Citrus Sinensis ID: 039861

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------

KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHSGSSEESTMSSFEEKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAGEARRAELEKKKNLDEDERLLEALGPPPNLKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKERVSCYFY

cHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccHHHHccccccccccHHHHcccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHHHHccEEEEEEcccccccccccccccccEEEEEEEEcccccccccccccccccccccEEEEccccccccccccHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccEEEcccccccccHHHHHccccccEEEEEcccccccHHHHHHHcccccccccHHHHHHHcccccccccEEEEEcccccccccccccccEEEEEccccccccccccccccccEEEEccccccEEEcccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccc

ccHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHcHHHccccccccccHHHHEcHHcccHHHHHHHHEEEEccccccEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHcccEEEEEEcccccccccccccccccEEEEEEEEEcccccccccccccHHHHHHccHHccccccccccHHHHHHHHHcccccEEEEccccccccccccHHHccccccccccccEEEcccccccccccccccccccccEEEEcccccHHcccHHHcccccccEEEEcccccHccccccccccccccEEEEEEccccccccccHccccccHHccEEEcccccccccccHHHHHHHHcHcccHHHHHHHHHccccccccEEEEEcccccccccccccccEEEEEccccccccccccccccccEEEEccccccccccHHHcccccccccccccccccccEEEEcccHcHHcccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccHHHHHHcHcHcc

KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLlsynelpskvkqcftycavfpkdydIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILAsrsffqdfdrgddgeisnckmhDIVHDFAQYLcsnecltveihsgsseestmssfEEKKIRHLMLIVRGrasvpisiwdnvkglrgLRSFLVksdeyswssevlpqLFDKLTCLRALnlkvrkpwssvndikeIPTNIEKLLHLKYLNLKSQNKIEKLPETLCElhnlerlnvddcenlrelpRGIGKLRKLmyidnddtdslrylpvgIGELIRLRRVTKLVVgggydracslgslkklNLLRECtirglggvsdaGEARRAELEKKKNLDEDERLLealgpppnlkklqiydyrgrrnvvpknwimdlslfrcrncehlpplgklpsleyleieGMQSVKRVGNeflgvesdtdgssviafpklkklefrnmeeleewdcgtaikgeiiimprlsslsiqscpklkalpdhllqkstlqkleiwgcpilkervscyfy

kigreivkkckglplaaKTIASllrskstekEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHSGSSEESTMSSFEEKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNlkvrkpwssvndikEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNlerlnvddcenlrelprgigklrklmyidnddtdslrylpvgigelirlrRVTKLVVGGgydracslgslkklnLLRECTIrglggvsdageaRRAELekkknldederllealgpppnlkklqiydyRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLgvesdtdgssviafpklkklefrnMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKstlqkleiwgcpilkervscyfy

KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHsgsseestmssfeeKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAGEARRAelekkknldederlleALGPPPNLKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKERVSCYFY

*****IVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIH***************KIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGV********************************LKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKERVSCYF*

KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHS**********FEEKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAGEARRAELEKKKNLDEDERLLEALGPPPNLKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLGVES******VIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKERVS**F*

KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIH************EEKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAGEARRAELEKKKNLDEDERLLEALGPPPNLKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKERVSCYFY

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		557	2.2.26 [Sep-21-2011]
Q7XA40		992	Putative disease resistan	N/A	no	0.861	0.483	0.357	3e-68
Q7XA39		988	Putative disease resistan	N/A	no	0.849	0.478	0.354	1e-67
Q7XBQ9		970	Disease resistance protei	N/A	no	0.827	0.475	0.343	6e-65
Q7XA42		979	Putative disease resistan	N/A	no	0.809	0.460	0.344	6e-65
Q9LRR5		1424	Putative disease resistan	yes	no	0.906	0.354	0.323	2e-61
Q9LRR4		1054	Putative disease resistan	no	no	0.904	0.478	0.319	2e-60
Q38834		852	Disease resistance RPP13-	no	no	0.827	0.541	0.259	5e-33
Q39214		926	Disease resistance protei	no	no	0.901	0.542	0.264	5e-32
Q9LVT4		843	Probable disease resistan	no	no	0.881	0.582	0.261	7e-29
P0DI18		1049	Probable disease resistan	no	no	0.888	0.471	0.265	1e-26

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function desciption

 Score =  260 bits (664), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 204/570 (35%), Positives = 288/570 (50%), Gaps = 90/570 (15%)

Query: 1   KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYN 60
           +IG+EIVKKC G+PLAAKT+  LLR K  E EW+++ ++EIW L   +  +L  L LSY+
Sbjct: 337 EIGKEIVKKCGGVPLAAKTLGGLLRFKREESEWEHVRDSEIWNLPQDENSVLPALRLSYH 396

Query: 61  ELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRS 120
            LP  ++QCF YCAVFPKD  I+KE LI LWMA  +L  KG  E+ED+G E +N L  RS
Sbjct: 397 HLPLDLRQCFAYCAVFPKDTKIEKEYLIALWMAHSFLLSKGNMELEDVGNEVWNELYLRS 456

Query: 121 FFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHSGSSEESTMSSFEEKKIRHL 180
           FFQ+ +       +  KMHD++HD          L   + S S+   ++     K    +
Sbjct: 457 FFQEIEVKSGK--TYFKMHDLIHD----------LATSMFSASASSRSIRQINVKDDEDM 504

Query: 181 MLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRK 240
           M IV            N K +  +  F      YS      P LF +   LR LNL    
Sbjct: 505 MFIV-----------TNYKDMMSI-GFSEVVSSYS------PSLFKRFVSLRVLNL---- 542

Query: 241 PWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELP 300
              S ++ +++P+++  L+HL+YL+L S NKI  LP+ LC+L NL+ L++ +C++L  LP
Sbjct: 543 ---SNSEFEQLPSSVGDLVHLRYLDL-SGNKICSLPKRLCKLQNLQTLDLYNCQSLSCLP 598

Query: 301 RGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVG--GGYDRACSLGSLKKLN 358
           +   KL  L  +  D    L  +P  IG L  L+ +   VVG   GY     LG L+ LN
Sbjct: 599 KQTSKLCSLRNLVLDHC-PLTSMPPRIGLLTCLKTLGYFVVGERKGY----QLGELRNLN 653

Query: 359 LLRECTIRGLGGVSDAGEARRAELEKKKNL--------------DEDERLLEALGPPPNL 404
           L    +I  L  V +  EA+ A L  K NL               E+ ++LEAL P PNL
Sbjct: 654 LRGAISITHLERVKNDMEAKEANLSAKANLHSLSMSWDRPNRYESEEVKVLEALKPHPNL 713

Query: 405 KKLQIYDYRG------RRNVVPKNWIMDLSLFRCRNCEHLPPLGKLPSLEYLEIE-GMQS 457
           K L+I D+ G        + V KN ++ + +  C NC  LPP G+LP LE LE++ G   
Sbjct: 714 KYLEIIDFCGFCLPDWMNHSVLKN-VVSILISGCENCSCLPPFGELPCLESLELQDGSVE 772

Query: 458 VKRVGNEFLGVESDTDGSSVIAFPKLKKLE---FRNMEELEEWDCGTAIKGEIIIMPRLS 514
           V+ V         D+   +   FP L+KL    F N++ L+               P L 
Sbjct: 773 VEYV--------EDSGFLTRRRFPSLRKLHIGGFCNLKGLQRMKGAEQ-------FPVLE 817

Query: 515 SLSIQSCPKLKALPDHLLQKSTLQKLEIWG 544
            + I  CP     P      S+++KLEIWG
Sbjct: 818 EMKISDCPMF-VFP----TLSSVKKLEIWG 842

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function description

>sp\|Q38834\|R13L4_ARATH Disease resistance RPP13-like protein 4 OS=Arabidopsis thaliana GN=RPP13L4 PE=2 SV=2	Back alignment and function description

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function description

>sp\|Q9LVT4\|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		557
359482794		880	PREDICTED: putative disease resistance p	0.929	0.588	0.453	1e-119
359482769		904	PREDICTED: putative disease resistance p	0.935	0.576	0.445	1e-119
147825450		927	hypothetical protein VITISV_000086 [Viti	0.940	0.565	0.441	1e-118
359482790		923	PREDICTED: putative disease resistance p	0.937	0.565	0.442	1e-118
359482792		922	PREDICTED: putative disease resistance p	0.933	0.563	0.449	1e-117
359482788		903	PREDICTED: putative disease resistance p	0.933	0.575	0.437	1e-116
359482784		919	PREDICTED: putative disease resistance p	0.935	0.566	0.447	1e-116
255549784		786	leucine-rich repeat containing protein,	0.951	0.674	0.440	1e-116
224115608		922	cc-nbs-lrr resistance protein [Populus t	0.937	0.566	0.444	1e-111
224115620		963	cc-nbs-lrr resistance protein [Populus t	0.956	0.553	0.436	1e-111

>gi\|359482794\|ref\|XP_002268547.2\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 254/560 (45%), Positives = 348/560 (62%), Gaps = 42/560 (7%)

Query: 1   KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYN 60
           +IG +I  KCKGLPLA KT+ +L+R K+ ++EW+N+L +E+W+L+  ++ +   LLLSY 
Sbjct: 341 EIGEKIADKCKGLPLAIKTLGNLMRLKNNKEEWENVLNSEVWQLDEFERDICPALLLSYY 400

Query: 61  ELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFNILASRS 120
           +LP  +K+CF++CAVFPKD  I+ +ELI LWMAQ YL+   +KEME +G EYF  LA+RS
Sbjct: 401 DLPPAIKRCFSFCAVFPKDSVIKIDELIRLWMAQNYLNSDASKEMEMVGREYFEYLAARS 460

Query: 121 FFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHSGSSEESTMSSFEEKKIRHL 180
           FFQDF++  D +I  CKMHDIVHDFAQ+L  NEC  + + + + E  T +SF+  KIRH 
Sbjct: 461 FFQDFEKDGDDDIIRCKMHDIVHDFAQFLTKNECFIMNVEN-AEEGRTKTSFQ--KIRHA 517

Query: 181 MLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRK 240
            LI + R    +S +     ++ L + L+K    S S E LP LF  LTCLRALNL  R 
Sbjct: 518 TLIGQQRYPNFVSTYK----MKNLHTLLLKFTFSSTSDEALPNLFQHLTCLRALNL-ARN 572

Query: 241 PWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELP 300
           P      I E+P  + KL+HLKYL+L   +K+ +LPET+C+L+NL+ LN+  C +L ELP
Sbjct: 573 PL-----IMELPKAVGKLIHLKYLSLSDCHKLRELPETICDLYNLQTLNISRCFSLVELP 627

Query: 301 RGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLL 360
           + +GKL  L ++ N     L+ LP GI  L  L+ + + VV    D  C +G L+ LN L
Sbjct: 628 QAMGKLINLRHLQNCGALDLKGLPKGIARLNSLQTLEEFVVSSDGDAECKIGDLRNLNNL 687

Query: 361 R-ECTIRGLGGVSDAGEARRAELEKKKNL----------DEDERLLEALGPPPNLKKLQI 409
           R E  IRGL  V DA E ++AEL+ K ++          D  + + EAL P PNLK L I
Sbjct: 688 RGELEIRGLRKVEDAREVQKAELKNKIHIHHLTLVFDLKDGTKGVAEALHPHPNLKSLCI 747

Query: 410 YDYRGRRNVVPKNWIM--------DLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQSVKRV 461
           + Y    ++   +W+M        +L L  C  C  LPPLG+LP LE L+I+ M+SVK +
Sbjct: 748 WGY---GDIEWHDWMMRSSLTQLKNLELSHCSGCRCLPPLGELPVLEKLKIKDMESVKHI 804

Query: 462 GNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSC 521
           G EFLG       SS IAFP LKKL F NM+E E+W+     +    IMP LS L IQ C
Sbjct: 805 GGEFLG------SSSTIAFPNLKKLTFHNMKEWEKWEIKEEEEER-SIMPCLSYLEIQKC 857

Query: 522 PKLKALPDHLLQKSTLQKLE 541
           PKL+ LPDH+L  + LQ+  
Sbjct: 858 PKLEGLPDHVLHWTPLQEFH 877

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359482769\|ref\|XP_003632834.1\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147825450\|emb\|CAN71072.1\| hypothetical protein VITISV_000086 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482790\|ref\|XP_002268671.2\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482792\|ref\|XP_002268589.2\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482788\|ref\|XP_003632840.1\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359482784\|ref\|XP_002269044.2\| PREDICTED: putative disease resistance protein RGA4-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255549784\|ref\|XP_002515943.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223544848\|gb\|EEF46363.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224115608\|ref\|XP_002332098.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222874918\|gb\|EEF12049.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224115620\|ref\|XP_002332101.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222874921\|gb\|EEF12052.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		557
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.912	0.356	0.304	2.7e-49
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.926	0.489	0.285	1.4e-46
TAIR\|locus:2078012		852	ZAR1 "HOPZ-ACTIVATED RESISTANC	0.709	0.463	0.277	2.5e-28
TAIR\|locus:2171579		843	AT5G47250 [Arabidopsis thalian	0.256	0.169	0.357	1.1e-27
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.642	0.198	0.255	2e-27
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.263	0.165	0.320	7.5e-26
TAIR\|locus:2008440		899	AT1G61180 [Arabidopsis thalian	0.262	0.162	0.299	9.1e-26
TAIR\|locus:2197739		762	AT1G61300 [Arabidopsis thalian	0.262	0.191	0.305	2.8e-25
TAIR\|locus:2176486		908	RPP8 "RECOGNITION OF PERONOSPO	0.556	0.341	0.281	2.8e-25
TAIR\|locus:504956182		1049	AT1G58848 [Arabidopsis thalian	0.615	0.326	0.253	1.3e-24

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 516 (186.7 bits), Expect = 2.7e-49, Sum P(2) = 2.7e-49
 Identities = 177/582 (30%), Positives = 270/582 (46%)

Query:     2 IGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIKKGLLAPLLLSYNE 61
             IG+ I ++CKGLPLAA+ IAS LRSK    +W  + +N      +    +L  L LSY+ 
Sbjct:   358 IGKRIAEQCKGLPLAARAIASHLRSKPNPDDWYAVSKN----FSSYTNSILPVLKLSYDS 413

Query:    62 LPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSE-KGAKEMEDIGAEYFNILASRS 120
             LP ++K+CF  C++FPK +   +EEL+ LWMA   L + + ++ +EDIG +Y   L ++S
Sbjct:   414 LPPQLKRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQS 473

Query:   121 FFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHXXXXXXXXXXXXXXKKIRHL 180
             FFQ  D      +++  MHD+++D A+ +  + C  +E                   RH 
Sbjct:   474 FFQRLDI----TMTSFVMHDLMNDLAKAVSGDFCFRLEDDNIPEIPSTT--------RHF 521

Query:   181 MLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSS-----EVLPQLFDKLTCLRALN 235
                 R +    ++ + ++ G   LR+ L  +   S  S     +VL  L + L+ LR L+
Sbjct:   522 SFS-RSQCDASVA-FRSICGAEFLRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILS 579

Query:   236 LKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCEN 295
             L       S   I  +P +++ L  L+YL+L S  KI++LPE +C L NL+ L + +C +
Sbjct:   580 L-------SHYQITNLPKSLKGLKLLRYLDLSS-TKIKELPEFVCTLCNLQTLLLSNCRD 631

Query:   296 LRELPRGIGKLRKLMYIDNDDTDSLRYLP--VGIGELIRLRR-VTKLVVGGGYDRACSLG 352
             L  LP+ I +L  L  +D   T  +   P    +  L +L   V   + G G      L 
Sbjct:   632 LTSLPKSIAELINLRLLDLVGTPLVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELS 691

Query:   353 SLKKLNLLREC-TIRGLGGVSDAGEARRAXXXXXXXXXXXXXXXXALG------------ 399
              L+    + E   +       DAG  R+                   G            
Sbjct:   692 HLRGTLRISELQNVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEV 751

Query:   400 -----PPPNLKKLQIYDYRGRRNVVPKNWIMDLSLF--------RCRNCEHLPPLGKLPS 446
                  P P+LK   I  Y+G     PK W+ D S F         C  C  LPP+G+LPS
Sbjct:   752 LRMLEPHPHLKTFCIESYQG--GAFPK-WLGDSSFFGITSVTLSSCNLCISLPPVGQLPS 808

Query:   447 LEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGE 506
             L+YL IE    +++VG +F   E+++ G   + F  L+ L+F  M   +EW C     G 
Sbjct:   809 LKYLSIEKFNILQKVGLDFFFGENNSRG---VPFQSLQILKFYGMPRWDEWICPELEDG- 864

Query:   507 IIIMPRLSSLSIQSCPKL-KALPDHLLQKSTLQKLEIWGCPI 547
               I P L  L IQ CP L K  P+ L   ST  ++ I  CP+
Sbjct:   865 --IFPCLQKLIIQRCPSLRKKFPEGL-PSST--EVTISDCPL 901

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956182 AT1G58848 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00003279001	SubName- Full=Chromosome undetermined scaffold_141, whole genome shotgun sequence; (816 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		557
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	9e-30
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-05
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	9e-04

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  118 bits (297), Expect = 9e-30
 Identities = 48/98 (48%), Positives = 71/98 (72%), Gaps = 2/98 (2%)

Query: 2   IGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWELEAIK--KGLLAPLLLSY 59
           + +EIV+KCKGLPLA K +  LL  KST +EW+++LE    EL        +L+ L LSY
Sbjct: 183 VAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSY 242

Query: 60  NELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYL 97
           + LP  +K+CF Y A+FP+DY+I+KE+LI+LW+A+G++
Sbjct: 243 DNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFV 280

Length = 285

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		557
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.91
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.91
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.9
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.87
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.85
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.84
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.81
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.75
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.68
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.67
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.65
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.6
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.57
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.55
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.54
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.45
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.42
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.39
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.37
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.18
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.09
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.95
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.83
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.83
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.82
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.72
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.68
PLN03150		623	hypothetical protein; Provisional	98.59
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.59
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.58
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.56
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.54
PLN03150		623	hypothetical protein; Provisional	98.48
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.44
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.31
KOG4341		483	consensus F-box protein containing LRR [General fu	98.15
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.1
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.09
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.07
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.07
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.05
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.02
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.87
PRK15386		426	type III secretion protein GogB; Provisional	97.78
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.75
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.73
PRK15386		426	type III secretion protein GogB; Provisional	97.69
KOG4341		483	consensus F-box protein containing LRR [General fu	97.68
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.55
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.52
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.5
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.46
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.45
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.37
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.16
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.09
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.52
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.51
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.04
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.02
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.02
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.97
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.82
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.76
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.12
KOG0473		326	consensus Leucine-rich repeat protein [Function un	94.22
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	94.03
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.95
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.83
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.11
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.91
KOG3864		221	consensus Uncharacterized conserved protein [Funct	92.23
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	92.17
KOG1947		482	consensus Leucine rich repeat proteins, some prote	90.86
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	90.69
smart00370		26	LRR Leucine-rich repeats, outliers.	90.69
PRK04841		903	transcriptional regulator MalT; Provisional	88.37
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	83.63
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.3
smart00370		26	LRR Leucine-rich repeats, outliers.	83.3

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=5.3e-55  Score=464.38  Aligned_cols=481  Identities=28%  Similarity=0.454  Sum_probs=344.7

Q ss_pred             ChHHHHHHHcCCcHHHHHHHHHhhcCCCCHHHHHHHHhhhhhhh----hhhcccchhHHHHhhccCChhhhHHHhhhcCC
Q 039861            1 KIGREIVKKCKGLPLAAKTIASLLRSKSTEKEWQNILENEIWEL----EAIKKGLLAPLLLSYNELPSKVKQCFTYCAVF   76 (557)
Q Consensus         1 ~i~~~iv~~c~GlPLal~~~g~~L~~~~~~~~W~~~l~~~~~~~----~~~~~~i~~~l~~sy~~L~~~~k~cfl~~a~f   76 (557)
                      ++|++||++|+|||||+++||+.|+.|.+.++|+++.+.+.+..    ....+.|+++|++|||.||++.|.||+|||.|
T Consensus       343 ~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalF  422 (889)
T KOG4658|consen  343 ELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALF  422 (889)
T ss_pred             HHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccC
Confidence            47999999999999999999999999999999999999765542    22346799999999999999999999999999


Q ss_pred             CCCCccCHHHHHHHHHHcCCcCc-CCcccHHHHHHHHHHHHHhccCcccccCCCCCCeeeEEechHHHHHHHHhcc----
Q 039861           77 PKDYDIQKEELIELWMAQGYLSE-KGAKEMEDIGAEYFNILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCS----  151 (557)
Q Consensus        77 p~~~~i~~~~li~~w~a~g~~~~-~~~~~~~~~~~~~~~~L~~~~ll~~~~~~~~g~~~~~~mhdli~~~~~~i~~----  151 (557)
                      |+||.|+++.|+.+|+||||+.+ +++.+++|+|++|+.+|++++|++.....  ++...|+|||+||+||.++|+    
T Consensus       423 PED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~--~~~~~~kmHDvvRe~al~ias~~~~  500 (889)
T KOG4658|consen  423 PEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDE--GRKETVKMHDVVREMALWIASDFGK  500 (889)
T ss_pred             CcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccc--cceeEEEeeHHHHHHHHHHhccccc
Confidence            99999999999999999999988 44688999999999999999999987654  677789999999999999999    


Q ss_pred             -cceEEEeccCCCCCCCcccccccCceEEEEEEecCCCCcccccccccCCCCcceEEEeccCCccchhhhhHHHHhcCCc
Q 039861          152 -NECLTVEIHSGSSEESTMSSFEEKKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTC  230 (557)
Q Consensus       152 -~e~~~~~~~~~~~~~~~~~~~~~~~~r~l~l~~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~p~~~~~l~~  230 (557)
                       ++..++....+. .+.+ ...++..+|++++..+....++....     ++.|++|.+..|.. +.....+..|..++.
T Consensus       501 ~~e~~iv~~~~~~-~~~~-~~~~~~~~rr~s~~~~~~~~~~~~~~-----~~~L~tLll~~n~~-~l~~is~~ff~~m~~  572 (889)
T KOG4658|consen  501 QEENQIVSDGVGL-SEIP-QVKSWNSVRRMSLMNNKIEHIAGSSE-----NPKLRTLLLQRNSD-WLLEISGEFFRSLPL  572 (889)
T ss_pred             cccceEEECCcCc-cccc-cccchhheeEEEEeccchhhccCCCC-----CCccceEEEeecch-hhhhcCHHHHhhCcc
Confidence             666555443221 1122 22333789999999998876554432     66899999999863 244445666889999


Q ss_pred             eeEEEeccccCCCC-cCcccccchhhhcccCCCeeecccCCcccccchhhhccCcCcEeecCCccccccCcccccCCCCC
Q 039861          231 LRALNLKVRKPWSS-VNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETLCELHNLERLNVDDCENLRELPRGIGKLRKL  309 (557)
Q Consensus       231 L~~L~L~~~~~~~~-~~~l~~lp~~~~~l~~L~~L~L~~~~~l~~lp~~~~~l~~L~~L~l~~~~~l~~lp~~i~~L~~L  309 (557)
                      ||+|||       + +..+.++|++|+.|.+||||+++++. +..+|..+++|++|.+|++..+..+..+|.....|++|
T Consensus       573 LrVLDL-------s~~~~l~~LP~~I~~Li~LryL~L~~t~-I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~L  644 (889)
T KOG4658|consen  573 LRVLDL-------SGNSSLSKLPSSIGELVHLRYLDLSDTG-ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSL  644 (889)
T ss_pred             eEEEEC-------CCCCccCcCChHHhhhhhhhcccccCCC-ccccchHHHHHHhhheeccccccccccccchhhhcccc
Confidence            999999       5 44578999999999999999999999 99999999999999999999988777787766779999


Q ss_pred             cEeecCCCCCCCcccccccCcccccccCceEecCccCCccCccccccCCcCCCceecCCCCCCChhHHHHhhccCCCCCc
Q 039861          310 MYIDNDDTDSLRYLPVGIGELIRLRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAGEARRAELEKKKNLD  389 (557)
Q Consensus       310 ~~L~l~~~~~l~~~p~~i~~L~~L~~L~~~~~~~~~~~~~~l~~L~~L~~L~~l~i~~~~~~~~~~~~~~~~l~~l~~l~  389 (557)
                      ++|.+.... ...-...++++.+|++|.........  ...+..+..++.|+.+...-..             .   . .
T Consensus       645 r~L~l~~s~-~~~~~~~l~el~~Le~L~~ls~~~~s--~~~~e~l~~~~~L~~~~~~l~~-------------~---~-~  704 (889)
T KOG4658|consen  645 RVLRLPRSA-LSNDKLLLKELENLEHLENLSITISS--VLLLEDLLGMTRLRSLLQSLSI-------------E---G-C  704 (889)
T ss_pred             cEEEeeccc-cccchhhHHhhhcccchhhheeecch--hHhHhhhhhhHHHHHHhHhhhh-------------c---c-c
Confidence            999997652 11111234455555555554443322  1112223233333221111000             0   0 0


Q ss_pred             hHHhhhhcCCCCCCccEEEEeecCCcCCCCCccccc------------CccccCccccCCCCCCCCCCCcCeeeeccccC
Q 039861          390 EDERLLEALGPPPNLKKLQIYDYRGRRNVVPKNWIM------------DLSLFRCRNCEHLPPLGKLPSLEYLEIEGMQS  457 (557)
Q Consensus       390 ~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~l~------------~L~l~~~~~~~~l~~l~~l~~L~~L~l~~~~~  457 (557)
                      ........+..+.+|+.|.+.++.+..  ....|..            .+...+|.....+.+..-.|+|+.|.+..|..
T Consensus       705 ~~~~~~~~~~~l~~L~~L~i~~~~~~e--~~~~~~~~~~~~~~f~~l~~~~~~~~~~~r~l~~~~f~~~L~~l~l~~~~~  782 (889)
T KOG4658|consen  705 SKRTLISSLGSLGNLEELSILDCGISE--IVIEWEESLIVLLCFPNLSKVSILNCHMLRDLTWLLFAPHLTSLSLVSCRL  782 (889)
T ss_pred             ccceeecccccccCcceEEEEcCCCch--hhcccccccchhhhHHHHHHHHhhccccccccchhhccCcccEEEEecccc
Confidence            112334566778999999999998765  2123311            12445666666666666789999999999988


Q ss_pred             ceEecccccCCCCCCCCcccccccccccc-cccccccccccccccccccccccCCccceeeeccCccccCCCC
Q 039861          458 VKRVGNEFLGVESDTDGSSVIAFPKLKKL-EFRNMEELEEWDCGTAIKGEIIIMPRLSSLSIQSCPKLKALPD  529 (557)
Q Consensus       458 l~~~~~~~~~~~~~~~~~~~~~~~~L~~L-~l~~~~~l~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~lp~  529 (557)
                      ++.+..........  ...+..|+++..+ .+.+.+.+..+..      .--.+++|+.+.+..||+++.+|.
T Consensus       783 ~e~~i~~~k~~~~l--~~~i~~f~~~~~l~~~~~l~~l~~i~~------~~l~~~~l~~~~ve~~p~l~~~P~  847 (889)
T KOG4658|consen  783 LEDIIPKLKALLEL--KELILPFNKLEGLRMLCSLGGLPQLYW------LPLSFLKLEELIVEECPKLGKLPL  847 (889)
T ss_pred             cccCCCHHHHhhhc--ccEEecccccccceeeecCCCCceeEe------cccCccchhheehhcCcccccCcc
Confidence            77664432111100  0012345556666 3555555444432      112345588888888887777664

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		557
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-48
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	9e-46
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-20
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-17
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-06
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	4e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-20
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-06
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-06
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	7e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	9e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-10
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	7e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	4e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	3e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	6e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-04
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	9e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	7e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	8e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	4e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-07
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-06
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	5e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	3e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-04
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-05
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	5e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	7e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	8e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	9e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-05
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-05
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	3e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	3e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-05
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	4e-04
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	3e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	7e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-04
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	2e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	3e-04
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	4e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	6e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  177 bits (450), Expect = 1e-48
 Identities = 48/299 (16%), Positives = 96/299 (32%), Gaps = 51/299 (17%)

Query: 1   KIGREIVKKCKGLPLAAKTIASLLRSKSTE-KEWQNILENEIWELEAIKK-----GLLAP 54
           +    I+K+CKG PL    I +LLR      + +   L+N+ ++            L   
Sbjct: 308 EQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEA 367

Query: 55  LLLSYNELPSKVKQCFTYCAVFPKDYDIQKEELIELWMAQGYLSEKGAKEMEDIGAEYFN 114
           + +S   L   +K  +T  ++  KD  +  + L  LW  +            +   +   
Sbjct: 368 MSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDME-----------TEEVEDILQ 416

Query: 115 ILASRSFFQDFDRGDDGEISNCKMHDIVHDFAQYLCSNECLTVEIHSGSSEESTMSSFEE 174
              ++S         +G+     +HD+  DF        C  +        +        
Sbjct: 417 EFVNKSLLF---CDRNGKSFRYYLHDLQVDFLT---EKNCSQL--------QDLHKKIIT 462

Query: 175 KKIRHLMLIVRGRASVPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRAL 234
           +  R+           P ++  + +      +FL      +   + L  L   L  ++A 
Sbjct: 463 QFQRYH---------QPHTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIKA- 512

Query: 235 NLKVRKPWSSVNDIKEIPTNIEKLLHLKYLNLKSQNKIEKLPETL-CELHNLERLNVDD 292
             ++  P   +++  E         +   L+ K     E   E L    H L R    +
Sbjct: 513 KTELVGPAHLIHEFVE---------YRHILDEKDCAVSENFQEFLSLNGHLLGRQPFPN 562

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		557
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.94
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.93
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.93
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.92
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.92
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.92
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.92
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.91
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.91
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.91
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.91
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.91
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.91
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.91
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.9
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.9
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.89
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.89
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.89
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.89
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.89
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.89
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.88
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.88
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.88
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.88
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.87
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.87
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.87
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.86
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.86
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.86
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.84
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.83
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.83
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.83
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.83
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.82
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.81
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.81
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.81
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.81
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.8
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.79
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.78
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.77
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.76
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.76
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.75
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.75
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.75
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.74
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.73
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.72
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.71
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.7
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.7
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.69
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.68
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.68
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.68
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.68
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.68
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.66
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.66
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.64
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.64
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.64
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.64
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.64
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.63
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.61
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.6
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.59
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.58
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.58
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.58
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.57
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.54
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.53
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.53
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.52
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.52
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.52
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.51
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.51
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.51
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.51
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.49
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.48
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.47
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.46
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.46
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.45
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.45
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.43
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.43
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.42
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.42
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.41
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.39
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.38
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.38
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.37
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.36
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.33
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.33
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.32
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.3
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.3
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.29
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.29
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.28
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.26
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.24
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.24
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.23
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.23
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.2
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.2
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.19
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.12
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.07
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.06
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.03
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.03
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.95
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.8
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.74
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.68
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.57
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.55
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.38
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.38
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.31
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.1
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.01
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.0
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.93
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.9
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.86
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.85
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.76
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.63
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.23
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.93
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.18
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	94.63
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.46
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.35
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	91.97
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	86.75
2fna_A		357	Conserved hypothetical protein; structural genomic	85.3

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

Probab=99.94  E-value=3.5e-26  Score=248.22  Aligned_cols=340  Identities=14%  Similarity=0.167  Sum_probs=234.2

Q ss_pred             ccCceEEEEEEecCCCC------------------cccccccccCCCCcceEEEeccCCccchhhhhHHHHhcCCceeEE
Q 039861          173 EEKKIRHLMLIVRGRAS------------------VPISIWDNVKGLRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRAL  234 (557)
Q Consensus       173 ~~~~~r~l~l~~~~~~~------------------~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~p~~~~~l~~L~~L  234 (557)
                      ....++.|.+..+....                  +|..+.  |.++++|+.|++++|.   ..+.+|..|.++++|++|
T Consensus       446 ~L~~L~~L~Ls~N~Lsg~~i~~~~~~~s~n~~~g~iP~~l~--f~~L~~L~~L~Ls~N~---l~~~iP~~l~~L~~L~~L  520 (876)
T 4ecn_A          446 RLTKLQIIYFANSPFTYDNIAVDWEDANSDYAKQYENEELS--WSNLKDLTDVELYNCP---NMTQLPDFLYDLPELQSL  520 (876)
T ss_dssp             GCTTCCEEEEESCCCCGGGBSSSCSCTTSHHHHHHTTSCCC--GGGCTTCCEEEEESCT---TCCSCCGGGGGCSSCCEE
T ss_pred             cCCCCCEEECcCCcCCCCcccccccccccccccccCChhhh--hccCCCCCEEECcCCC---CCccChHHHhCCCCCCEE
Confidence            34678999999888776                  554432  1149999999999987   445578889999999999


Q ss_pred             EeccccCCCCcCc-cc--ccchhhhccc-------CCCeeecccCCcccccch--hhhccCcCcEeecCCccccccCccc
Q 039861          235 NLKVRKPWSSVND-IK--EIPTNIEKLL-------HLKYLNLKSQNKIEKLPE--TLCELHNLERLNVDDCENLRELPRG  302 (557)
Q Consensus       235 ~L~~~~~~~~~~~-l~--~lp~~~~~l~-------~L~~L~L~~~~~l~~lp~--~~~~l~~L~~L~l~~~~~l~~lp~~  302 (557)
                      +|       ++|. +.  .+|..++++.       +|++|++++|. +..+|.  .++++++|++|++++|. +..+| .
T Consensus       521 ~L-------s~N~~lsg~~iP~~i~~L~~~~~~l~~L~~L~Ls~N~-L~~ip~~~~l~~L~~L~~L~Ls~N~-l~~lp-~  590 (876)
T 4ecn_A          521 NI-------ACNRGISAAQLKADWTRLADDEDTGPKIQIFYMGYNN-LEEFPASASLQKMVKLGLLDCVHNK-VRHLE-A  590 (876)
T ss_dssp             EC-------TTCTTSCHHHHHHHHHHHHHCTTTTTTCCEEECCSSC-CCBCCCHHHHTTCTTCCEEECTTSC-CCBCC-C
T ss_pred             EC-------cCCCCcccccchHHHHhhhhcccccCCccEEEeeCCc-CCccCChhhhhcCCCCCEEECCCCC-cccch-h
Confidence            99       7776 76  4888888887       99999999998 779998  89999999999999987 66888 8


Q ss_pred             ccCCCCCcEeecCCCCCCCcccccccCccc-ccccCceEecCccCCccCccccccCCcCCCceecCCCCCCChh----HH
Q 039861          303 IGKLRKLMYIDNDDTDSLRYLPVGIGELIR-LRRVTKLVVGGGYDRACSLGSLKKLNLLRECTIRGLGGVSDAG----EA  377 (557)
Q Consensus       303 i~~L~~L~~L~l~~~~~l~~~p~~i~~L~~-L~~L~~~~~~~~~~~~~~l~~L~~L~~L~~l~i~~~~~~~~~~----~~  377 (557)
                      ++.+++|++|++++| .+..+|..++.+++ |+.|++..+.... .+..+..+ ...+|+.+.+++..-.....    ..
T Consensus       591 ~~~L~~L~~L~Ls~N-~l~~lp~~l~~l~~~L~~L~Ls~N~L~~-lp~~~~~~-~~~~L~~L~Ls~N~l~g~ip~l~~~l  667 (876)
T 4ecn_A          591 FGTNVKLTDLKLDYN-QIEEIPEDFCAFTDQVEGLGFSHNKLKY-IPNIFNAK-SVYVMGSVDFSYNKIGSEGRNISCSM  667 (876)
T ss_dssp             CCTTSEESEEECCSS-CCSCCCTTSCEECTTCCEEECCSSCCCS-CCSCCCTT-CSSCEEEEECCSSCTTTTSSSCSSCT
T ss_pred             hcCCCcceEEECcCC-ccccchHHHhhccccCCEEECcCCCCCc-Cchhhhcc-ccCCCCEEECcCCcCCCccccchhhh
Confidence            899999999999998 45688988999998 9999888776552 22222111 11225556665442211110    00


Q ss_pred             HHhhccCCCCCchHH----hhhhc-CCCCCCccEEEEeecCCcCCCCCcc-------------cccCccccCccccCCCC
Q 039861          378 RRAELEKKKNLDEDE----RLLEA-LGPPPNLKKLQIYDYRGRRNVVPKN-------------WIMDLSLFRCRNCEHLP  439 (557)
Q Consensus       378 ~~~~l~~l~~l~~~~----~~~~~-l~~~~~L~~L~l~~~~~~~~~~~~~-------------~l~~L~l~~~~~~~~l~  439 (557)
                      ......+++.+....    .++.. +..+++|+.|+|++|.+..  +|+.             .++.|++++|. +..+|
T Consensus       668 ~~~~~~~L~~L~Ls~N~L~~lp~~~~~~l~~L~~L~Ls~N~L~~--ip~~~~~~~~~~l~nl~~L~~L~Ls~N~-L~~lp  744 (876)
T 4ecn_A          668 DDYKGINASTVTLSYNEIQKFPTELFATGSPISTIILSNNLMTS--IPENSLKPKDGNYKNTYLLTTIDLRFNK-LTSLS  744 (876)
T ss_dssp             TTCCCCCEEEEECCSSCCCSCCHHHHHTTCCCSEEECCSCCCSC--CCTTSSSCTTSCCTTGGGCCEEECCSSC-CCCCC
T ss_pred             ccccCCCcCEEEccCCcCCccCHHHHccCCCCCEEECCCCcCCc--cChHHhccccccccccCCccEEECCCCC-Cccch
Confidence            000111222222111    11222 2356788888888887764  5443             34446777774 33666


Q ss_pred             C-CC--CCCCcCeeeeccccCceEecccccCCCCCCCCcccccccccccccccccccccccccccccccccccCCcccee
Q 039861          440 P-LG--KLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSL  516 (557)
Q Consensus       440 ~-l~--~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~L~~L  516 (557)
                      . +.  .+++|+.|+|++|. +..++..            +..+++|+.|++++++.+..-...+.+|..+..+++|+.|
T Consensus       745 ~~l~~~~l~~L~~L~Ls~N~-L~~lp~~------------l~~L~~L~~L~Ls~N~~ls~N~l~~~ip~~l~~L~~L~~L  811 (876)
T 4ecn_A          745 DDFRATTLPYLSNMDVSYNC-FSSFPTQ------------PLNSSQLKAFGIRHQRDAEGNRILRQWPTGITTCPSLIQL  811 (876)
T ss_dssp             GGGSTTTCTTCCEEECCSSC-CSSCCCG------------GGGCTTCCEEECCCCBCTTCCBCCCCCCTTGGGCSSCCEE
T ss_pred             HHhhhccCCCcCEEEeCCCC-CCccchh------------hhcCCCCCEEECCCCCCcccccccccChHHHhcCCCCCEE
Confidence            4 44  78889999988864 3333332            4568899999998754222211134567788999999999


Q ss_pred             eeccCccccCCCCCcCCCCCcceEEEecCCCcc
Q 039861          517 SIQSCPKLKALPDHLLQKSTLQKLEIWGCPILK  549 (557)
Q Consensus       517 ~l~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~  549 (557)
                      ++++|. ++.+|..+.  ++|+.|++++|+...
T Consensus       812 ~Ls~N~-L~~Ip~~l~--~~L~~LdLs~N~l~~  841 (876)
T 4ecn_A          812 QIGSND-IRKVDEKLT--PQLYILDIADNPNIS  841 (876)
T ss_dssp             ECCSSC-CCBCCSCCC--SSSCEEECCSCTTCE
T ss_pred             ECCCCC-CCccCHhhc--CCCCEEECCCCCCCc
Confidence            999995 599998754  699999999998643

PyMOL of 4ecn

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		557
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-10
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	3e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	3e-05
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	9e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	7e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.001
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.002
d1m9la_		198	c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree	0.004

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 59.4 bits (143), Expect = 2e-10
 Identities = 12/74 (16%), Positives = 23/74 (31%), Gaps = 8/74 (10%)

Query: 1   KIGREIVKKCKGLPLAAKTIASLLRSKSTE--KEWQNILENEIWELEAIKKGLLAPLLLS 58
            +  + ++   G P            K+ E   +  N LE+          G+      S
Sbjct: 209 DVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLV------GVECITPYS 262

Query: 59  YNELPSKVKQCFTY 72
           Y  L   +++C   
Sbjct: 263 YKSLAMALQRCVEV 276

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		557
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.81
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.81
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.78
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.72
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.7
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.63
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.62
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.58
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.57
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.54
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.5
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.5
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.5
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.47
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.41
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.41
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.4
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.39
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.38
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.38
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.33
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.31
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.31
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.17
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.13
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.12
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.09
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.09
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.96
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.82
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.77
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.74
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.58
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.35
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.06
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.97
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.9
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.67
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.9
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.72
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.51

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.81  E-value=1e-20  Score=181.71  Aligned_cols=258  Identities=17%  Similarity=0.168  Sum_probs=177.6

Q ss_pred             CCcceEEEeccCCccchhhhhHHHHhcCCceeEEEeccccCCCCc-Cccc-ccchhhhcccCCCeeecccCCcccccchh
Q 039861          201 LRGLRSFLVKSDEYSWSSEVLPQLFDKLTCLRALNLKVRKPWSSV-NDIK-EIPTNIEKLLHLKYLNLKSQNKIEKLPET  278 (557)
Q Consensus       201 l~~L~~L~l~~~~~~~~~~~~p~~~~~l~~L~~L~L~~~~~~~~~-~~l~-~lp~~~~~l~~L~~L~L~~~~~l~~lp~~  278 (557)
                      -.+++.|++.++...... .+|..++++++|++|+|       ++ |.+. .+|.+|++|++|++|+|++|......|..
T Consensus        49 ~~~v~~L~L~~~~l~g~~-~lp~~l~~L~~L~~L~L-------s~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~  120 (313)
T d1ogqa_          49 TYRVNNLDLSGLNLPKPY-PIPSSLANLPYLNFLYI-------GGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDF  120 (313)
T ss_dssp             CCCEEEEEEECCCCSSCE-ECCGGGGGCTTCSEEEE-------EEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGG
T ss_pred             cEEEEEEECCCCCCCCCC-CCChHHhcCcccccccc-------ccccccccccccccccccccchhhhcccccccccccc
Confidence            346888999988754322 25777999999999999       54 5665 78999999999999999999833344577


Q ss_pred             hhccCcCcEeecCCccccccCcccccCCCCCcEeecCCCCCCCcccccccCcccc-cccCceEecCccCCccCccccccC
Q 039861          279 LCELHNLERLNVDDCENLRELPRGIGKLRKLMYIDNDDTDSLRYLPVGIGELIRL-RRVTKLVVGGGYDRACSLGSLKKL  357 (557)
Q Consensus       279 ~~~l~~L~~L~l~~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~~p~~i~~L~~L-~~L~~~~~~~~~~~~~~l~~L~~L  357 (557)
                      +..+.+|+++++++|.....+|..++++++|+++++++|.....+|..++.+..+ +.+....+.               
T Consensus       121 ~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~---------------  185 (313)
T d1ogqa_         121 LSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR---------------  185 (313)
T ss_dssp             GGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSE---------------
T ss_pred             ccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccccccccccc---------------
Confidence            8899999999999988888889999999999999999986666777777666554 222211111               


Q ss_pred             CcCCCceecCCCCCCChhHHHHhhccCCCCCchHHhhhhcCCCCCCccEEEEeecCCcCCCCCcccccCccccCccccCC
Q 039861          358 NLLRECTIRGLGGVSDAGEARRAELEKKKNLDEDERLLEALGPPPNLKKLQIYDYRGRRNVVPKNWIMDLSLFRCRNCEH  437 (557)
Q Consensus       358 ~~L~~l~i~~~~~~~~~~~~~~~~l~~l~~l~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~l~~L~l~~~~~~~~  437 (557)
                             +.+.                         .+..+..+ ....+++..+...                    ..
T Consensus       186 -------l~~~-------------------------~~~~~~~l-~~~~l~l~~~~~~--------------------~~  212 (313)
T d1ogqa_         186 -------LTGK-------------------------IPPTFANL-NLAFVDLSRNMLE--------------------GD  212 (313)
T ss_dssp             -------EEEE-------------------------CCGGGGGC-CCSEEECCSSEEE--------------------EC
T ss_pred             -------cccc-------------------------cccccccc-ccccccccccccc--------------------cc
Confidence                   0000                         00111111 2224444433322                    22


Q ss_pred             CCC-CCCCCCcCeeeeccccCceEecccccCCCCCCCCcccccccccccccccccccccccccccccccccccCCcccee
Q 039861          438 LPP-LGKLPSLEYLEIEGMQSVKRVGNEFLGVESDTDGSSVIAFPKLKKLEFRNMEELEEWDCGTAIKGEIIIMPRLSSL  516 (557)
Q Consensus       438 l~~-l~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~l~~L~~L  516 (557)
                      +|. ++.+++|+.++++++. +...+..            +..+++|+.|+++++..      .+.+|..++.+++|++|
T Consensus       213 ~~~~~~~~~~l~~l~~~~~~-l~~~~~~------------~~~~~~L~~L~Ls~N~l------~g~iP~~l~~L~~L~~L  273 (313)
T d1ogqa_         213 ASVLFGSDKNTQKIHLAKNS-LAFDLGK------------VGLSKNLNGLDLRNNRI------YGTLPQGLTQLKFLHSL  273 (313)
T ss_dssp             CGGGCCTTSCCSEEECCSSE-ECCBGGG------------CCCCTTCCEEECCSSCC------EECCCGGGGGCTTCCEE
T ss_pred             cccccccccccccccccccc-ccccccc------------cccccccccccCccCee------cccCChHHhCCCCCCEE
Confidence            232 5678899999988754 2211111            34578999999998653      23457889999999999


Q ss_pred             eeccCccccCCCCCcCCCCCcceEEEecCCCcccc--ccc
Q 039861          517 SIQSCPKLKALPDHLLQKSTLQKLEIWGCPILKER--VSC  554 (557)
Q Consensus       517 ~l~~c~~l~~lp~~~~~l~~L~~L~l~~c~~l~~~--~~~  554 (557)
                      ++++|..-..+|+. .++++|+.+++++|+.+...  +.|
T Consensus       274 ~Ls~N~l~g~iP~~-~~L~~L~~l~l~~N~~l~g~plp~c  312 (313)
T d1ogqa_         274 NVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSPLPAC  312 (313)
T ss_dssp             ECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTTSSCC
T ss_pred             ECcCCcccccCCCc-ccCCCCCHHHhCCCccccCCCCCCC
Confidence            99999644488864 66889999999999987643  455

PyMOL of d1ogqa_

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure