Citrus Sinensis ID: 039865


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
cccccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHccccHHHHcccccccHHHcccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHcc
ccccHHHHHHHHHHcccHHHHHcccccccHHHHHHHcccHHHHHHHHHccccHHcccccccccHHHHHHHcccHHHHHHHHHccccHHHHHccccccHHHHHHcccccHHHHHHHHcccEEEEEcccccccccccccccccccccccc
SLLGHLDFVQEILRRKpelagaldsrkaspLHLAAAKGYLDIVLKLVSfnpemcfardidgknplHIAAIRRHVNVLKELVKGRPQAALILMERGVTILhacddngnTILHLAVLEKQVEVFYMdfdgnnmdsnifygcglsgyglss
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFygcglsgyglss
*****LDFVQEILR***************PLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYG***
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
*LLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q9ZU96 532 Ankyrin repeat-containing no no 0.722 0.201 0.322 5e-09
Q6AWW5 524 Ankyrin repeat-containing no no 0.797 0.225 0.283 1e-08
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.885 0.132 0.311 1e-07
Q9C7A2 590 Ankyrin repeat-containing no no 0.837 0.210 0.272 4e-07
Q6GNY1 1011 E3 ubiquitin-protein liga N/A no 0.783 0.114 0.296 6e-07
Q804S5 1030 E3 ubiquitin-protein liga yes no 0.743 0.106 0.294 9e-07
Q86YT6 1006 E3 ubiquitin-protein liga yes no 0.743 0.109 0.294 4e-06
Q80SY4 1006 E3 ubiquitin-protein liga yes no 0.743 0.109 0.294 4e-06
Q9ET47 871 Espin OS=Mus musculus GN= no no 0.851 0.144 0.322 1e-05
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.831 0.065 0.307 1e-05
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 11/118 (9%)

Query: 4   GHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKN 63
           GHL  V+E+LR  PEL    D+   SPL+ AA + +L+IV  ++  +P        +GK 
Sbjct: 105 GHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGKT 164

Query: 64  PLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEV 121
            LH A     + ++K L+           E+   I+   D  G T LH+AV  + +EV
Sbjct: 165 SLHTAGRYGLLRIVKALI-----------EKDAAIVGVKDKKGQTALHMAVKGRSLEV 211





Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 Back     alignment and function description
>sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 Back     alignment and function description
>sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 Back     alignment and function description
>sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
343887296232 hypothetical protein [Citrus unshiu] 0.939 0.599 0.792 7e-66
343887311 473 ankyrin repeat family protein [Citrus un 0.966 0.302 0.547 3e-43
343887301 470 Ankyrin repeat family protein [Citrus un 0.824 0.259 0.612 1e-40
343887300 469 ankyrin repeat family protein [Citrus un 0.966 0.304 0.535 8e-40
296081692 444 unnamed protein product [Vitis vinifera] 0.959 0.319 0.479 2e-34
359475962 486 PREDICTED: ankyrin repeat-containing pro 0.959 0.292 0.479 3e-34
343887299 477 ankyrin repeat family protein [Citrus un 0.817 0.253 0.479 9e-30
224092119 471 predicted protein [Populus trichocarpa] 0.959 0.301 0.413 1e-29
255560687 431 ankyrin repeat-containing protein, putat 0.817 0.280 0.484 2e-26
359475964 491 PREDICTED: ankyrin repeat-containing pro 0.966 0.291 0.449 2e-25
>gi|343887296|dbj|BAK61842.1| hypothetical protein [Citrus unshiu] Back     alignment and taxonomy information
 Score =  254 bits (649), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 133/164 (81%), Gaps = 25/164 (15%)

Query: 10  QEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAA 69
           QEILRRKPE AG LDSRKASPLHLAAAKGYLDIVLKLVS NPEMCFARDIDGKNPLHIAA
Sbjct: 68  QEILRRKPEQAGELDSRKASPLHLAAAKGYLDIVLKLVSVNPEMCFARDIDGKNPLHIAA 127

Query: 70  IRRHVNVLKELVKGRPQAALILMERGVTILHAC-------------------------DD 104
           IR +VNVLKELVK RPQAALILMERGVTILHAC                         DD
Sbjct: 128 IRGNVNVLKELVKVRPQAALILMERGVTILHACVNYNQLESLRLLVEIRNDHEFVNSKDD 187

Query: 105 NGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLSS 148
           NG+TILHLAVLEKQVEVFYMDFD NNMD+NIFYGCGLSGYGLSS
Sbjct: 188 NGSTILHLAVLEKQVEVFYMDFDRNNMDNNIFYGCGLSGYGLSS 231




Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|343887311|dbj|BAK61857.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|343887301|dbj|BAK61847.1| Ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|343887300|dbj|BAK61846.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|296081692|emb|CBI20697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475962|ref|XP_002279591.2| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|343887299|dbj|BAK61845.1| ankyrin repeat family protein [Citrus unshiu] Back     alignment and taxonomy information
>gi|224092119|ref|XP_002309480.1| predicted protein [Populus trichocarpa] gi|222855456|gb|EEE93003.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255560687|ref|XP_002521357.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223539435|gb|EEF41025.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359475964|ref|XP_002279612.2| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2012873 578 AT1G10340 "AT1G10340" [Arabido 0.560 0.143 0.309 3.6e-10
TAIR|locus:2075009 607 AT3G09550 [Arabidopsis thalian 0.864 0.210 0.294 1.9e-09
TAIR|locus:2065434 532 AT2G01680 "AT2G01680" [Arabido 0.722 0.201 0.347 4.1e-09
TAIR|locus:2172089 426 ANK "ankyrin" [Arabidopsis tha 0.675 0.234 0.33 4.6e-09
TAIR|locus:2172099 431 AT5G54620 [Arabidopsis thalian 0.736 0.252 0.308 4.7e-09
TAIR|locus:2176252 442 AT5G51160 "AT5G51160" [Arabido 0.655 0.219 0.345 4.9e-09
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.797 0.178 0.290 5.7e-09
DICTYBASE|DDB_G0287459 986 secG "Arf guanyl-nucleotide ex 0.824 0.123 0.317 9.6e-09
TAIR|locus:2180882 457 AT5G15500 [Arabidopsis thalian 0.763 0.247 0.283 1.4e-08
TAIR|locus:2129685 694 AT4G14390 "AT4G14390" [Arabido 0.851 0.181 0.318 2.7e-08
TAIR|locus:2012873 AT1G10340 "AT1G10340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 131 (51.2 bits), Expect = 3.6e-10, Sum P(2) = 3.6e-10
 Identities = 26/84 (30%), Positives = 50/84 (59%)

Query:     4 GHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKN 63
             GH + V +I+  +P L  + ++ + +PLHLAA  G ++IV++++    E+C AR+I+   
Sbjct:    48 GHRELVSKIIELRPSLVSSRNAYRNTPLHLAAILGDVNIVMQMLETGLEVCSARNINNHT 107

Query:    64 PLHIAAIRRHVNVLKELVKGRPQA 87
             PLH+A     +   + L+  + Q+
Sbjct:   108 PLHLACRSNSIEAAR-LIAEKTQS 130


GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0009581 "detection of external stimulus" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065434 AT2G01680 "AT2G01680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172089 ANK "ankyrin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172099 AT5G54620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176252 AT5G51160 "AT5G51160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287459 secG "Arf guanyl-nucleotide exchange factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2180882 AT5G15500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00061573
hypothetical protein (471 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-14
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 67.0 bits (164), Expect = 4e-15
 Identities = 42/118 (35%), Positives = 66/118 (55%), Gaps = 14/118 (11%)

Query: 4   GHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKN 63
           GHL+ V+ +L    ++  A D+   +PLHLAA  G+L+IV  L+    ++  ARD DG  
Sbjct: 18  GHLEVVKLLLENGADVN-AKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVN-ARDKDGNT 75

Query: 64  PLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEV 121
           PLH+AA   +++V+K           +L++ G   ++A D +G T LHLA     +EV
Sbjct: 76  PLHLAARNGNLDVVK-----------LLLKHG-ADVNARDKDGRTPLHLAAKNGHLEV 121


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.94
PHA02874 434 ankyrin repeat protein; Provisional 99.92
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.92
PHA02875 413 ankyrin repeat protein; Provisional 99.92
PHA02791284 ankyrin-like protein; Provisional 99.92
PHA02946 446 ankyin-like protein; Provisional 99.92
KOG0508 615 consensus Ankyrin repeat protein [General function 99.91
PHA02798 489 ankyrin-like protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.9
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.9
PHA03100 480 ankyrin repeat protein; Provisional 99.9
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.9
PHA02874 434 ankyrin repeat protein; Provisional 99.9
PHA02989 494 ankyrin repeat protein; Provisional 99.89
PHA02878 477 ankyrin repeat protein; Provisional 99.89
PHA02878 477 ankyrin repeat protein; Provisional 99.89
PHA02791284 ankyrin-like protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
PHA02946 446 ankyin-like protein; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.89
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.88
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.88
KOG0508 615 consensus Ankyrin repeat protein [General function 99.87
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.87
PHA02795 437 ankyrin-like protein; Provisional 99.86
PHA03100 480 ankyrin repeat protein; Provisional 99.86
KOG0510 929 consensus Ankyrin repeat protein [General function 99.86
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA02876 682 ankyrin repeat protein; Provisional 99.86
PHA02876 682 ankyrin repeat protein; Provisional 99.85
PHA02798 489 ankyrin-like protein; Provisional 99.85
KOG0510 929 consensus Ankyrin repeat protein [General function 99.85
PHA02741169 hypothetical protein; Provisional 99.85
PHA02741169 hypothetical protein; Provisional 99.85
PHA02884 300 ankyrin repeat protein; Provisional 99.84
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.83
PHA02917 661 ankyrin-like protein; Provisional 99.82
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.82
PHA02917 661 ankyrin-like protein; Provisional 99.82
PHA02989 494 ankyrin repeat protein; Provisional 99.81
PHA02795 437 ankyrin-like protein; Provisional 99.8
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.8
KOG0514452 consensus Ankyrin repeat protein [General function 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.8
PHA02730 672 ankyrin-like protein; Provisional 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
PHA02884 300 ankyrin repeat protein; Provisional 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.76
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.76
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.74
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.74
PHA02730 672 ankyrin-like protein; Provisional 99.74
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.73
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.73
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.72
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.72
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.71
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.7
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.7
KOG0514452 consensus Ankyrin repeat protein [General function 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
PHA02792 631 ankyrin-like protein; Provisional 99.68
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.68
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
PHA02792 631 ankyrin-like protein; Provisional 99.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.66
PHA02736154 Viral ankyrin protein; Provisional 99.64
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.63
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.61
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.6
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.59
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.59
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.56
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.41
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.41
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.34
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.32
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.32
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.25
PF1360630 Ank_3: Ankyrin repeat 99.08
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.06
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.06
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.05
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.95
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.95
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.93
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.92
PF1360630 Ank_3: Ankyrin repeat 98.83
KOG0522 560 consensus Ankyrin repeat protein [General function 98.79
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.66
KOG2384223 consensus Major histocompatibility complex protein 98.65
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.61
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.59
KOG0511 516 consensus Ankyrin repeat protein [General function 98.46
KOG0522 560 consensus Ankyrin repeat protein [General function 98.46
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.45
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.4
KOG0511 516 consensus Ankyrin repeat protein [General function 98.32
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.31
KOG2384 223 consensus Major histocompatibility complex protein 98.07
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.93
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.82
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.67
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.64
KOG2505591 consensus Ankyrin repeat protein [General function 97.52
KOG2505 591 consensus Ankyrin repeat protein [General function 97.16
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.14
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.09
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.37
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.04
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.11
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 87.1
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 86.22
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.96  E-value=2.2e-30  Score=155.24  Aligned_cols=133  Identities=22%  Similarity=0.265  Sum_probs=101.3

Q ss_pred             CCCCcHHHHHHHHHhCCccccccCCCCCcHHHHHHHcCCHHHHHHHHhc-CCCccccCCCCCChHHHHHHHhCCHHHHHH
Q 039865            1 SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSF-NPEMCFARDIDGKNPLHIAAIRRHVNVLKE   79 (148)
Q Consensus         1 a~~g~~~~v~~ll~~~~~~~~~~~~~g~~~l~~a~~~g~~~~~~~Ll~~-~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~   79 (148)
                      |..|+.+++++|+++-...++.+|..||||||+|++.|+.++++.|+.+ ++++ +.....|.||||||+..|..++.++
T Consensus        46 ~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~adv-na~tn~G~T~LHyAagK~r~eIaql  124 (226)
T KOG4412|consen   46 CSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADV-NATTNGGQTCLHYAAGKGRLEIAQL  124 (226)
T ss_pred             eecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCc-ceecCCCcceehhhhcCChhhHHHH
Confidence            4578899999999755444577888899999999999999999999988 8887 8888999999999999999999999


Q ss_pred             HHhcChhHHHHHhhcCCchhhhcccCCCceeeeeeeeCCcceeEeccCCCCCCcccccCCCCCCCCCC
Q 039865           80 LVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLS  147 (148)
Q Consensus        80 ll~~~~~~~~~~~~~g~~~~~~~~~~g~t~l~~a~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~a  147 (148)
                      |++.++.            +.+.|..|+||||.|+..|..+++++|+..+. ..+..+..|.||++.|
T Consensus       125 Lle~ga~------------i~~kD~~~qtplHRAAavGklkvie~Li~~~a-~~n~qDk~G~TpL~~a  179 (226)
T KOG4412|consen  125 LLEKGAL------------IRIKDKQGQTPLHRAAAVGKLKVIEYLISQGA-PLNTQDKYGFTPLHHA  179 (226)
T ss_pred             HHhcCCC------------CcccccccCchhHHHHhccchhhHHHHHhcCC-CCCcccccCccHHHHH
Confidence            9996543            35556666677777766677777766666443 4555555555555543



>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-09
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 5e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 7e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 2e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 6e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-07
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 5e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-05
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-06
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-05
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-06
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 6e-06
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 8e-06
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-04
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 6e-04
1ycs_B239 P53-53bp2 Complex Length = 239 7e-04
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure

Iteration: 1

Score = 58.5 bits (140), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 42/121 (34%), Positives = 66/121 (54%), Gaps = 14/121 (11%) Query: 4 GHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKN 63 GHL+ V+ +L ++ A D +PLHLAA G+L++V L+ ++ A+D +G+ Sbjct: 13 GHLEVVKLLLEAGADV-NAKDKNGRTPLHLAARNGHLEVVKLLLEAGADVN-AKDKNGRT 70 Query: 64 PLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFY 123 PLH+AA H+ V+K +L+E G + +A D NG T LHLA +EV Sbjct: 71 PLHLAARNGHLEVVK-----------LLLEAGADV-NAKDKNGRTPLHLAARNGHLEVVK 118 Query: 124 M 124 + Sbjct: 119 L 119
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-15
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-09
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-11
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-11
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-10
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-11
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-10
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 1e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-14
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-13
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-12
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-13
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-11
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-11
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-12
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-13
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-12
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 8e-12
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-09
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 8e-07
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-09
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-07
2etb_A256 Transient receptor potential cation channel subfam 9e-13
2etb_A256 Transient receptor potential cation channel subfam 3e-09
2etb_A 256 Transient receptor potential cation channel subfam 3e-06
2etb_A256 Transient receptor potential cation channel subfam 3e-06
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-10
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-09
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-08
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-12
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-11
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-12
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-04
2rfa_A232 Transient receptor potential cation channel subfa 3e-12
2rfa_A 232 Transient receptor potential cation channel subfa 3e-11
2rfa_A232 Transient receptor potential cation channel subfa 6e-11
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A 232 Transient receptor potential cation channel subfa 2e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-11
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-04
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-11
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-10
3hra_A 201 Ankyrin repeat family protein; structural protein; 6e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-10
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-08
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-12
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-10
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-10
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-06
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-11
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-11
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-11
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
2pnn_A273 Transient receptor potential cation channel subfa 5e-11
2pnn_A273 Transient receptor potential cation channel subfa 5e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-07
2pnn_A273 Transient receptor potential cation channel subfa 2e-06
2pnn_A 273 Transient receptor potential cation channel subfa 4e-06
2pnn_A 273 Transient receptor potential cation channel subfa 2e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3jxi_A 260 Vanilloid receptor-related osmotically activated p 3e-04
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-10
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-09
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-09
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-09
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-09
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 6e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-05
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-05
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
 Score = 69.0 bits (170), Expect = 9e-16
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 17/120 (14%)

Query: 4   GHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSF--NPEMCFARDIDG 61
           G LD ++E LR+   L    D R  +PL  A+A G ++ V  L+ +  +P        + 
Sbjct: 13  GELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGADPH---ILAKER 69

Query: 62  KNPLHIAAIRRHVNVLKELVKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEV 121
           ++ L +A+   +     ++V        +L+ER V I +  D NG T L  AV    V+ 
Sbjct: 70  ESALSLASTGGY----TDIVG-------LLLERDVDI-NIYDWNGGTPLLYAVRGNHVKC 117


>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.95
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.93
2rfa_A232 Transient receptor potential cation channel subfa 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
2etb_A256 Transient receptor potential cation channel subfam 99.92
2pnn_A273 Transient receptor potential cation channel subfa 99.92
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.91
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.91
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.91
3hra_A201 Ankyrin repeat family protein; structural protein; 99.91
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.91
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.9
2etb_A256 Transient receptor potential cation channel subfam 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.9
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.85
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.76
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.97  E-value=4e-33  Score=171.72  Aligned_cols=132  Identities=31%  Similarity=0.396  Sum_probs=120.5

Q ss_pred             CCCCcHHHHHHHHHhCCccccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCccccCCCCCChHHHHHHHhCCHHHHHHH
Q 039865            1 SLLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKEL   80 (148)
Q Consensus         1 a~~g~~~~v~~ll~~~~~~~~~~~~~g~~~l~~a~~~g~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~l   80 (148)
                      |..|+.++|+.|+++|+++ +.+|..|.||||+|+..++.+++++|++.|+++ +.++..|.||||+|+..|+.+++++|
T Consensus        12 a~~G~~~~v~~Ll~~Gadv-n~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~-~~~d~~g~TpLh~A~~~g~~~~v~~L   89 (169)
T 4gpm_A           12 AENGNKDRVKDLIENGADV-NASDSDGRTPLHHAAENGHKEVVKLLISKGADV-NAKDSDGRTPLHHAAENGHKEVVKLL   89 (169)
T ss_dssp             HHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT-TCCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             HHcCCHHHHHHHHHCCCCC-CCcCCCCCCHHHHHHHcCCHHHHHHHHhcccch-hhhccCCCCHHHHHHHcCCHHHHHHH
Confidence            3579999999999999998 999999999999999999999999999999998 89999999999999999999999999


Q ss_pred             HhcChhHHHHHhhcCCchhhhcccCCCceeeeeeeeCCcceeEeccCCCCCCcccccCCCCCCCCCC
Q 039865           81 VKGRPQAALILMERGVTILHACDDNGNTILHLAVLEKQVEVFYMDFDGNNMDSNIFYGCGLSGYGLS  147 (148)
Q Consensus        81 l~~~~~~~~~~~~~g~~~~~~~~~~g~t~l~~a~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~a  147 (148)
                      ++.+++            ++..|..|+||||+|+..|+.+++++|++.+. +++..+..+.||+++|
T Consensus        90 l~~gad------------vn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~ga-d~~~~d~~G~TpL~~A  143 (169)
T 4gpm_A           90 ISKGAD------------VNAKDSDGRTPLHHAAENGHKEVVKLLISKGA-DVNTSDSDGRTPLDLA  143 (169)
T ss_dssp             HHTTCC------------TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC-CTTCCCTTSCCHHHHH
T ss_pred             HHCcCC------------CCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCC-CccccCCCCCCHHHHH
Confidence            996655            47778899999999999999999999998655 7888888888988776



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-12
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-09
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-08
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-09
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-07
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-08
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.001
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-07
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.004
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-07
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.5 bits (148), Expect = 1e-12
 Identities = 23/95 (24%), Positives = 38/95 (40%), Gaps = 13/95 (13%)

Query: 30  PLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELVKGRPQAAL 89
           PLH+A+  G+L IV  L+          ++  + PLH+AA   H  V K           
Sbjct: 3   PLHVASFMGHLPIVKNLLQRGASPN-VSNVKVETPLHMAARAGHTEVAK----------- 50

Query: 90  ILMERGVTILHACDDNGNTILHLAVLEKQVEVFYM 124
            L++    + +A   +  T LH A       +  +
Sbjct: 51  YLLQNKAKV-NAKAKDDQTPLHCAARIGHTNMVKL 84


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.94
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.86
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.85
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.84
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.82
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.8
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.8
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.79
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.78
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.76
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.74
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.72
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.94  E-value=5.8e-28  Score=139.12  Aligned_cols=100  Identities=25%  Similarity=0.249  Sum_probs=92.9

Q ss_pred             CCCcHHHHHHHHHhCCccccccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCccccCCCCCChHHHHHHHhCCHHHHHHHH
Q 039865            2 LLGHLDFVQEILRRKPELAGALDSRKASPLHLAAAKGYLDIVLKLVSFNPEMCFARDIDGKNPLHIAAIRRHVNVLKELV   81 (148)
Q Consensus         2 ~~g~~~~v~~ll~~~~~~~~~~~~~g~~~l~~a~~~g~~~~~~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~ll   81 (148)
                      ..|+.+++++|+++|+++ +.++..|+||||+|+..|+.+++++|+++|+++ +.++..|.||||+|+..++.+++++|+
T Consensus        11 ~~g~~~~v~~Ll~~g~d~-n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~di-n~~d~~g~tpLh~A~~~~~~~~v~~Ll   88 (118)
T d1myoa_          11 KNGDLDEVKDYVAKGEDV-NRTLEGGRKPLHYAADCGQLEILEFLLLKGADI-NAPDKHHITPLLSAVYEGHVSCVKLLL   88 (118)
T ss_dssp             HTTCHHHHHHHHTTTCCC-CCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTT-TCCSSSCSCHHHHHHTTTCCHHHHHHH
T ss_pred             HCCCHHHHHHHHHhhhcc-cccccccccccccccccccccccccccccccee-eecccccccchhhhhhcCchhhhhhhh
Confidence            579999999999999997 999999999999999999999999999999998 899999999999999999999999999


Q ss_pred             hcChhHHHHHhhcCCchhhhcccCCCceeeeeee
Q 039865           82 KGRPQAALILMERGVTILHACDDNGNTILHLAVL  115 (148)
Q Consensus        82 ~~~~~~~~~~~~~g~~~~~~~~~~g~t~l~~a~~  115 (148)
                      +.+++            ++..|..|+||||+|..
T Consensus        89 ~~Gad------------~~~~d~~G~t~l~~a~~  110 (118)
T d1myoa_          89 SKGAD------------KTVKGPDGLTALEATDN  110 (118)
T ss_dssp             TTCCC------------SSSSSSSTCCCCCTCSS
T ss_pred             ccccc------------ceeeCCCCCCHHHHHhH
Confidence            96655            47789999999999843



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure