Citrus Sinensis ID: 040114
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 378 | ||||||
| 255586934 | 384 | Calcium-activated outward-rectifying pot | 0.960 | 0.945 | 0.674 | 1e-146 | |
| 225446841 | 390 | PREDICTED: probable calcium-activated ou | 0.992 | 0.961 | 0.689 | 1e-143 | |
| 224066569 | 314 | outward rectifying potassium channel [Po | 0.793 | 0.955 | 0.747 | 1e-133 | |
| 224082562 | 292 | outward rectifying potassium channel [Po | 0.738 | 0.955 | 0.780 | 1e-123 | |
| 356499358 | 381 | PREDICTED: probable calcium-activated ou | 0.960 | 0.952 | 0.582 | 1e-121 | |
| 359485197 | 375 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.952 | 0.96 | 0.628 | 1e-120 | |
| 356553605 | 330 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.822 | 0.942 | 0.621 | 1e-111 | |
| 326517677 | 394 | predicted protein [Hordeum vulgare subsp | 0.843 | 0.809 | 0.540 | 2e-95 | |
| 255557407 | 426 | Calcium-activated outward-rectifying pot | 0.788 | 0.699 | 0.563 | 2e-94 | |
| 224116730 | 435 | outward rectifying potassium channel [Po | 0.791 | 0.687 | 0.566 | 1e-93 |
| >gi|255586934|ref|XP_002534067.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223525894|gb|EEF28311.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 522 bits (1345), Expect = e-146, Method: Compositional matrix adjust.
Identities = 265/393 (67%), Positives = 308/393 (78%), Gaps = 30/393 (7%)
Query: 1 MDEPFLSKTKGLAEGSSNASSIKRELPSGNLDHGPSRRQSTAHLVRSDAIIPIITAPKP- 59
MDEPFL KT + + +SS RE PSG LD + +DA+IP++ P
Sbjct: 1 MDEPFLPKTT--QKDTYRSSSSWREFPSGYLDP----------ITNNDALIPVVKTPNAS 48
Query: 60 --PSYLNIIANLKKG--KLTRRSHSAPSVFTQFKEAFPDSLDPRPPLKSTPLIVQQAFIG 115
PSY+N++++L K KL RSHSAP +FT K + + LDPRP KSTP+IV QAFIG
Sbjct: 49 PSPSYVNLLSSLNKNRRKLPHRSHSAPPIFTDAKGSSTNFLDPRPTPKSTPVIVWQAFIG 108
Query: 116 LVLYILAGIVIYLTNGNFKGKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFI 175
++LY+L +V +L +G FKG T +PVDALYF VVTLCTIG+GDI+PD+TFTKL TCVFI
Sbjct: 109 VILYLLIVVVTFLVSGKFKGTTTSRPVDALYFTVVTLCTIGFGDIIPDSTFTKLLTCVFI 168
Query: 176 LIGFGFVDILLNGLVTYICDRQEAVFLSTMDENR-------------ERRMRIRIKVCLA 222
L+GFGF+DILLNGLVTYICDRQEAV LS +DENR + RMRIR KVCLA
Sbjct: 169 LVGFGFIDILLNGLVTYICDRQEAVLLSAVDENRFNTMVQAYVIDRAKGRMRIRTKVCLA 228
Query: 223 LGVVIGCLAIGTVTVHFLEDMNWVDSFYLSVTSVTTVGYGDYAFTTLTGRCFAIIWLLVS 282
L VV GC+AIGT+ VHFLE ++WVDSFYLSVTSVTTVGYGDYAFTT+TGRCFAI+WLL+S
Sbjct: 229 LVVVFGCIAIGTIAVHFLESLSWVDSFYLSVTSVTTVGYGDYAFTTITGRCFAIVWLLIS 288
Query: 283 TLAVARAFLYLTELRIEKRNRRIAKWVLQKKMTLGDLVAADLDNDGSISKSEFVIYKLKE 342
TLAVARAFLYL ELRI+KRNR IAKWVLQKKMTLGDLVAADLDNDGSISKSEF+IYKLKE
Sbjct: 289 TLAVARAFLYLAELRIDKRNRIIAKWVLQKKMTLGDLVAADLDNDGSISKSEFIIYKLKE 348
Query: 343 MGKIAEKDILQICNQFDLIDDSKCGKITVADLM 375
MGKI EKDIL ICNQFD+ID+S CGKIT+A LM
Sbjct: 349 MGKITEKDILLICNQFDIIDNSNCGKITLAGLM 381
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225446841|ref|XP_002279555.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224066569|ref|XP_002302141.1| outward rectifying potassium channel [Populus trichocarpa] gi|222843867|gb|EEE81414.1| outward rectifying potassium channel [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224082562|ref|XP_002306742.1| outward rectifying potassium channel [Populus trichocarpa] gi|222856191|gb|EEE93738.1| outward rectifying potassium channel [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356499358|ref|XP_003518508.1| PREDICTED: probable calcium-activated outward-rectifying potassium channel 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359485197|ref|XP_003633230.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-activated outward-rectifying potassium channel 6-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356553605|ref|XP_003545145.1| PREDICTED: LOW QUALITY PROTEIN: probable calcium-activated outward-rectifying potassium channel 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|326517677|dbj|BAK03757.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|255557407|ref|XP_002519734.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] gi|223541151|gb|EEF42707.1| Calcium-activated outward-rectifying potassium channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224116730|ref|XP_002331863.1| outward rectifying potassium channel [Populus trichocarpa] gi|222875381|gb|EEF12512.1| outward rectifying potassium channel [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 378 | ||||||
| TAIR|locus:2117681 | 436 | KCO6 "Ca2+ activated outward r | 0.801 | 0.694 | 0.517 | 2.3e-78 | |
| TAIR|locus:2141375 | 408 | KCO5 "Ca2+ activated outward r | 0.433 | 0.401 | 0.591 | 4.6e-76 | |
| UNIPROTKB|Q8LIN5 | 349 | TPKB "Two pore potassium chann | 0.685 | 0.742 | 0.412 | 5.1e-51 | |
| TAIR|locus:2162162 | 363 | KCO1 "CA2+ ACTIVATED OUTWARD R | 0.822 | 0.856 | 0.365 | 1.7e-50 | |
| UNIPROTKB|Q850M0 | 347 | TPKA "Two pore potassium chann | 0.687 | 0.749 | 0.389 | 2e-49 | |
| TAIR|locus:2170423 | 443 | KCO2 "Ca2+ activated outward r | 0.534 | 0.455 | 0.518 | 3.3e-47 | |
| TAIR|locus:2196155 | 284 | TPK4 [Arabidopsis thaliana (ta | 0.558 | 0.742 | 0.423 | 8.6e-47 | |
| TAIR|locus:2170413 | 260 | KCO3 "AT5G46360" [Arabidopsis | 0.478 | 0.696 | 0.473 | 1.3e-38 | |
| UNIPROTKB|Q8E842 | 131 | Q8E842 "Potassium/ion transpor | 0.248 | 0.717 | 0.333 | 1.2e-08 | |
| TIGR_CMR|SO_A0098 | 131 | SO_A0098 "potassium/ion transp | 0.248 | 0.717 | 0.333 | 1.2e-08 |
| TAIR|locus:2117681 KCO6 "Ca2+ activated outward rectifying K+ channel 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 788 (282.4 bits), Expect = 2.3e-78, P = 2.3e-78
Identities = 165/319 (51%), Positives = 221/319 (69%)
Query: 71 KGKLTRRSHSAPSVFTQFKEAFPDSLDPRPPLKSTPLIVQQAFIGLVLYILAGIVIY-LT 129
+G RS +AP++ P + + P +++ +V+QAF LV+Y+ G++IY L
Sbjct: 114 QGHALHRSKTAPAMAVINDLHHP--IRQKDPTETSRSVVRQAFALLVVYLSLGVLIYWLN 171
Query: 130 NGNFKGKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFILIGFGFVDILLNGL 189
++ T VD LYF +VT+CTIGYGDI P++ TKLF+ +F+L+GFGF+DILL+G+
Sbjct: 172 RDHYVVNQTHPVVDGLYFCIVTMCTIGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGM 231
Query: 190 VTYICDRQEAVFLSTM---DENRERR----------MRIRIKVCLALGVVIGCLAIGTVT 236
V+Y+ D QE+ L + DE +RR MRIR+KV LALGVV+ C+A+G
Sbjct: 232 VSYVLDLQESYMLDSAKRRDEPEKRRSYIIDVKKGRMRIRLKVALALGVVVLCIAVGVGI 291
Query: 237 VHFLEDMNWVDSFYLSVTSVTTVGYGDYAFTTLTGRCFAIIWLLVSTLAVARAFLYLTEL 296
+HF+E++ W+DSFYLSV SVTTVGYGD AF TL GR FA IWLLVSTLAVARAFLYL E
Sbjct: 292 MHFIEEIGWLDSFYLSVMSVTTVGYGDRAFKTLPGRLFAAIWLLVSTLAVARAFLYLAEA 351
Query: 297 RIEKRNRRIAKWVLQKKMTLGDLVAADLDNDGSISKSEFVIYKLKEMGKIAEKDILQICN 356
R++KRNR AK VL + M++ AAD+DN+G +SK+E+VIYKLKEM KI +KDIL I
Sbjct: 352 RVDKRNRERAKKVLCETMSVSQFFAADIDNNGCVSKAEYVIYKLKEMEKITDKDILPISK 411
Query: 357 QFDLIDDSKCGKITVADLM 375
QFD +D GKIT+ DL+
Sbjct: 412 QFDKLDRCSNGKITLLDLL 430
|
|
| TAIR|locus:2141375 KCO5 "Ca2+ activated outward rectifying K+ channel 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8LIN5 TPKB "Two pore potassium channel b" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162162 KCO1 "CA2+ ACTIVATED OUTWARD RECTIFYING K+ CHANNEL 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q850M0 TPKA "Two pore potassium channel a" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170423 KCO2 "Ca2+ activated outward rectifying K+ channel 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196155 TPK4 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170413 KCO3 "AT5G46360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E842 Q8E842 "Potassium/ion transporter, voltage-gated ion channel (VIC) superfamily" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_A0098 SO_A0098 "potassium/ion transporter, voltage-gated ion channel (VIC) superfamily" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 378 | |||
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 7e-14 | |
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 1e-10 | |
| PRK10537 | 393 | PRK10537, PRK10537, voltage-gated potassium channe | 6e-07 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Score = 65.7 bits (161), Expect = 7e-14
Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 3/75 (4%)
Query: 116 LVLYILAGIVIYLTNGNFKGKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFI 175
L+L ++ G V Y G DALYF VTL TIGYGDIVP T +LFT ++I
Sbjct: 3 LLLVLIFGTVYYSLEEEGWGWDFL---DALYFSFVTLTTIGYGDIVPLTDAGRLFTIIYI 59
Query: 176 LIGFGFVDILLNGLV 190
LIG + L L
Sbjct: 60 LIGIPLFLLFLAVLG 74
|
This family includes the two membrane helix type ion channels found in bacteria. Length = 74 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
| >gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 378 | |||
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 99.96 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 99.91 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.44 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 99.44 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.44 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.39 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.33 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 99.3 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.27 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.25 | |
| KOG4404 | 350 | consensus Tandem pore domain K+ channel TASK3/THIK | 99.2 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 99.08 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.0 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 98.98 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 98.96 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 98.95 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 98.94 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.8 | |
| KOG1418 | 433 | consensus Tandem pore domain K+ channel [Inorganic | 98.71 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 98.57 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 98.37 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 98.36 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 98.15 | |
| KOG3193 | 1087 | consensus K+ channel subunit [Inorganic ion transp | 98.02 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 97.9 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 97.86 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.61 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 97.38 | |
| KOG0501 | 971 | consensus K+-channel KCNQ [Inorganic ion transport | 97.26 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 97.04 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 96.52 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 96.18 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 94.86 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 94.82 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 93.61 | |
| KOG3827 | 400 | consensus Inward rectifier K+ channel [Inorganic i | 93.46 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 93.3 | |
| PRK10750 | 483 | potassium transporter; Provisional | 93.29 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 92.86 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 92.62 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 92.31 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 91.29 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 91.24 | |
| PF00060 | 148 | Lig_chan: Ligand-gated ion channel; InterPro: IPR0 | 90.12 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 90.02 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 89.24 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 86.81 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 86.58 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 86.24 | |
| TIGR00933 | 390 | 2a38 potassium uptake protein, TrkH family. The pr | 85.65 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 83.52 | |
| PRK05482 | 559 | potassium-transporting ATPase subunit A; Provision | 83.29 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 82.39 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 82.31 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 81.63 | |
| PRK10750 | 483 | potassium transporter; Provisional | 81.53 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 80.85 | |
| PTZ00183 | 158 | centrin; Provisional | 80.27 |
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.9e-28 Score=228.70 Aligned_cols=183 Identities=21% Similarity=0.378 Sum_probs=141.5
Q ss_pred HHHHHHHHHHHHHhhhh-hccc---------------------------------------ccCCCCCCCccceeeeeee
Q 040114 111 QAFIGLVLYILAGIVIY-LTNG---------------------------------------NFKGKATFKPVDALYFIVV 150 (378)
Q Consensus 111 ~~~~~l~~~l~~g~~~~-~~~~---------------------------------------~~~~~~~~~~~~a~yf~~v 150 (378)
+++++.+.|+++|+.+| ..|. ..+....|.|..||||+.+
T Consensus 11 ~Livct~tYLLvGAaVFdaLEse~E~~~r~~l~~~~~~~~~kyn~s~~d~r~~er~i~~s~ph~ag~qWkF~GaFYFa~T 90 (350)
T KOG4404|consen 11 LLIVCTFTYLLVGAAVFDALESENEARERERLERRLANLKRKYNLSEEDYRELERVILKSEPHKAGPQWKFAGAFYFATT 90 (350)
T ss_pred HHHHHHHHHHHHHHHHHHHhcCcchHHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHhcCccccccccccCcceEEEEE
Confidence 35567788999999999 4331 1123346999999999999
Q ss_pred eeeeeecccccccCccCceeeehhhhhhhhhhhhhhcchhhhhhhhHHHHHhhhhhhhhhhh---hhHHHHHHHHHHHHH
Q 040114 151 TLCTIGYGDIVPDTTFTKLFTCVFILIGFGFVDILLNGLVTYICDRQEAVFLSTMDENRERR---MRIRIKVCLALGVVI 227 (378)
Q Consensus 151 tltTvGyGdi~P~t~~g~~~~~~~~l~Gi~~~~~~~~~~~~~l~~~~~~~l~r~~~~~~~~~---~~~~~~~~~~~~~~i 227 (378)
.+||||||.-.|.|..||+||++|.++|+++..+++..++..+.... ..++++.++..-.+ ...-..+...+...+
T Consensus 91 VItTIGyGhstP~T~~GK~Fcm~Yal~Gipl~lvmFqs~gERlnt~~-ayil~~~r~~~~~r~~~~S~~~l~~i~~~~~~ 169 (350)
T KOG4404|consen 91 VITTIGYGHSTPSTDGGKAFCMFYALVGIPLTLVMFQSIGERLNTFV-AYILRRCRRRLGRRRWDVSVYNLVLILFTACI 169 (350)
T ss_pred EEeeeccCCCCCCCcCceehhhhHHHhcCchHHHHHHHHHHHHHHHH-HHHHHHHHHHhccccCCCcHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999998888876665432 23334443322111 111122333344456
Q ss_pred hhhhhhcceeecccccccccceeEEEEEEeccccCCcccCCc--------chhHHHHHHHHHHHHHHHHHHHHHH
Q 040114 228 GCLAIGTVTVHFLEDMNWVDSFYLSVTSVTTVGYGDYAFTTL--------TGRCFAIIWLLVSTLAVARAFLYLT 294 (378)
Q Consensus 228 ~~~~~g~~~~~~~e~~~~~da~Y~~~~T~tTVGyGD~~p~t~--------~gr~f~~~~il~g~~~va~~~~~l~ 294 (378)
++++.|+.+|..+|+|+|+||+||||+|+|||||||+++... ..+.|..+||++|+.+++.+++.+.
T Consensus 170 ~~i~~gaa~fs~~E~Wsyfds~YyCFITltTIGFGDyValQ~~~alq~qplYv~~sf~fIL~Gl~vi~a~~Nllv 244 (350)
T KOG4404|consen 170 LLICCGAAMFSSVEGWSYFDSYYYCFITLTTIGFGDYVALQQDAALQSQPLYVFFSFVFILLGLCVIYALLNLLV 244 (350)
T ss_pred HHHHhhHHHhhcccCcchhhhhheeeeeeeeccccchhhhcchhhhhCCCceehHhHHHHHHHHHHHHHHHHHHH
Confidence 678899999999999999999999999999999999998643 4588999999999999988887665
|
|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4404 consensus Tandem pore domain K+ channel TASK3/THIK-1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1418 consensus Tandem pore domain K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3193 consensus K+ channel subunit [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3827 consensus Inward rectifier K+ channel [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >PRK10750 potassium transporter; Provisional | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >TIGR00933 2a38 potassium uptake protein, TrkH family | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PRK05482 potassium-transporting ATPase subunit A; Provisional | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PRK10750 potassium transporter; Provisional | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 378 | ||||
| 3ouf_A | 97 | Structure Of A K+ Selective Nak Mutant Length = 97 | 5e-09 | ||
| 3ouf_A | 97 | Structure Of A K+ Selective Nak Mutant Length = 97 | 7e-04 | ||
| 3tcu_A | 97 | Crystal Structure Of Nak2k Channel D68e Mutant Leng | 1e-08 | ||
| 3t4z_A | 97 | Crystal Structure Of Nak2k Channel Y55w Mutant Leng | 1e-08 | ||
| 3t1c_A | 97 | Crystal Structure Of Nak Channel D66y Mutant Length | 2e-08 | ||
| 3tet_A | 97 | Crystal Structure Of Nak2k Channel Y66f Mutant Leng | 2e-08 | ||
| 3t4d_A | 97 | Crystal Structure Of Nak2k Channel Y55f Mutant Leng | 2e-08 | ||
| 3t2m_A | 97 | Crystal Structure Of Nak Channel N68d Mutant Length | 8e-08 | ||
| 2q6a_A | 114 | Crystal Structure Of Nak Channel D66e Mutant Length | 1e-07 | ||
| 2q67_A | 114 | Crystal Structure Of Nak Channel D66a Mutant Length | 1e-07 | ||
| 2q69_A | 114 | Crystal Structure Of Nak Channel D66n Mutant Length | 1e-07 | ||
| 2q68_A | 114 | Crystal Structure Of Nak Channel D66a, S70e Double | 1e-07 | ||
| 2ahy_A | 110 | Na+ Complex Of The Nak Channel Length = 110 | 2e-07 | ||
| 3vou_A | 148 | The Crystal Structure Of Nak-Navsulp Chimera Channe | 2e-07 | ||
| 3e83_A | 96 | Crystal Structure Of The The Open Nak Channel Pore | 3e-07 | ||
| 3um7_A | 309 | Crystal Structure Of The Human Two Pore Domain K+ I | 3e-06 | ||
| 3rbz_A | 340 | Mthk Channel, Ca2+-Bound Length = 340 | 3e-06 | ||
| 1lnq_A | 336 | Crystal Structure Of Mthk At 3.3 A Length = 336 | 3e-06 | ||
| 1lnq_A | 336 | Crystal Structure Of Mthk At 3.3 A Length = 336 | 9e-06 | ||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 1e-05 | ||
| 4hyo_A | 91 | Crystal Structure Of Mthk Pore Length = 91 | 3e-05 | ||
| 3ldc_A | 82 | High Resolution Open Mthk Pore Structure Crystalliz | 4e-05 | ||
| 3r65_A | 82 | Mthk Channel Pore E92q Mutant Length = 82 | 4e-05 | ||
| 3k06_A | 96 | Crystal Structure Of Cng Mimicking Nak Mutant, Nak- | 5e-05 | ||
| 3k0d_A | 96 | Crystal Structure Of Cng Mimicking Nak Mutant, Nak- | 5e-05 | ||
| 3k03_A | 96 | Crystal Structure Of Cng Mimicking Nak Mutant, Nak- | 7e-05 | ||
| 3ous_A | 82 | Mthk Channel Pore T59a Mutant Length = 82 | 2e-04 | ||
| 4h33_A | 137 | Crystal Structure Of A Voltage-gated K+ Channel Por | 5e-04 | ||
| 3ldd_A | 82 | High Resolution Open Mthk Pore Structure Crystalliz | 6e-04 | ||
| 2a9h_A | 155 | Nmr Structural Studies Of A Potassium Channel Chary | 9e-04 |
| >pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 | Back alignment and structure |
|
| >pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 | Back alignment and structure |
| >pdb|3TCU|A Chain A, Crystal Structure Of Nak2k Channel D68e Mutant Length = 97 | Back alignment and structure |
| >pdb|3T4Z|A Chain A, Crystal Structure Of Nak2k Channel Y55w Mutant Length = 97 | Back alignment and structure |
| >pdb|3T1C|A Chain A, Crystal Structure Of Nak Channel D66y Mutant Length = 97 | Back alignment and structure |
| >pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 | Back alignment and structure |
| >pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 | Back alignment and structure |
| >pdb|3T2M|A Chain A, Crystal Structure Of Nak Channel N68d Mutant Length = 97 | Back alignment and structure |
| >pdb|2Q6A|A Chain A, Crystal Structure Of Nak Channel D66e Mutant Length = 114 | Back alignment and structure |
| >pdb|2Q67|A Chain A, Crystal Structure Of Nak Channel D66a Mutant Length = 114 | Back alignment and structure |
| >pdb|2Q69|A Chain A, Crystal Structure Of Nak Channel D66n Mutant Length = 114 | Back alignment and structure |
| >pdb|2Q68|A Chain A, Crystal Structure Of Nak Channel D66a, S70e Double Mutants Length = 114 | Back alignment and structure |
| >pdb|2AHY|A Chain A, Na+ Complex Of The Nak Channel Length = 110 | Back alignment and structure |
| >pdb|3VOU|A Chain A, The Crystal Structure Of Nak-Navsulp Chimera Channel Length = 148 | Back alignment and structure |
| >pdb|3E83|A Chain A, Crystal Structure Of The The Open Nak Channel Pore Length = 96 | Back alignment and structure |
| >pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 | Back alignment and structure |
| >pdb|3RBZ|A Chain A, Mthk Channel, Ca2+-Bound Length = 340 | Back alignment and structure |
| >pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 | Back alignment and structure |
| >pdb|1LNQ|A Chain A, Crystal Structure Of Mthk At 3.3 A Length = 336 | Back alignment and structure |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
| >pdb|4HYO|A Chain A, Crystal Structure Of Mthk Pore Length = 91 | Back alignment and structure |
| >pdb|3LDC|A Chain A, High Resolution Open Mthk Pore Structure Crystallized In 100 Mm K+ Length = 82 | Back alignment and structure |
| >pdb|3R65|A Chain A, Mthk Channel Pore E92q Mutant Length = 82 | Back alignment and structure |
| >pdb|3K06|A Chain A, Crystal Structure Of Cng Mimicking Nak Mutant, Nak-Ntpp, K+ Complex Length = 96 | Back alignment and structure |
| >pdb|3K0D|A Chain A, Crystal Structure Of Cng Mimicking Nak Mutant, Nak-Etpp, K+ Complex Length = 96 | Back alignment and structure |
| >pdb|3K03|A Chain A, Crystal Structure Of Cng Mimicking Nak Mutant, Nak-Dtpp, K+ Complex Length = 96 | Back alignment and structure |
| >pdb|3OUS|A Chain A, Mthk Channel Pore T59a Mutant Length = 82 | Back alignment and structure |
| >pdb|4H33|A Chain A, Crystal Structure Of A Voltage-gated K+ Channel Pore Module In A Closed State In Lipid Membranes, Tetragonal Crystal Form Length = 137 | Back alignment and structure |
| >pdb|3LDD|A Chain A, High Resolution Open Mthk Pore Structure Crystallized In 100 Mm K+ And Further Soaked In 99 Mm Na+1 MM K+ Length = 82 | Back alignment and structure |
| >pdb|2A9H|A Chain A, Nmr Structural Studies Of A Potassium Channel Charybdotoxin Complex Length = 155 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 378 | |||
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 4e-25 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 1e-22 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 1e-17 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 1e-16 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 3e-17 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 2e-15 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 3e-17 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 2e-16 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 7e-15 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 1e-12 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 2e-14 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 4e-14 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 1e-10 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 2e-05 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 7e-10 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 7e-06 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 1e-09 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 2e-05 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 1e-09 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 3e-04 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 4e-09 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 9e-05 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 5e-09 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 1e-04 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 2e-08 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 5e-08 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 8e-06 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 3e-07 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 2e-05 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-06 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 5e-06 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 7e-05 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 1e-05 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 5e-05 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 7e-04 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 8e-04 |
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
Score = 102 bits (256), Expect = 4e-25
Identities = 35/208 (16%), Positives = 71/208 (34%), Gaps = 11/208 (5%)
Query: 119 YILAGIVIYLTNGNFKGKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFILIG 178
+ G + + + + A +F + TIGYG++ T +LF + L+G
Sbjct: 94 ALGGGADPETQSTSQSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFCIFYALVG 153
Query: 179 FGFVDILLNGLVTYICDRQEAVF-----LSTMDENRERRMRIRIKVCLALGVVIGCLAIG 233
ILL G+ + + +R+ + L + +
Sbjct: 154 IPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGCLLFVLTP 213
Query: 234 TVTVHFLEDMNWVDSFYLSVTSVTTVGYGDYAFTTL------TGRCFAIIWLLVSTLAVA 287
T ++ED + +++ Y + ++TTVG+GDY + W+L+ A
Sbjct: 214 TFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWILLGLAYFA 273
Query: 288 RAFLYLTELRIEKRNRRIAKWVLQKKMT 315
+ R A+ +
Sbjct: 274 SVLTTIGNWLRVVSRRTRAEMGGLTAQS 301
|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Length = 321 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 378 | |||
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.97 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.96 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.62 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.61 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.6 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.59 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.59 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.58 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.56 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.55 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.54 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.53 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.53 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.52 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.52 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.51 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.5 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.49 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.49 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.48 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.48 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.46 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.33 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.29 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.27 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.24 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.23 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.22 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.2 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.19 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.18 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.17 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.12 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.07 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.07 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.06 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.06 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.01 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 98.97 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 98.79 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.69 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 98.53 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.5 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.42 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.94 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 97.91 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 93.72 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 92.9 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 92.86 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 92.78 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 92.69 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 92.33 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 92.27 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 92.25 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 92.24 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 91.98 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 91.88 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 91.72 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 91.67 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 91.65 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 91.63 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.53 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 91.31 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 91.3 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 91.16 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 91.07 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 90.97 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 90.91 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 90.85 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 90.82 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 90.75 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 90.73 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 90.71 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 90.69 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 90.6 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 90.5 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 90.38 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 90.38 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 90.38 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 90.3 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 90.17 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 90.01 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 90.01 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 89.96 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 89.94 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 89.92 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 89.82 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 89.79 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 89.77 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 89.74 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 89.71 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 89.6 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 89.6 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 89.53 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 89.53 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 89.52 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 89.47 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 89.47 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 89.45 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 89.39 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 89.39 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 89.26 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 89.24 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 89.11 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 89.1 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 89.09 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 89.02 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 88.98 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 88.88 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 88.86 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 88.85 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 88.78 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 88.75 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 88.6 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 88.59 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 88.43 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 88.41 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 88.37 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 88.37 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 88.35 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 88.32 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 88.27 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 88.26 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 88.25 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 88.25 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 88.09 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 88.02 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 87.98 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 87.95 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 87.91 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 87.88 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 87.86 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 87.81 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 87.79 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 87.79 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 87.78 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 87.76 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 87.75 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 87.65 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 87.57 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 87.56 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 87.52 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 87.52 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 87.5 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 87.46 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 87.46 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 87.46 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 87.45 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 87.37 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 87.22 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 87.21 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 87.19 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 87.16 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 87.14 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 87.12 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 87.02 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 87.01 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 86.96 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 86.89 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 86.89 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 86.78 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 86.77 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 86.75 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 86.68 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 86.53 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 86.51 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 86.46 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 86.45 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 86.43 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 86.41 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 86.37 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 86.33 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 86.22 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 86.19 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 86.14 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 85.89 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 85.88 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 85.82 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 85.72 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 85.68 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 85.61 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 85.61 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 85.55 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 85.4 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 85.3 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 85.3 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 85.25 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 85.03 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 85.02 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 84.95 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 84.71 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 84.64 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 84.5 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 84.47 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 84.45 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 84.35 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 84.21 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 84.11 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 84.1 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 84.06 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 84.04 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 83.96 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 83.95 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 83.86 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 83.79 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 83.79 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 83.69 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 83.56 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 83.45 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 83.36 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 83.19 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 83.18 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 83.08 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 82.96 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 82.84 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 82.58 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 82.5 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 82.45 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 82.24 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 82.19 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 82.1 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 81.96 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 81.77 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 81.75 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 81.61 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 81.57 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 81.55 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 81.2 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 80.98 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 80.78 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 80.78 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 80.72 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 80.63 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 80.58 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 80.56 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 80.46 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 80.24 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 80.2 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 80.09 |
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.7e-33 Score=266.10 Aligned_cols=170 Identities=26% Similarity=0.347 Sum_probs=138.0
Q ss_pred CCCCCCccceeeeeeeeeeeeecccccccCccCceeeehhhhhhhhhhhhhhcchhhhhhhhHHHHHhhhhhhh---hhh
Q 040114 135 GKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFILIGFGFVDILLNGLVTYICDRQEAVFLSTMDEN---RER 211 (378)
Q Consensus 135 ~~~~~~~~~a~yf~~vtltTvGyGdi~P~t~~g~~~~~~~~l~Gi~~~~~~~~~~~~~l~~~~~~~l~r~~~~~---~~~ 211 (378)
..+.|+|.||+||+++|+|||||||++|.|+.||+++++|+++|++++.+.++.+++.+.....++..+.+++. ++.
T Consensus 88 ~~~~w~~~~a~yf~~~t~tTvGyGd~~P~T~~Gk~f~~~~~l~Gi~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~ 167 (280)
T 3ukm_A 88 GNWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTRRPVLYFHIRWGFSKQ 167 (280)
T ss_dssp --CCSSHHHHHHHHHHHHTTCCCCSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSTTTTTC------CCH
T ss_pred CCCCCChhcchhheeeeeeccccCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCChh
Confidence 34679999999999999999999999999999999999999999999999999998877765433333333221 112
Q ss_pred hhhHHHHHHHHHHHHHhhhhhhcceeeccc-ccccccceeEEEEEEeccccCCcccCCcc-------hhHHHHHHHHHHH
Q 040114 212 RMRIRIKVCLALGVVIGCLAIGTVTVHFLE-DMNWVDSFYLSVTSVTTVGYGDYAFTTLT-------GRCFAIIWLLVST 283 (378)
Q Consensus 212 ~~~~~~~~~~~~~~~i~~~~~g~~~~~~~e-~~~~~da~Y~~~~T~tTVGyGD~~p~t~~-------gr~f~~~~il~g~ 283 (378)
+......+.+.+..+++++++|+.+++.+| +|+|+||+||+++|+|||||||++|.+.. ||+|+++|+++|+
T Consensus 168 ~~~~~~~~~l~~~~~~~~~~~ga~~~~~~E~~~s~~da~y~~~iTltTvGyGD~~p~t~~~~~~~~l~r~~~~~~il~Gl 247 (280)
T 3ukm_A 168 VVAIVHAVLLGFVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGL 247 (280)
T ss_dssp HHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSCCHHHHHHHHHHHHTTCCCCSCCSSCSSSCTTHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhHHHHHHHHHhcCCchhhhhhheeeeeecccCCCCCCCCCcccccchhHHHHHHHHHHHHH
Confidence 222233344445556677889999999998 89999999999999999999999999986 5999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHH
Q 040114 284 LAVARAFLYLTELRIEKRNRR 304 (378)
Q Consensus 284 ~~va~~~~~l~~~~~~~~~r~ 304 (378)
++++..++.+++....++.++
T Consensus 248 ~~~~~~~~~i~~~~~~~~l~~ 268 (280)
T 3ukm_A 248 IAMLVVLETFCELHELKKFRK 268 (280)
T ss_dssp HHHHHHHHHHHTSHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHH
Confidence 999999999998877766443
|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 378 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 6e-13 | |
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 4e-11 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 8e-11 | |
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 1e-07 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 6e-07 | |
| d1xl4a2 | 116 | f.14.1.1 (A:23-138) Inward rectifier potassium cha | 5e-06 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 1e-06 | |
| d1p7ba2 | 116 | f.14.1.1 (A:36-151) Inward rectifier potassium cha | 4e-05 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 61.6 bits (150), Expect = 6e-13
Identities = 24/74 (32%), Positives = 38/74 (51%)
Query: 223 LGVVIGCLAIGTVTVHFLEDMNWVDSFYLSVTSVTTVGYGDYAFTTLTGRCFAIIWLLVS 282
L +V+ + GT HF+E +W S Y + ++ TVGYGDY+ +T G F + +++
Sbjct: 6 LLLVLAVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLG 65
Query: 283 TLAVARAFLYLTEL 296
A A L E
Sbjct: 66 IGTFAVAVERLLEF 79
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 378 | |||
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.64 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.59 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.51 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.47 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.41 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.36 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.24 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.2 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.57 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 97.65 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 95.46 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 94.74 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 94.58 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 94.29 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 93.2 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 93.07 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 93.05 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 93.03 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 92.74 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 92.5 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 92.33 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 92.09 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 92.08 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 92.03 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 91.13 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 91.02 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 90.95 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 90.85 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 90.65 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 90.5 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 90.21 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 90.18 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 89.9 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 89.86 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 89.66 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 89.31 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 89.23 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 88.87 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 88.74 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 88.61 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 88.57 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 88.49 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 88.25 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 88.18 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 88.17 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 88.01 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 87.81 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 87.68 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 87.42 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 87.38 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 87.18 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 87.17 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 86.78 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 86.69 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 86.67 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 86.59 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 86.28 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 86.16 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 85.64 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 85.62 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 85.58 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 85.54 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 84.9 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 84.66 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 83.58 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 83.57 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 83.55 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 83.45 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 83.28 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 82.69 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 82.67 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 81.93 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 81.58 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 80.91 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 80.74 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 80.52 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.64 E-value=9.7e-18 Score=134.11 Aligned_cols=94 Identities=19% Similarity=0.328 Sum_probs=76.3
Q ss_pred hHHHHHHHHHHHHHHHHHHhhhhhcccccCCCCCCCccceeeeeeeeeeeeecccccccCccCceeeehhhhhhhhhhhh
Q 040114 105 TPLIVQQAFIGLVLYILAGIVIYLTNGNFKGKATFKPVDALYFIVVTLCTIGYGDIVPDTTFTKLFTCVFILIGFGFVDI 184 (378)
Q Consensus 105 ~~~~~~~~~~~l~~~l~~g~~~~~~~~~~~~~~~~~~~~a~yf~~vtltTvGyGdi~P~t~~g~~~~~~~~l~Gi~~~~~ 184 (378)
+|......++++++.++.+.++|+.|+..++.+..++.||+||+++|+|||||||++|.|+.||++++++++.|+.++++
T Consensus 5 ~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~ 84 (103)
T d1r3jc_ 5 WRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGL 84 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHH
Confidence 45544445555555566666666777766666677899999999999999999999999999999999999999999999
Q ss_pred hhcchhhhhhhhHH
Q 040114 185 LLNGLVTYICDRQE 198 (378)
Q Consensus 185 ~~~~~~~~l~~~~~ 198 (378)
.++.+.+.+.++++
T Consensus 85 ~~~~i~~~~~~~~~ 98 (103)
T d1r3jc_ 85 VTAALATWFVGREQ 98 (103)
T ss_dssp HHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHH
Confidence 99999887776543
|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|