Citrus Sinensis ID: 039899


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
cccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccHHHHHHHHHHcccccccccEEEcccccccccccccccccEEEEEcccccccccccEEEEEEEEEccccccccccccccccEEEEEcccccccEEEEEcccccccccccEEEEEEEcccccccccccccccEEEEEEEccccccEEEEEEEEEEEEccccccccccccccccccccccccccccEEEEccHHHHccccEEEEEEEccccccccccccccEEEEccEEEEccccHHHHHHHHHHHHHc
cccccccccccEEccccccccHHHccccHHcHHcccEEEccccccEEccccHHHHHcccEEEcccccHHcccccccccccEEEcccccHHccccccHHHHHHHcHHHHHHHHcccEEcccccccHHHcccccccEEEEEcccccccccccEEEEEEEEEccccccccccccEEEEEEEEccccccEEEcccccccccccccccEEEEEEEccccccccEEEEEEEEEEEEEEccccccEEEEEcEEEEEEcccccccccccccccccEEcccccccccEEEEHHHcccccccccccccEEEccccccHccccccccccHHHHHHHHHHHHHHHHHHHHHcc
lpsllglcsltkldisdcnlgegaipsdigniCSLKelylsknrffslpASINLLSKLWIIELEECqrlqslpqlpsnieqvqvngcasLGTLSHALKLCKSidvevskpiphlsivvpgseiskcfryqkedsamavtMPLFLRENEVVGYAMCCVFnvrkgscgikrlrsfpthqlschknasYMSSFIHFKEkfgqagsdhlwlfylspkegysrkwnfkspdfvlsfqsdsgpglevkccgfhpvyrhevvkcdhatnrwTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRlddyldenqvedfYQTTNQWTWFIDRLSEFCTDAKELLQA
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIphlsivvpgseiSKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVkcdhatnrwTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
***LLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTD*******
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRH****************************************************YL***QVEDFYQTTNQWTWFIDRLSEFCTDAKEL***
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
**SLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LPSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQLPSNIEQVQVNGCASLGTLSHALKLCKSIDVEVSKPIPHLSIVVPGSEISKCFRYQKEDSAMAVTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRKWNFKSPDFVLSFQSDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIIDYNLNGNLCTRFIDHLCELCQNQVKLNNVWYRLDDYLDENQVEDFYQTTNQWTWFIDRLSEFCTDAKELLQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query341 2.2.26 [Sep-21-2011]
Q403921144 TMV resistance protein N N/A no 0.246 0.073 0.452 5e-13
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.243 0.081 0.355 5e-05
Q1ZXD6 2800 Probable serine/threonine yes no 0.175 0.021 0.476 8e-05
Q9ERV7 915 p53-induced protein with yes no 0.178 0.066 0.484 0.0003
P0CB16 1201 Putative disease resistan no no 0.269 0.076 0.336 0.0004
Q9FXF2 1021 Probable LRR receptor-lik no no 0.240 0.080 0.333 0.0008
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (67%)

Query: 2   PSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWII 61
           P   GL SL  L++S CNL +G +P +IG++ SLK+L LS+N F  LP+SI  L  L  +
Sbjct: 827 PVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSL 886

Query: 62  ELEECQRLQSLPQLPSNIEQVQVN 85
           +L++CQRL  LP+LP  + ++ V+
Sbjct: 887 DLKDCQRLTQLPELPPELNELHVD 910




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 Back     alignment and function description
>sp|Q9ERV7|PIDD_MOUSE p53-induced protein with a death domain OS=Mus musculus GN=Pidd PE=1 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9FXF2|RKF1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RFK1 OS=Arabidopsis thaliana GN=RKF1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
224127726 1203 tir-nbs-lrr resistance protein [Populus 0.721 0.204 0.332 2e-30
224146780 540 predicted protein [Populus trichocarpa] 0.686 0.433 0.336 4e-27
224114331 1119 tir-nbs-lrr resistance protein [Populus 0.736 0.224 0.330 4e-25
224120770 1120 tir-nbs-lrr resistance protein [Populus 0.665 0.202 0.363 5e-25
224108373 1279 tir-nbs-lrr resistance protein [Populus 0.771 0.205 0.325 9e-25
399920225 1076 TIR-NBS-LRR [Rosa rugosa] 0.777 0.246 0.324 1e-24
359496026 1250 PREDICTED: TMV resistance protein N-like 0.739 0.201 0.334 2e-24
296090591 771 unnamed protein product [Vitis vinifera] 0.739 0.326 0.338 2e-24
224114311 1144 tir-nbs-lrr resistance protein [Populus 0.636 0.189 0.348 5e-24
359493273 1233 PREDICTED: TMV resistance protein N-like 0.709 0.196 0.318 6e-24
>gi|224127726|ref|XP_002329162.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870943|gb|EEF08074.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  139 bits (350), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 149/292 (51%), Gaps = 46/292 (15%)

Query: 11   TKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQ 70
            T+L +S+CNLGEGA+P+DIG + SL++L LS+N+F SLP SI+ LS L  + +E+C+ LQ
Sbjct: 882  TRLGLSNCNLGEGAVPNDIGYLSSLRQLNLSRNKFVSLPTSIDQLSGLQFLRMEDCKMLQ 941

Query: 71   SLPQLPSNIEQVQVNGCASLGTLSHALKLCK-------------------------SIDV 105
            SLP+LPSN+E+ +VNGC SL  +  + KLC+                         ++  
Sbjct: 942  SLPELPSNLEEFRVNGCTSLEKMQFSRKLCQLNYLRYLFINCWRLSESDCWNNMFPTLLR 1001

Query: 106  EVSKPIPHL----SIVVPGSEISKCFRYQKEDSAMAVTMPLFLREN-EVVGYAMCCVFNV 160
            +  +  P+L    S+++PGSEI   F +Q E S+++V  P    EN E +GYA+C     
Sbjct: 1002 KCFQGPPNLIESFSVIIPGSEIPTWFSHQSEGSSVSVQTPPHSHENDEWLGYAVCASLGY 1061

Query: 161  RKGSCGIKRLRSFPTHQLSCHKNA-SYMSSFIHFKEKFGQAGSDHLWLFYLSPKEGYSRK 219
                  + R        + C  N     S  I+ + K  +  SDHLW  Y   +      
Sbjct: 1062 PDFPPNVFR------SPMQCFFNGDGNESESIYVRLKPCEILSDHLWFLYFPSR------ 1109

Query: 220  WNFKSPDFVLSFQ-SDSGPGLEVKCCGFHPVYRHEVVKCDHATNRWTRSIID 270
              FK  D  + F+  D+    +V  CG   VY+ +V + +  TN +  S  +
Sbjct: 1110 --FKRFDRHVRFRFEDNCSQTKVIKCGVRLVYQQDVEELNRMTNLYENSTFE 1159




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224146780|ref|XP_002336335.1| predicted protein [Populus trichocarpa] gi|222834747|gb|EEE73210.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114331|ref|XP_002332400.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832723|gb|EEE71200.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120770|ref|XP_002330947.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222873141|gb|EEF10272.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224108373|ref|XP_002333401.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222836441|gb|EEE74848.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|399920225|gb|AFP55572.1| TIR-NBS-LRR [Rosa rugosa] Back     alignment and taxonomy information
>gi|359496026|ref|XP_002277166.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090591|emb|CBI40960.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114311|ref|XP_002332395.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832718|gb|EEE71195.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493273|ref|XP_002272034.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query341
UNIPROTKB|Q403921144 N "TMV resistance protein N" [ 0.246 0.073 0.452 4.4e-11
TAIR|locus:2206465709 AT1G57650 [Arabidopsis thalian 0.398 0.191 0.346 1.4e-10
TAIR|locus:2122925417 AT4G19470 [Arabidopsis thalian 0.240 0.196 0.411 2.8e-10
TAIR|locus:21181061219 AT4G12010 [Arabidopsis thalian 0.278 0.077 0.402 2.8e-10
TAIR|locus:21229651210 AT4G19510 [Arabidopsis thalian 0.258 0.072 0.377 4.9e-09
TAIR|locus:21759911294 AT5G17680 [Arabidopsis thalian 0.266 0.070 0.414 2e-08
TAIR|locus:21533631261 AT5G45200 [Arabidopsis thalian 0.225 0.061 0.405 1.9e-07
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.331 0.081 0.336 5.9e-07
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.331 0.072 0.336 6.8e-07
TAIR|locus:21703331197 CSA1 "constitutive shade-avoid 0.258 0.073 0.376 9.3e-07
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 4.4e-11, P = 4.4e-11
 Identities = 38/84 (45%), Positives = 57/84 (67%)

Query:     2 PSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWII 61
             P   GL SL  L++S CNL +G +P +IG++ SLK+L LS+N F  LP+SI  L  L  +
Sbjct:   827 PVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSL 886

Query:    62 ELEECQRLQSLPQLPSNIEQVQVN 85
             +L++CQRL  LP+LP  + ++ V+
Sbjct:   887 DLKDCQRLTQLPELPPELNELHVD 910




GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2206465 AT1G57650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122925 AT4G19470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170333 CSA1 "constitutive shade-avoidance1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01250006
tir-nbs-lrr resistance protein (1203 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-05
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score = 45.3 bits (107), Expect = 4e-05
 Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 5/90 (5%)

Query: 1   LPSLLGLCSLTKLDISDC-NLGEGAIPSDIGNICSLKELYLSK-NRFFSLPASINLLSKL 58
           +P L    +L  L +SDC +L E  +PS I  +  L++L +S+      LP  INL S L
Sbjct: 650 IPDLSMATNLETLKLSDCSSLVE--LPSSIQYLNKLEDLDMSRCENLEILPTGINLKS-L 706

Query: 59  WIIELEECQRLQSLPQLPSNIEQVQVNGCA 88
           + + L  C RL+S P + +NI  + ++  A
Sbjct: 707 YRLNLSGCSRLKSFPDISTNISWLDLDETA 736


syringae 6; Provisional. Length = 1153

>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 341
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.89
KOG0617264 consensus Ras suppressor protein (contains leucine 98.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.75
PLN03150623 hypothetical protein; Provisional 98.67
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
PLN03150623 hypothetical protein; Provisional 98.54
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.51
KOG0617264 consensus Ras suppressor protein (contains leucine 98.42
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.33
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.33
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.25
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.22
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.15
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.14
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.08
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.03
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.98
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.81
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.53
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.5
PRK15386426 type III secretion protein GogB; Provisional 97.45
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.25
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.18
KOG4237498 consensus Extracellular matrix protein slit, conta 97.05
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.03
PRK15386426 type III secretion protein GogB; Provisional 96.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.8
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.76
KOG4237498 consensus Extracellular matrix protein slit, conta 96.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.38
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.32
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 95.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.71
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.58
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 95.46
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.11
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.56
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.63
smart0037026 LRR Leucine-rich repeats, outliers. 93.63
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 93.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.03
KOG2123388 consensus Uncharacterized conserved protein [Funct 92.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 92.46
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.02
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 90.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 88.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 87.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 86.6
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 85.97
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.55
smart0037026 LRR Leucine-rich repeats, outliers. 85.55
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 82.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 80.38
>PLN03210 Resistant to P Back     alignment and domain information
Probab=99.86  E-value=1e-20  Score=208.38  Aligned_cols=249  Identities=17%  Similarity=0.250  Sum_probs=164.4

Q ss_pred             CCCCCCCCcEEeccCCCCCCCCCCccc--------------------cCCCCCcEEEccCCCCCCCChhccCCCCccEEE
Q 039899            3 SLLGLCSLTKLDISDCNLGEGAIPSDI--------------------GNICSLKELYLSKNRFFSLPASINLLSKLWIIE   62 (341)
Q Consensus         3 sl~~L~~L~~LdLs~~~l~eg~iP~~i--------------------~~L~~L~~L~Ls~N~~~~LP~si~~Ls~L~~L~   62 (341)
                      ++++|++|+.|+|++|... +.+|..+                    ...++|+.|+|++|.++.+|.++..+++|+.|+
T Consensus       797 si~~L~~L~~L~Ls~C~~L-~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~  875 (1153)
T PLN03210        797 SIQNLHKLEHLEIENCINL-ETLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLD  875 (1153)
T ss_pred             hhhCCCCCCEEECCCCCCc-CeeCCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHHHhcCCCCCEEE
Confidence            4566777777777777554 4566433                    112457777888888899999999999999999


Q ss_pred             cCCccccccCCCCCc---cccccccccccccCcch--hhhH----------------------HHHhhchhccC--CCCc
Q 039899           63 LEECQRLQSLPQLPS---NIEQVQVNGCASLGTLS--HALK----------------------LCKSIDVEVSK--PIPH  113 (341)
Q Consensus        63 Ls~c~~l~~lP~lp~---sL~~L~~~~c~sL~~l~--~~p~----------------------~l~~~l~~l~l--~~n~  113 (341)
                      |++|+.+..+|..+.   +|+.|++.+|.+|+.++  ..|.                      +|.++-+...+  +...
T Consensus       876 L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~~~a~l~~~~~~  955 (1153)
T PLN03210        876 MNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLDQEALLQQQSIF  955 (1153)
T ss_pred             CCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCCchhhhcccccc
Confidence            999999998887544   55667889999998653  1111                      11111101111  1112


Q ss_pred             cccccCCCCccccchhccCCCeEE-EEcCCCCCCCCccceEEEEEEeccCCCcCccccCCCCceeeEEEEeeCCCceEEE
Q 039899          114 LSIVVPGSEISKCFRYQKEDSAMA-VTMPLFLRENEVVGYAMCCVFNVRKGSCGIKRLRSFPTHQLSCHKNASYMSSFIH  192 (341)
Q Consensus       114 ~~~~lPg~~iP~wf~~~~~g~si~-~~Lp~~~~~~~~~gf~~c~v~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~  192 (341)
                      ...++||.++|.||.|+..|++++ +.+|+.|....+.||++|+|+++.....    ........+.|++....+..+..
T Consensus       956 ~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~----~~~~~~~~~~c~~~~~~~~~~~~ 1031 (1153)
T PLN03210        956 KQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFI----ISVSFDIQVCCRFIDRLGNHFDS 1031 (1153)
T ss_pred             eEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCcccc----CCCceeEEEEEEEECCCCCcccc
Confidence            235789999999999999999998 9999999877899999999998765311    11233467788887765554321


Q ss_pred             ee--e-cccCCCCCceEEEEeCCCcCCCCc----CCCCCCeEEEEEEeCCC-CCeEEeeeeEEEEEecCCcccc
Q 039899          193 FK--E-KFGQAGSDHLWLFYLSPKEGYSRK----WNFKSPDFVLSFQSDSG-PGLEVKCCGFHPVYRHEVVKCD  258 (341)
Q Consensus       193 ~~--~-~~~~~~sdHl~l~~~~~~~~l~~~----~~~~~~~v~~~F~~~~~-~~~~Vk~CGV~liy~~d~~~~~  258 (341)
                      ..  + .+.....+|+++|.....  +.+.    ....+.|+.++|+.... ..++||+|||+++|+.+..+..
T Consensus      1032 ~~~~~~~~~~~~~~~l~~~~~~~~--~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~cg~~~~~~~~~~~~~ 1103 (1153)
T PLN03210       1032 PYQPHVFSVTKKGSHLVIFDCCFP--LNEDNAPLAELNYDHVDIQFRLTNKNSQLKLKGCGIRLSEDDSSLNNT 1103 (1153)
T ss_pred             CCCceeEeeeccccceEEeccccc--ccccccchhccCCceeeEEEEEecCCCCeEEEeeeEEEeccCCCcccC
Confidence            11  0 112245667776643322  1111    23356788888875432 3479999999999977666543



syringae 6; Provisional

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query341
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-07
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 8e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 71.5 bits (176), Expect = 3e-14
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 2/78 (2%)

Query: 2   PSLLGLCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLS-KNRFFSLPASINLLSKLWI 60
           P++  L  L +LD+  C       P   G    LK L L   +   +LP  I+ L++L  
Sbjct: 223 PAIHHLPKLEELDLRGCTALRN-YPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEK 281

Query: 61  IELEECQRLQSLPQLPSN 78
           ++L  C  L  LP L + 
Sbjct: 282 LDLRGCVNLSRLPSLIAQ 299


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.1
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.1
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.03
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.01
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.01
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.99
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.99
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.97
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.96
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.94
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.94
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.92
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.92
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.91
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.9
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.9
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.9
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.87
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.85
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.85
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.8
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.79
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.79
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.78
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.78
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.76
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.76
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.74
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.74
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.74
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.74
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.74
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.74
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.74
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.72
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.71
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.69
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.67
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.67
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.66
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.66
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.65
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.65
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.64
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.64
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.64
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.64
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.63
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.63
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.63
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.62
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.61
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.6
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.6
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.6
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.59
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.59
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.59
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.57
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.56
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.56
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.55
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.53
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.51
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.5
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.5
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.49
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.49
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.43
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.4
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.33
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.1
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.98
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 97.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.59
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.13
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.87
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 96.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.33
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.3
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 96.07
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.0
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.72
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.26
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 94.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 89.3
4fdw_A401 Leucine rich hypothetical protein; putative cell s 88.78
4gt6_A394 Cell surface protein; leucine rich repeats, putati 88.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 87.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 86.18
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 86.13
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.26  E-value=7.8e-12  Score=118.27  Aligned_cols=107  Identities=21%  Similarity=0.309  Sum_probs=59.9

Q ss_pred             CCCCcEEeccCCCCCCCCCCccccCCCCCcEEEccCCCCCCCChhccCCCCccEEEcCCccccccCCCC---Cccccccc
Q 039899            7 LCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEECQRLQSLPQL---PSNIEQVQ   83 (341)
Q Consensus         7 L~~L~~LdLs~~~l~eg~iP~~i~~L~~L~~L~Ls~N~~~~LP~si~~Ls~L~~L~Ls~c~~l~~lP~l---p~sL~~L~   83 (341)
                      +++|+.|+|++|.+.  .+|..++.+++|+.|+|++|.++.+|..++.+++|+.|+|++|.+.+.+|..   .++|+.|+
T Consensus       182 l~~L~~L~L~~n~l~--~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~  259 (328)
T 4fcg_A          182 LVNLQSLRLEWTGIR--SLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLI  259 (328)
T ss_dssp             STTCCEEEEEEECCC--CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEE
T ss_pred             CCCCCEEECcCCCcC--cchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEE
Confidence            555555555555554  2565566666666666666666666666666666666666666666655542   24555566


Q ss_pred             cccccccCcchhhhHHHHhhchhccCCCCcccc
Q 039899           84 VNGCASLGTLSHALKLCKSIDVEVSKPIPHLSI  116 (341)
Q Consensus        84 ~~~c~sL~~l~~~p~~l~~~l~~l~l~~n~~~~  116 (341)
                      +.+|..+..++.....+ ..++.+++++|.+.+
T Consensus       260 L~~n~~~~~~p~~~~~l-~~L~~L~L~~n~~~~  291 (328)
T 4fcg_A          260 LKDCSNLLTLPLDIHRL-TQLEKLDLRGCVNLS  291 (328)
T ss_dssp             CTTCTTCCBCCTTGGGC-TTCCEEECTTCTTCC
T ss_pred             CCCCCchhhcchhhhcC-CCCCEEeCCCCCchh
Confidence            65555444443221111 225566666666554



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 341
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 46.7 bits (109), Expect = 2e-06
 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 7   LCSLTKLDISDCNLGEGAIPSDIGNICSLKELYLSKNRFFSLPASINLLSKLWIIELEEC 66
             SL +L++S+  L E  +P+       L+ L  S N    +P     L +L +    E 
Sbjct: 283 PPSLEELNVSNNKLIE--LPALPPR---LERLIASFNHLAEVPELPQNLKQLHV----EY 333

Query: 67  QRLQSLPQLPSNIEQVQVN 85
             L+  P +P ++E +++N
Sbjct: 334 NPLREFPDIPESVEDLRMN 352


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query341
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.08
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.98
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.98
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.89
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.83
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.55
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.43
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.42
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.38
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.36
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.29
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.24
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.23
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.16
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.15
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.09
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.88
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.68
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.56
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.25
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.82
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.16
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.54
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 93.05
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 89.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 81.84
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.08  E-value=2.9e-11  Score=110.63  Aligned_cols=68  Identities=25%  Similarity=0.344  Sum_probs=40.9

Q ss_pred             CCCCCCCCcEEeccC-CCCCCCCCCccccCCCCCcEEEccCCCCCC-CChhccCCCCccEEEcCCcccccc
Q 039899            3 SLLGLCSLTKLDISD-CNLGEGAIPSDIGNICSLKELYLSKNRFFS-LPASINLLSKLWIIELEECQRLQS   71 (341)
Q Consensus         3 sl~~L~~L~~LdLs~-~~l~eg~iP~~i~~L~~L~~L~Ls~N~~~~-LP~si~~Ls~L~~L~Ls~c~~l~~   71 (341)
                      ++++|++|++|+|++ |++. |.+|.+|++|++|++|+|++|+|.. .|..+..+.+|+.+++++|+..+.
T Consensus        71 ~l~~L~~L~~L~Ls~~N~l~-g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~  140 (313)
T d1ogqa_          71 SLANLPYLNFLYIGGINNLV-GPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGT  140 (313)
T ss_dssp             GGGGCTTCSEEEEEEETTEE-SCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESC
T ss_pred             HHhcCccccccccccccccc-cccccccccccccchhhhccccccccccccccchhhhccccccccccccc
Confidence            466777777777775 5666 6777777777777777777776552 223344444444444444444333



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure