.52
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 97.48
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 97.43
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 97.4
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 97.39
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 97.28
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 97.17
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 97.17
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.14
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 97.12
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 96.82
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 96.58
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 96.46
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 96.16
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 96.12
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.11
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 95.89
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 95.71
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 95.61
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 95.53
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 95.12
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 95.09
3mn1_A189 Probable YRBI family phosphatase; structural genom 94.93
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 94.35
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 94.28
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 94.13
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 94.1
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 93.97
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 93.41
3mmz_A176 Putative HAD family hydrolase; structural genomics 92.97
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 92.74
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 92.6
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 91.33
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 88.57
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 88.36
4gxt_A385 A conserved functionally unknown protein; structur 81.12
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
Probab=99.84  E-value=2.4e-20  Score=166.42  Aligned_cols=188  Identities=32%  Similarity=0.486  Sum_probs=138.0

Q ss_pred             cceecccCcch-HHH--------HHHHHHHHHhhccCCcchHHHHHHHHHhhHHHhhcccCCCCCCC----CCCCchHHH
Q 039859           82 VISRQLNGLTS-ASA--------DSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIP----PSDAGKEEV  148 (271)
Q Consensus        82 vil~DiEGTt~-is~--------~~~~l~~~l~~~~~~~e~~~~i~~l~~~~~~~~~~~~~~~~~~~----~~~~~~~~~  148 (271)
                      .+|||+|||++ +++        +.+.+..++..+|..++..+.++.++.....+.  ...+....+    +....++..
T Consensus        12 aviFDlDGTL~ds~~~~~~~~~~a~~~~~~~l~~~~~~~~~~~~~~~l~~~~g~~~--~~~~~~~~~~~~~~~~~~~~~~   89 (261)
T 1yns_A           12 VILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDA--HLDGAVPIPAASGNGVDDLQQM   89 (261)
T ss_dssp             EEEECCBTTTBCHHHHHHTHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHHTT--TSTTCCCCCCCSCSSHHHHHHH
T ss_pred             EEEEecCCCccchhhHhhcchHHHHHHHHHHHHHhCCCHHHHHHHHHHHHHhcccc--ccccccccchhhcccccccccC
Confidence            58999999999 762        778899999988887766666666665332211  110111100    001112234


Q ss_pred             HHHHHHHHHHhhhhccchhhHHHHHHHHHHHhhhcCcccccCCCCHHHHHHHHHHcCCeEEEEeCCCC------------
Q 039859          149 IAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTS------------  216 (271)
Q Consensus       149 ~~~~~~~v~~~i~~DrK~~~LK~LQG~iw~~~y~~g~~~~~~ypdv~~~L~~l~~~G~~l~i~Ssgs~------------  216 (271)
                      .+.+.++++.++..|+|...++++|+.+|+++|..+....++|||+.++|+.|+++|++++|+||++.            
T Consensus        90 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~L~~L~~~g~~~~i~Tn~~~~~~~~~l~~~~~  169 (261)
T 1yns_A           90 IQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTE  169 (261)
T ss_dssp             HHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHTTSCCBCCCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHTBTT
T ss_pred             HHHHHHHHHHHhccccccHHHHHHHHHHHHHHHHhCCcccccCcCHHHHHHHHHhCCCeEEEEeCCCHHHHHHHHHhhcc
Confidence            56777888888888999999999999999999998888899999999999999999999999999976            


Q ss_pred             ----Cccc-----c------ccccc-----cC-CCC------CCHHHH--HHHhCCeEEEEeCCCCCCCCC--CCCceee
Q 039859          217 ----TFIS-----L------AASYF-----LS-KEI------DVYFGL--IYRFGLDAIISVQPGNGPLPE--SRGFKTI  265 (271)
Q Consensus       217 ----~yFD-----~------~~sy~-----l~-~p~------D~~~d~--A~~AG~~t~~v~R~gn~~~~~--~~~~~~i  265 (271)
                          .|||     +      +..|.     ++ +|+      |+..|+  |++|||++++|.|.|+.+.+.  ..++.++
T Consensus       170 ~~l~~~fd~i~~~~~~~KP~p~~~~~~~~~lg~~p~~~l~VgDs~~di~aA~~aG~~~i~v~~~~~~~~~~~~~~~~~~i  249 (261)
T 1yns_A          170 GDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLI  249 (261)
T ss_dssp             BCCGGGCSEEECGGGCCTTCHHHHHHHHHHHTSCGGGEEEEESCHHHHHHHHHTTCEEEEECCTTCCCCCHHHHHHSCEE
T ss_pred             cChHhhccEEEecCCCCCCCHHHHHHHHHHhCcCcccEEEEcCCHHHHHHHHHCCCEEEEEeCCCCCcccccccCCCEEE
Confidence                5677     1      12222     34 565      999999  999999999999977653221  2257789


Q ss_pred             CCCCCC
Q 039859          266 NSFAGI  271 (271)
Q Consensus       266 ~sf~el  271 (271)
                      +||.||
T Consensus       250 ~~l~el  255 (261)
T 1yns_A          250 TSFSEL  255 (261)
T ss_dssp             SSGGGC
T ss_pred             CCHHHh
Confidence            998875
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>1e4c_P L-fuculose 1-phosphate aldolase; aldolase (class II), bacterial L-fucose metabolism; 1.66A {Escherichia coli} SCOP: c.74.1.1 PDB: 1fua_A 2fua_A 3fua_A 4fua_A* 1dzv_P 1e4b_P 1e47_P* 1e48_P* 1dzz_P 1e46_P 1dzu_P 1dzy_P 1dzx_P 1dzw_P 1e49_P 1e4a_P Back     alignment and structure
>2opi_A L-fuculose-1-phosphate aldolase; L-fuculose-1-phosphate aldolas structural genomics, PSI-2, protein structure initiative; 2.50A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2irp_A Putative aldolase class 2 protein AQ_1979; aldehyde, enzymatic mechanism; 2.40A {Aquifex aeolicus} Back     alignment and structure
>1k0w_A L-ribulose 5 phosphate 4-epimerase; aldolase, isomerase; 2.10A {Escherichia coli} SCOP: c.74.1.1 PDB: 1jdi_A Back     alignment and structure
>3ocr_A Class II aldolase/adducin domain protein; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG, lyase; 1.95A {Pseudomonas syringae PV} Back     alignment and structure
>2fk5_A Fuculose-1-phosphate aldolase; class II aldolase, metal binding, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Thermus thermophilus} PDB: 2flf_A Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2z7b_A MLR6791 protein; class II aldolase superfamily, lyase; 1.90A {Mesorhizobium loti} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1pvt_A Sugar-phosphate aldolase; structural genomics, PSI, protein initiative, midwest center for structural genomics, MCSG; 2.50A {Thermotoga maritima} SCOP: c.74.1.1 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2v9l_A Rhamnulose-1-phosphate aldolase; entropy index, metal-binding, oligomerization, zinc, lyase, class II, cytoplasm; HET: PGO; 1.23A {Escherichia coli} PDB: 2uyv_A* 1ojr_A 2v9g_A* 1gt7_A* 2v9n_A* 2uyu_A* 2v9m_A* 2v9o_A 2v9e_A 2v9f_A 2v9i_A 2v29_A 2v2a_A* 2v2b_A Back     alignment and structure
>3m4r_A Uncharacterized protein; short chain dehydrogenase, class II aldolase, adducin head D carbohydrate metabolism, structural genomics; 2.00A {Thermoplasma acidophilum} Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 271
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 1e-04
d2g80a1225 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast 0.003
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Enolase-phosphatase E1
domain: E-1 enzyme
species: Human(Homo sapiens) [TaxId: 9606]

 Score = 40.6 bits (93), Expect = 1e-04
 Identities = 52/215 (24%), Positives = 81/215 (37%), Gaps = 45/215 (20%)

Query: 100 VEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAGKE--EVIAALVANVD 157
           V+++L    E    + D+ +L+ Q E+D     A  +P    +   +  ++I A+V NV 
Sbjct: 36  VKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVC 95

Query: 158 AMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTST 217
             +  DRK TALKQLQGH+WR  F +  ++ E F DV  A+ KW   G K    SS +  
Sbjct: 96  WQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVE 155

Query: 218 FISLAASYFLSKEIDVYFGLIY-------------------------------------- 239
              L   +    +I       +                                      
Sbjct: 156 AQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREAS 215

Query: 240 ---RFGLDAIISVQPGNGPLP--ESRGFKTINSFA 269
                 +   + V+PGN  L   E   +  I SF+
Sbjct: 216 AAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFS 250
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query271
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.94
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.85
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.48
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.43
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.42
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.37
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.35
d1e4cp_206 L-fuculose-1-phosphate aldolase {Escherichia coli 99.33
d1ojra_274 L-rhamnulose-1-phosphate aldolase {Escherichia col 99.29
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.29
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.25
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.23
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.23
d1k0wa_223 L-ribulose-5-phosphate 4-epimerase {Escherichia co 99.22
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.19
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.17
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.14
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.1
d1pvta_232 Putative sugar-phosphate aldolase {Thermotoga mari 99.06
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.03
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 98.92
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 98.77
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.52
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 98.33
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 98.23
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 98.19
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 98.0
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.96
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 97.7
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.42
d2c4na1 250 NagD {Escherichia coli [TaxId: 562]} 97.28
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 96.99
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 96.89
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.83
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 96.8
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 95.87
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 95.18
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 93.77
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 93.75
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 89.38
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 89.03
d2bdea1 458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 81.09
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Enolase-phosphatase E1
domain: E-1 enzyme
species: Human(Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=1.4e-26  Score=196.10  Aligned_cols=188  Identities=32%  Similarity=0.492  Sum_probs=147.8

Q ss_pred             cceecccCcch-HHH--------HHHHHHHHHhhccCCcchHHHHHHHHHhhHHHhhcccCCCCCCCCCCCc----hHHH
Q 039859           82 VISRQLNGLTS-ASA--------DSNKVEKHLSATHETAGTKGDIKILQSQVEDDLKQGVAGAVPIPPSDAG----KEEV  148 (271)
Q Consensus        82 vil~DiEGTt~-is~--------~~~~l~~~l~~~~~~~e~~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~----~~~~  148 (271)
                      .+|||++||++ ++|        +++++++||.++|..++++..+..++.....+....  +..++......    ....
T Consensus         9 ~vlfD~dGTl~~~~~v~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~   86 (253)
T d1zs9a1           9 VILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD--GAVPIPAASGNGVDDLQQM   86 (253)
T ss_dssp             EEEECCBTTTBCHHHHHHTHHHHHHHHHHHHHHHHTTSHHHHHHHHHHHHHHHHTTTST--TCCCCCCCSCSSHHHHHHH
T ss_pred             EEEEeCcCCCccchhhhhhhhHHHHHHHHHHHHHhcCChhHHHHHHHHHHhhhhhhhhh--hhhhhhhhhhcchhhHHHh
Confidence            58999999999 875        789999999999999999999988887654443222  11222222211    1234


Q ss_pred             HHHHHHHHHHhhhhccchhhHHHHHHHHHHHhhhcCcccccCCCCHHHHHHHHHHcCCeEEEEeCCCC------------
Q 039859          149 IAALVANVDAMIKADRKITALKQLQGHIWRTGFESNELEGEVFDDVPEALEKWHSLGTKCNGVSSLTS------------  216 (271)
Q Consensus       149 ~~~~~~~v~~~i~~DrK~~~LK~LQG~iw~~~y~~g~~~~~~ypdv~~~L~~l~~~G~~l~i~Ssgs~------------  216 (271)
                      ++....++.+++..++|.+..++++|++|+++|........+|||+.++|++|+++|++++|+||++.            
T Consensus        87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~e~l~~L~~~g~~l~i~Tn~~~~~~~~~~~~~~~  166 (253)
T d1zs9a1          87 IQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTE  166 (253)
T ss_dssp             HHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHTTSCCBCCCTTHHHHHHHHHHTTCEEEEECSSCHHHHHHHHHTBTT
T ss_pred             HHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHHhhhcccccCCCHHHHHHHHhhccCceeecCCCcHHHHHHHHHHcCc
Confidence            55666778888999999999999999999999999999999999999999999999999999999988            


Q ss_pred             -Cccc--------------cccccc-----cC-CCC------CCHHHH--HHHhCCeEEEEeCCCCCCCCCC--CCceee
Q 039859          217 -TFIS--------------LAASYF-----LS-KEI------DVYFGL--IYRFGLDAIISVQPGNGPLPES--RGFKTI  265 (271)
Q Consensus       217 -~yFD--------------~~~sy~-----l~-~p~------D~~~d~--A~~AG~~t~~v~R~gn~~~~~~--~~~~~i  265 (271)
                       +||+              ++..|.     ++ .|+      |+..|+  |++|||+|++|.|+||.+.++.  .++.+|
T Consensus       167 ~~~~~~~~~~~d~~~~~KP~p~~~~~~~~~~~~~p~~~l~vgD~~~dv~aA~~aG~~ti~v~r~g~~~~~~~~~~~~~~i  246 (253)
T d1zs9a1         167 GDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLI  246 (253)
T ss_dssp             BCCGGGCSEEECGGGCCTTCHHHHHHHHHHHTSCGGGEEEEESCHHHHHHHHHTTCEEEEECCTTCCCCCHHHHHHSCEE
T ss_pred             chhhhhcceeeccccccCCCcHHHHHHHHHhCCCcCcEEEEeCCHHHHHHHHHcCCEEEEEeCCCCCCCchhhcCCCcEE
Confidence             4555              111121     34 666      999999  9999999999999999866543  358899


Q ss_pred             CCCCCC
Q 039859          266 NSFAGI  271 (271)
Q Consensus       266 ~sf~el  271 (271)
                      +||.||
T Consensus       247 ~sl~EL  252 (253)
T d1zs9a1         247 TSFSEL  252 (253)
T ss_dssp             SSGGGC
T ss_pred             CChHHh
Confidence            999987
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e4cp_ c.74.1.1 (P:) L-fuculose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojra_ c.74.1.1 (A:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1k0wa_ c.74.1.1 (A:) L-ribulose-5-phosphate 4-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1pvta_ c.74.1.1 (A:) Putative sugar-phosphate aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure