Citrus Sinensis ID: 040165

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
cccccHHHHHccccccccHHHHHHHHcccHHHHHHHccHHHHHHHHHHcccccccccccEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccEEEEcccccEEEcccccccccccEEEEEEEccccccEEEEEEEEEccEEEEEEcccccEEEEccccccccccccccccccEEEcccEEEEEEcccccccccEEEEEEccccEEEEEccccccccccEEEEccEEccEEEEEcccccccEEEEEEEccccccccEEEEEEEcccccccccccccEEEEEEEEEcccEEEEEEcccEEEEEEccccEEEEEEEcccccEEEEEEEccccccccc
cccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccEEEEEEEEEEEcccccccccccccccccccccccccccccEEEEEEEccEEEEEEEcccccEEEEccccccEEEccccccccccEEEEEEEEccccccEEEEEEEccccEEEEEEEccccEEEEEcccccccccccccccccEEEEcEEEEEEEEcccccccEEEEEEEcccccccccccccccccccEEEEEEEcccEEEEEEEcccccEEEEEEEEcccccEEEEEEEEEcccccccccccccccEEEEEEEEccEEEEEEcccEEEEEEccccEEEEEEEccccccEEEEEEccccccccc
MWSIPKDILEAEILCRLpiksllrfkcvskewhclisdpkfaLYRQkkqgeidnnnTIHQRVLVLAISPDRLQSLHCLTRCITelnfnfpfesipnviigsCNGLVCMALhgckdffiynpstrahkklpdpdislgspylygfgydsstddYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVklfygtesppkgclfngalhwlvsgfhfgsqdpvIIAFDLAEEKFCrvgeachprsvslgvvggclslnvccsncvdkttDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCtatgtdggdeIIMINKWREFIScnlnertleeiyrpnfdwcetvsytesilspnvl
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRahkklpdpdislGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETvsytesilspnvl
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
*****KDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESI******
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
*WSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWSIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVLVLAISPDRLQSLHCLTRCITELNFNFPFESIPNVIIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRVGEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRPNFDWCETVSYTESILSPNVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query358 2.2.26 [Sep-21-2011]
Q8GXC7427 F-box/kelch-repeat protei yes no 0.913 0.765 0.286 1e-25
Q9LIR8364 F-box/kelch-repeat protei no no 0.759 0.747 0.299 8e-23
Q9SU30413 F-box protein CPR30 OS=Ar no no 0.734 0.636 0.3 1e-21
Q9SUY0402 F-box protein At4g22390 O no no 0.748 0.666 0.268 4e-17
Q9C800441 Putative F-box protein At no no 0.734 0.596 0.274 1e-14
Q9FGS3357 Putative F-box protein At no no 0.748 0.750 0.277 2e-12
Q9SFC7417 F-box protein At3g07870 O no no 0.717 0.616 0.267 3e-12
Q9FGY4359 F-box protein At5g49610 O no no 0.592 0.590 0.285 3e-12
Q9LU24360 Putative F-box protein At no no 0.812 0.808 0.222 6e-12
Q9M0Q9383 Putative F-box protein At no no 0.703 0.657 0.264 9e-12
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function desciption
 Score =  117 bits (294), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 118/412 (28%), Positives = 183/412 (44%), Gaps = 85/412 (20%)

Query: 4   IPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQRVL 63
           +P +I+  EIL RLP KS+ RF+CVSK +  L SDP FA          ++  ++H++++
Sbjct: 36  LPPEII-TEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLILRNESVRSLHRKLI 94

Query: 64  VLAISPDRL--QSLHCLTRCITELNFNFPFESIPNV------------------------ 97
           V + +   L   S+    R +  +  N+P +  P++                        
Sbjct: 95  VSSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLN 154

Query: 98  ----------IIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLGSPY------L 141
                     I+GS NGLVC++  G    F+YNP+T   K+LP+        Y       
Sbjct: 155 AKSYRRNWVEIVGSSNGLVCIS-PGEGAVFLYNPTTGDSKRLPENFRPKSVEYERDNFQT 213

Query: 142 YGFGYDSSTDDYKVL---AVSCLRVLLKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCL 198
           YGFG+D  TDDYK++   A S   +   V+S+KA SWR +     +   +   S   G  
Sbjct: 214 YGFGFDGLTDDYKLVKLVATSEDILDASVYSLKADSWRRI---CNLNYEHNDGSYTSGVH 270

Query: 199 FNGALHWLVSGFHFGSQDPVIIAFDLAEEKFCRV-----GEACHPRSVSLGVVGGCLSLN 253
           FNGA+HW+ +      +  V++AFD+  E+F  +      E C  R  +  V  G L+  
Sbjct: 271 FNGAIHWVFTESRHNQR--VVVAFDIQTEEFREMPVPDEAEDCSHRFSNFVV--GSLNGR 326

Query: 254 VCCSN-CVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDE 312
           +C  N C D   D  +WVM +YG   SW R+      I + Y  S+  LC+       DE
Sbjct: 327 LCVVNSCYDVHDD--IWVMSEYGEAKSWSRIR-----INLLYR-SMKPLCSTKN----DE 374

Query: 313 IIMINKWREFISCNLNERTLEEIYRPNFDWC--------ETVSYTESILSPN 356
            +++    + +  N      E     N   C        E  +Y ES++SPN
Sbjct: 375 EVLLELDGDLVLYNF-----ETNASSNLGICGVKLSDGFEANTYVESLISPN 421

Arabidopsis thaliana (taxid: 3702)
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function description
>sp|Q9SUY0|FB244_ARATH F-box protein At4g22390 OS=Arabidopsis thaliana GN=At4g22390 PE=2 SV=3 Back     alignment and function description
>sp|Q9C800|FB34_ARATH Putative F-box protein At1g33530 OS=Arabidopsis thaliana GN=At1g33530 PE=4 SV=1 Back     alignment and function description
>sp|Q9FGS3|FB287_ARATH Putative F-box protein At5g50220 OS=Arabidopsis thaliana GN=At5g50220 PE=4 SV=1 Back     alignment and function description
>sp|Q9SFC7|FB135_ARATH F-box protein At3g07870 OS=Arabidopsis thaliana GN=At3g07870 PE=2 SV=1 Back     alignment and function description
>sp|Q9FGY4|FB341_ARATH F-box protein At5g49610 OS=Arabidopsis thaliana GN=At5g49610 PE=1 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q9M0Q9|FB223_ARATH Putative F-box protein At4g09190 OS=Arabidopsis thaliana GN=At4g09190 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
255558738369 ubiquitin-protein ligase, putative [Rici 0.924 0.897 0.336 5e-39
224129168374 predicted protein [Populus trichocarpa] 0.905 0.866 0.334 6e-36
255554010406 ubiquitin-protein ligase, putative [Rici 0.938 0.827 0.318 7e-35
224060347372 predicted protein [Populus trichocarpa] 0.944 0.908 0.319 2e-34
255580390 1029 Transitional endoplasmic reticulum ATPas 0.930 0.323 0.343 3e-34
224060349364 predicted protein [Populus trichocarpa] 0.762 0.75 0.365 5e-33
357458431370 F-box [Medicago truncatula] gi|355488544 0.832 0.805 0.343 2e-31
225433770360 PREDICTED: F-box/kelch-repeat protein At 0.944 0.938 0.305 2e-31
357447623375 F-box/kelch-repeat protein [Medicago tru 0.840 0.802 0.308 4e-31
357458437 489 F-box protein [Medicago truncatula] gi|3 0.782 0.572 0.340 4e-31
>gi|255558738|ref|XP_002520393.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223540440|gb|EEF42009.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  167 bits (424), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 190/374 (50%), Gaps = 43/374 (11%)

Query: 3   SIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLIS-DPKFALYRQKKQGEIDNNNTIHQR 61
            +P +I+  +IL RLP+K L++FKCV + W  LIS DP+FA    ++  ++ N   +H  
Sbjct: 7   QLPFEII-IDILSRLPVKHLIQFKCVCRTWQYLISSDPEFAKLHLERVLQVTN---VHLH 62

Query: 62  VLVLAISPDRLQSLHCLTRCITELNF-----NFPFESIPN---VIIGSCNGLVCMALHGC 113
            L+L+  P   QS+     C  + NF      FP  +  +     +GSCNGL+       
Sbjct: 63  RLLLSADP--FQSVDMEAYCDADDNFLIREHRFPVRNPEDDDFEFVGSCNGLISAVFGSD 120

Query: 114 KDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVL----AVSCLRVLLKVFS 169
            +  ++NPST   +KLP P  S      YGFGYDS  DDYK++    + SC  V ++VF+
Sbjct: 121 HEITVWNPSTGESRKLPAPTSSTEDKLFYGFGYDSKLDDYKIVRGASSASCNEVQMEVFN 180

Query: 170 MKAFSWRDVHYNLGVKL-FYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEK 228
           +K   WR +  NL   + F G+         NG LHWLV   + G    +I++ DLAEEK
Sbjct: 181 LKGNRWRAIQ-NLHCNVRFQGS-----AIALNGILHWLVDQLNEGL---MIVSLDLAEEK 231

Query: 229 FCRV----GEACHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLT 284
           F  +              L V+G   SL+VC S+    TT+FE W +K YG  +SW +L 
Sbjct: 232 FLEMVVLPDYVTENWGTELKVLGD--SLSVCSSS---HTTNFEAWTVKGYGSKASWLKLF 286

Query: 285 KIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREFISCNLNERTLEEIYRP-NFDWC 343
             ++D +      L  L  A   +    +++  +  E I  N  E+TL++   P N+ W 
Sbjct: 287 SFNSDPLPGCKYWLNVLWVAKNGN----VLLNYEGLEIIVYNPKEQTLKQFNVPNNWHWF 342

Query: 344 ETVSYTESILSPNV 357
           E ++Y ES++SPN 
Sbjct: 343 EAITYIESLVSPNA 356

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129168|ref|XP_002328907.1| predicted protein [Populus trichocarpa] gi|222839337|gb|EEE77674.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255554010|ref|XP_002518045.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223542641|gb|EEF44178.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224060347|ref|XP_002300154.1| predicted protein [Populus trichocarpa] gi|222847412|gb|EEE84959.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255580390|ref|XP_002531022.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223529397|gb|EEF31360.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224060349|ref|XP_002300155.1| predicted protein [Populus trichocarpa] gi|222847413|gb|EEE84960.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357458431|ref|XP_003599496.1| F-box [Medicago truncatula] gi|355488544|gb|AES69747.1| F-box [Medicago truncatula] Back     alignment and taxonomy information
>gi|225433770|ref|XP_002268486.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357447623|ref|XP_003594087.1| F-box/kelch-repeat protein [Medicago truncatula] gi|355483135|gb|AES64338.1| F-box/kelch-repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357458437|ref|XP_003599499.1| F-box protein [Medicago truncatula] gi|355488547|gb|AES69750.1| F-box protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query358
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.667 0.559 0.321 3.9e-32
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.759 0.747 0.308 1e-29
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.463 0.401 0.335 2.7e-19
TAIR|locus:2006902441 AT1G33530 "AT1G33530" [Arabido 0.734 0.596 0.284 1.1e-14
TAIR|locus:2127465402 AT4G22390 "AT4G22390" [Arabido 0.765 0.681 0.263 4.1e-14
TAIR|locus:2077452417 AT3G07870 "AT3G07870" [Arabido 0.413 0.354 0.298 9.4e-14
TAIR|locus:2141548383 AT4G09190 "AT4G09190" [Arabido 0.712 0.665 0.277 1.2e-12
TAIR|locus:2094947360 AT3G16210 "AT3G16210" [Arabido 0.863 0.858 0.243 1.7e-12
TAIR|locus:2024437382 AT1G09650 "AT1G09650" [Arabido 0.770 0.722 0.279 2e-12
TAIR|locus:2157757357 AT5G50220 "AT5G50220" [Arabido 0.413 0.414 0.304 7.3e-12
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 3.9e-32, Sum P(2) = 3.9e-32
 Identities = 89/277 (32%), Positives = 138/277 (49%)

Query:    98 IIGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPD---P---DISLGSPYLYGFGYDSSTD 151
             I+GS NGLVC++  G    F+YNP+T   K+LP+   P   +    +   YGFG+D  TD
Sbjct:   165 IVGSSNGLVCIS-PGEGAVFLYNPTTGDSKRLPENFRPKSVEYERDNFQTYGFGFDGLTD 223

Query:   152 DYKVLA-VSCLRVLL--KVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVS 208
             DYK++  V+    +L   V+S+KA SWR +  NL  +  +   S   G  FNGA+HW+ +
Sbjct:   224 DYKLVKLVATSEDILDASVYSLKADSWRRI-CNLNYE--HNDGSYTSGVHFNGAIHWVFT 280

Query:   209 GFHFGSQDPVIIAFDLAEEKFCRV-----GEACHPRSVSLGVVGGCLSLNVCCSN-CVDK 262
                   +  V++AFD+  E+F  +      E C  R  +  VVG  L+  +C  N C D 
Sbjct:   281 ESRHNQR--VVVAFDIQTEEFREMPVPDEAEDCSHRFSNF-VVGS-LNGRLCVVNSCYDV 336

Query:   263 TTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKWREF 322
               D  +WVM +YG   SW R+ +I+  ++ R   S+  LC+       DE +++    + 
Sbjct:   337 HDD--IWVMSEYGEAKSWSRI-RIN--LLYR---SMKPLCSTKN----DEEVLLELDGDL 384

Query:   323 ISCNLNERTLEEIYRPNF---DWCETVSYTESILSPN 356
             +  N        +        D  E  +Y ES++SPN
Sbjct:   385 VLYNFETNASSNLGICGVKLSDGFEANTYVESLISPN 421
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2006902 AT1G33530 "AT1G33530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127465 AT4G22390 "AT4G22390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077452 AT3G07870 "AT3G07870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141548 AT4G09190 "AT4G09190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094947 AT3G16210 "AT3G16210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024437 AT1G09650 "AT1G09650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157757 AT5G50220 "AT5G50220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033571001
SubName- Full=Chromosome chr5 scaffold_67, whole genome shotgun sequence; (361 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 2e-19
pfam0064648 pfam00646, F-box, F-box domain 1e-05
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 1e-05
pfam1293747 pfam12937, F-box-like, F-box-like 9e-04
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information 
 Score = 85.5 bits (212), Expect = 2e-19
 Identities = 56/237 (23%), Positives = 94/237 (39%), Gaps = 30/237 (12%)

Query: 99  IGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPD--ISLGSPYLYGFGYDSSTDDYKVL 156
           +  C+GL+C      K   ++NPST   + LP P    S      Y  GYD     YKVL
Sbjct: 1   VVPCDGLIC--FSYGKRLVVWNPSTGQSRWLPTPKSRRSNKESDTYFLGYDPIEKQYKVL 58

Query: 157 AVSCLRVL-----LKVFSMKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFH 211
             S           +V+++ + SWR +  +      +      +G   NG L++L +   
Sbjct: 59  CFSDRSGNRNQSEHQVYTLGSNSWRTIECSPP---HHPL--KSRGVCINGVLYYL-AYTL 112

Query: 212 FGSQDPVIIAFDLAEEKFCRVGEAC-----HPRSVSLGVVGGCLSLNVCCSNCVDKTTDF 266
             + D  I++FD++ E+F                +SL    G L++ +        T +F
Sbjct: 113 KTNPDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINYKGKLAV-LKQKKD---TNNF 168

Query: 267 ELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATG-TDGGDEIIMINKWREF 322
           +LWV+   G    W +L  +     +     LV     +G TD G+ ++       F
Sbjct: 169 DLWVLNDAGKQ-EWSKLFTVP----IPPLPDLVDDNFLSGFTDKGEIVLCCEDENPF 220

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 358
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.62
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.61
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.59
PHA02713557 hypothetical protein; Provisional 99.58
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.55
PHA02790480 Kelch-like protein; Provisional 99.5
PHA02713557 hypothetical protein; Provisional 99.49
PHA03098534 kelch-like protein; Provisional 99.47
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.46
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.31
PLN02153341 epithiospecifier protein 99.31
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.25
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.22
PHA03098534 kelch-like protein; Provisional 99.21
PLN02193470 nitrile-specifier protein 99.18
PHA02790480 Kelch-like protein; Provisional 99.13
PLN02153341 epithiospecifier protein 99.08
PLN02193470 nitrile-specifier protein 99.02
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.94
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.92
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.85
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.82
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.65
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.52
KOG4693392 consensus Uncharacterized conserved protein, conta 98.42
KOG4693392 consensus Uncharacterized conserved protein, conta 98.15
KOG1230 521 consensus Protein containing repeated kelch motifs 98.12
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.78
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.76
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.53
KOG1230 521 consensus Protein containing repeated kelch motifs 97.32
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.31
PF1396450 Kelch_6: Kelch motif 97.25
COG3055381 Uncharacterized protein conserved in bacteria [Fun 97.16
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 96.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.75
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 96.24
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.03
smart00284255 OLF Olfactomedin-like domains. 96.02
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 95.8
KOG2997366 consensus F-box protein FBX9 [General function pre 95.72
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 94.97
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 94.72
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.07
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 93.89
COG3055381 Uncharacterized protein conserved in bacteria [Fun 93.71
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 93.35
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 93.2
smart0061247 Kelch Kelch domain. 93.11
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.68
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 92.55
PLN02772 398 guanylate kinase 92.46
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 92.44
smart0061247 Kelch Kelch domain. 91.98
PF1396450 Kelch_6: Kelch motif 91.85
KOG0310 487 consensus Conserved WD40 repeat-containing protein 91.75
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 91.71
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 91.4
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 91.21
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.11
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 91.04
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 90.47
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 89.8
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 89.72
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.48
PRK11028 330 6-phosphogluconolactonase; Provisional 89.16
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 88.68
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 88.26
PF1341549 Kelch_3: Galactose oxidase, central domain 88.21
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 87.56
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 86.07
cd01206111 Homer Homer type EVH1 domain. Homer type EVH1 doma 85.71
COG2706 346 3-carboxymuconate cyclase [Carbohydrate transport 85.57
KOG3545249 consensus Olfactomedin and related extracellular m 85.07
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 84.25
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 82.75
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 82.04
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 80.22
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information 
Probab=100.00  E-value=1.9e-33  Score=243.65  Aligned_cols=216  Identities=25%  Similarity=0.405  Sum_probs=162.6

Q ss_pred             EEeecceEEEEEeCCceEEEEcccccceeccCCCCCCCC--CCceEEEeEeCCCCCeEEEEEEc-----cceEEEEEEcC
Q 040165           99 IGSCNGLVCMALHGCKDFFIYNPSTRAHKKLPDPDISLG--SPYLYGFGYDSSTDDYKVLAVSC-----LRVLLKVFSMK  171 (358)
Q Consensus        99 ~~s~~Gll~~~~~~~~~~~V~NP~T~~~~~lP~~~~~~~--~~~~~~~~~d~~~~~ykvv~~~~-----~~~~~~vyss~  171 (358)
                      ++|||||||+.  ....++||||+||+++.||+++....  ....++||||+.+++||||++..     ....++||+++
T Consensus         1 ~~sCnGLlc~~--~~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~G~d~~~~~YKVv~~~~~~~~~~~~~~~Vys~~   78 (230)
T TIGR01640         1 VVPCDGLICFS--YGKRLVVWNPSTGQSRWLPTPKSRRSNKESDTYFLGYDPIEKQYKVLCFSDRSGNRNQSEHQVYTLG   78 (230)
T ss_pred             CcccceEEEEe--cCCcEEEECCCCCCEEecCCCCCcccccccceEEEeecccCCcEEEEEEEeecCCCCCccEEEEEeC
Confidence            47999999997  34789999999999999998764311  11258899999999999999862     24689999999


Q ss_pred             CCceEecccccccccccccCCCCceEEECceEEEEeecCCCCCCCcEEEEEECCCCeeE-EecCCCC---C-CceEEEEE
Q 040165          172 AFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFGSQDPVIIAFDLAEEKFC-RVGEACH---P-RSVSLGVV  246 (358)
Q Consensus       172 t~~W~~~~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~~~~~~~i~~fD~~~~~~~-~i~~P~~---~-~~~~l~~~  246 (358)
                      +++||.+..     .+........+|++||.+||++...... ....|++||+.+|+|+ .+++|..   . ....|+++
T Consensus        79 ~~~Wr~~~~-----~~~~~~~~~~~v~~~G~lyw~~~~~~~~-~~~~IvsFDl~~E~f~~~i~~P~~~~~~~~~~~L~~~  152 (230)
T TIGR01640        79 SNSWRTIEC-----SPPHHPLKSRGVCINGVLYYLAYTLKTN-PDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLINY  152 (230)
T ss_pred             CCCcccccc-----CCCCccccCCeEEECCEEEEEEEECCCC-CcEEEEEEEcccceEeeeeecCccccccccceEEEEE
Confidence            999999875     2222112234999999999999764311 1138999999999999 5999942   1 35789999


Q ss_pred             CCeeEEEeecccccCCCCcEEEEEEccCCCCCceeEEEEeecCCccccCceeeEEEEeeecCCCcEEEEEcC--cceEEE
Q 040165          247 GGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINK--WREFIS  324 (358)
Q Consensus       247 ~g~L~lv~~~~~~~~~~~~~~vW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~~--~~~l~~  324 (358)
                      +|+|+++....    ....++||+|++++. .+|+|.++|+............++++   .++|+|++....  ...+..
T Consensus       153 ~G~L~~v~~~~----~~~~~~IWvl~d~~~-~~W~k~~~i~~~~~~~~~~~~~~~~~---~~~g~I~~~~~~~~~~~~~~  224 (230)
T TIGR01640       153 KGKLAVLKQKK----DTNNFDLWVLNDAGK-QEWSKLFTVPIPPLPDLVDDNFLSGF---TDKGEIVLCCEDENPFYIFY  224 (230)
T ss_pred             CCEEEEEEecC----CCCcEEEEEECCCCC-CceeEEEEEcCcchhhhhhheeEeEE---eeCCEEEEEeCCCCceEEEE
Confidence            99999998421    134699999998765 46999999996544332222557777   778998887764  224999


Q ss_pred             EECCCC
Q 040165          325 CNLNER  330 (358)
Q Consensus       325 yd~~t~  330 (358)
                      ||++|+
T Consensus       225 y~~~~~  230 (230)
T TIGR01640       225 YNVGEN  230 (230)
T ss_pred             EeccCC
Confidence            999985

This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.
>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>cd01206 Homer Homer type EVH1 domain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query358
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
 Score = 41.8 bits (97), Expect = 2e-04
 Identities = 14/89 (15%), Positives = 32/89 (35%), Gaps = 2/89 (2%)

Query: 3   SIPKDILEAEILCRLPIKSLLRF-KCVSKEWHCLISDPKFALYRQKKQGEIDNNNTIHQR 61
            +P+ +L   +L  LP   L++  + V   W  L+      L + +++G +   +   +R
Sbjct: 53  ELPEPLLL-RVLAELPATELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEER 111

Query: 62  VLVLAISPDRLQSLHCLTRCITELNFNFP 90
                      +  + L     E +    
Sbjct: 112 DHWQQFYFLSKRRRNLLRNPCGEEDLEGW 140
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.57
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.56
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.56
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.55
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.55
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.54
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.53
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.49
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.44
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.43
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.42
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.42
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.37
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.31
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.2
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.98
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.95
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.78
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.78
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.78
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.73
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.71
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.18
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 96.5
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.12
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 95.97
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 95.78
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 95.58
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.24
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 94.82
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.16
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 94.11
3jro_A 753 Fusion protein of protein transport protein SEC13 94.04
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.02
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 93.78
3v65_B386 Low-density lipoprotein receptor-related protein; 93.68
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 93.63
3jrp_A 379 Fusion protein of protein transport protein SEC13 93.3
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.26
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 93.21
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 93.08
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.05
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 93.02
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.91
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 92.86
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 92.61
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 92.6
4e54_B435 DNA damage-binding protein 2; beta barrel, double 92.14
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.06
3jrp_A379 Fusion protein of protein transport protein SEC13 92.03
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 91.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 91.72
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 91.7
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.67
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 91.57
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 91.35
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 91.25
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 91.19
3p5b_L400 Low density lipoprotein receptor variant; B-propel 91.12
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 90.99
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 90.83
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 90.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 90.74
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 90.69
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 90.45
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 89.81
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 89.75
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 89.51
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 89.43
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 89.41
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 89.39
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 89.33
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 88.53
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 88.52
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 88.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 87.76
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 87.58
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 87.05
3v9f_A 781 Two-component system sensor histidine kinase/RESP 86.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 86.63
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 86.23
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 86.12
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 86.05
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 85.45
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 85.13
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 84.89
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 84.85
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 84.55
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 84.53
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 84.43
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 84.17
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 84.0
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 83.94
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 83.59
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 83.24
4g56_B357 MGC81050 protein; protein arginine methyltransfera 83.11
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 82.83
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 82.63
4a2l_A 795 BT_4663, two-component system sensor histidine kin 81.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 81.6
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 81.34
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 81.25
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 81.06
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 80.56
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 80.32
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 80.25
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 80.24
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 80.04
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=99.57  E-value=6.7e-13  Score=118.42  Aligned_cols=212  Identities=9%  Similarity=0.011  Sum_probs=138.5

Q ss_pred             EEEeecceEEEEEe-----CCceEEEEcccccceeccCCCCCCCCCCceEEEeEeCCCCCeEEEEEE---ccceEEEEEE
Q 040165           98 IIGSCNGLVCMALH-----GCKDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVS---CLRVLLKVFS  169 (358)
Q Consensus        98 ~~~s~~Gll~~~~~-----~~~~~~V~NP~T~~~~~lP~~~~~~~~~~~~~~~~d~~~~~ykvv~~~---~~~~~~~vys  169 (358)
                      .++..+|.|.+...     ....+.++||.|++|..+++++.++......  .+   .+...|+...   .....+++|+
T Consensus        56 ~~~~~~~~lyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~--~~---~~~iyv~GG~~~~~~~~~~~~~d  130 (302)
T 2xn4_A           56 GMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAA--VL---NGLLYAVGGFDGSTGLSSVEAYN  130 (302)
T ss_dssp             EEEEETTEEEEESCBCSSSBCCCEEEEETTTTEEEEECCCSSCCBSCEEE--EE---TTEEEEEEEECSSCEEEEEEEEE
T ss_pred             eEEEECCEEEEEeCcCCCccccceEEECCCCCceeeCCCCCccccceEEE--EE---CCEEEEEcCCCCCccCceEEEEe
Confidence            44555777766522     1256899999999999999887654322121  11   2222222222   2246799999


Q ss_pred             cCCCceEecccccccccccccCCCCceEEECceEEEEeecCCCC-CCCcEEEEEECCCCeeEEe-cCCCCCCceEEEEEC
Q 040165          170 MKAFSWRDVHYNLGVKLFYGTESPPKGCLFNGALHWLVSGFHFG-SQDPVIIAFDLAEEKFCRV-GEACHPRSVSLGVVG  247 (358)
Q Consensus       170 s~t~~W~~~~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~~-~~~~~i~~fD~~~~~~~~i-~~P~~~~~~~l~~~~  247 (358)
                      +.+++|+.++.     +|... ....++.++|.+|.+++..... .....+..||+.+++|+.+ ++|..+....++..+
T Consensus       131 ~~~~~W~~~~~-----~p~~r-~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~  204 (302)
T 2xn4_A          131 IKSNEWFHVAP-----MNTRR-SSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIAEMSTRRSGAGVGVLN  204 (302)
T ss_dssp             TTTTEEEEECC-----CSSCC-BSCEEEEETTEEEEECCEETTTTEECCCEEEEETTTTEEEEECCCSSCCBSCEEEEET
T ss_pred             CCCCeEeecCC-----CCCcc-cCceEEEECCEEEEEeCCCCCCCccccEEEEEeCCCCcEEECCCCccccccccEEEEC
Confidence            99999999987     66543 4467788999999998764321 1135799999999999998 555444455677889


Q ss_pred             CeeEEEeecccccCCCCcEEEEEEccCCCCCceeEEEEeecCCccccCceeeEEEEeeecCCCcEEEEEcCc-----ceE
Q 040165          248 GCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLVTLCTATGTDGGDEIIMINKW-----REF  322 (358)
Q Consensus       248 g~L~lv~~~~~~~~~~~~~~vW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~~~-----~~l  322 (358)
                      |+|+++++..+.. ...  ++|.++..  ...|+++..++....      ...+++    .++.|++.....     ..+
T Consensus       205 ~~iyv~GG~~~~~-~~~--~~~~yd~~--~~~W~~~~~~~~~r~------~~~~~~----~~~~i~v~GG~~~~~~~~~v  269 (302)
T 2xn4_A          205 NLLYAVGGHDGPL-VRK--SVEVYDPT--TNAWRQVADMNMCRR------NAGVCA----VNGLLYVVGGDDGSCNLASV  269 (302)
T ss_dssp             TEEEEECCBSSSS-BCC--CEEEEETT--TTEEEEECCCSSCCB------SCEEEE----ETTEEEEECCBCSSSBCCCE
T ss_pred             CEEEEECCCCCCc-ccc--eEEEEeCC--CCCEeeCCCCCCccc------cCeEEE----ECCEEEEECCcCCCcccccE
Confidence            9999999754311 123  45555542  268998875553321      222332    256677765421     259


Q ss_pred             EEEECCCCeEEEe
Q 040165          323 ISCNLNERTLEEI  335 (358)
Q Consensus       323 ~~yd~~t~~~~~v  335 (358)
                      ..||+++++|+++
T Consensus       270 ~~yd~~~~~W~~~  282 (302)
T 2xn4_A          270 EYYNPTTDKWTVV  282 (302)
T ss_dssp             EEEETTTTEEEEC
T ss_pred             EEEcCCCCeEEEC
Confidence            9999999999998
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 358
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 5e-07
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 5e-04
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 0.003
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 43.5 bits (103), Expect = 5e-07
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 3  SIPKDILEAEILCRLPIKSLLRFKCVSKEWHCLISDPKF 41
          S+P ++L   I   L +  LL+   V K W+ L SD   
Sbjct: 3  SLPDELLL-GIFSCLCLPELLKVSGVCKRWYRLASDESL 40
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query358
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.19
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.77
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 98.76
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.7
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.55
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.38
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.01
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 95.19
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 94.98
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.36
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 93.64
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.47
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 87.51
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 85.01
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 84.94
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.46
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 84.29
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 80.4
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.2
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.19  E-value=7.7e-10  Score=95.27  Aligned_cols=200  Identities=9%  Similarity=0.019  Sum_probs=119.7

Q ss_pred             ceEEEEcccccceeccCCCCCCCCCCceEEEeEeCCCCCeEEEEEE-------ccceEEEEEEcCCCceEeccccccccc
Q 040165          114 KDFFIYNPSTRAHKKLPDPDISLGSPYLYGFGYDSSTDDYKVLAVS-------CLRVLLKVFSMKAFSWRDVHYNLGVKL  186 (358)
Q Consensus       114 ~~~~V~NP~T~~~~~lP~~~~~~~~~~~~~~~~d~~~~~ykvv~~~-------~~~~~~~vyss~t~~W~~~~~~~~~~~  186 (358)
                      ..+.++||.|++|..+|++|.++.....+  ..   .+..-|+...       .....+++|+..+++|+.++.     +
T Consensus        19 ~~~~~yd~~t~~W~~~~~~p~~R~~~~~~--~~---~~~iyv~GG~~~~~~~~~~~~~~~~yd~~~~~w~~~~~-----~   88 (288)
T d1zgka1          19 SYLEAYNPSNGTWLRLADLQVPRSGLAGC--VV---GGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAP-----M   88 (288)
T ss_dssp             CCEEEEETTTTEEEECCCCSSCCBSCEEE--EE---TTEEEEECCEEEETTEEEECCCEEEEETTTTEEEECCC-----C
T ss_pred             ceEEEEECCCCeEEECCCCCCccceeEEE--EE---CCEEEEEeCcccCCCCccccchhhhccccccccccccc-----c
Confidence            46789999999999999887653322111  11   1211122111       234678999999999999887     6


Q ss_pred             ccccCCCCceEEECceEEEEeecCCCC----------------------------------------------CCCcEEE
Q 040165          187 FYGTESPPKGCLFNGALHWLVSGFHFG----------------------------------------------SQDPVII  220 (358)
Q Consensus       187 ~~~~~~~~~~v~~~G~lywl~~~~~~~----------------------------------------------~~~~~i~  220 (358)
                      |... ..+.++..+|++|.+++.....                                              .....+.
T Consensus        89 p~~r-~~~~~~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~~~~~~~~~  167 (288)
T d1zgka1          89 SVPR-NRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAE  167 (288)
T ss_dssp             SSCC-BTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSSCBCCCEE
T ss_pred             ccee-cceeccccceeeEEecceecccccceeeeeccccCccccccccccccccceeeeeeecceEecCcccccccceEE
Confidence            6543 4567778899999886532110                                              0123456


Q ss_pred             EEECCCCeeEEecCC-CCCCceEEEEECCeeEEEeecccccCCCCcEEEEEEccCCCCCceeEEEEeecCCccccCceee
Q 040165          221 AFDLAEEKFCRVGEA-CHPRSVSLGVVGGCLSLNVCCSNCVDKTTDFELWVMKQYGVHSSWERLTKIDNDIMVRYHGSLV  299 (358)
Q Consensus       221 ~fD~~~~~~~~i~~P-~~~~~~~l~~~~g~L~lv~~~~~~~~~~~~~~vW~l~~~~~~~~W~~~~~i~~~~~~~~~~~~~  299 (358)
                      .||+.+++|...+.+ ........+..+++++++++....   ...-..|..+..  ..+|..+..++...      ...
T Consensus       168 ~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~GG~~~~---~~~~~~~~~~~~--~~~~~~~~~~p~~r------~~~  236 (288)
T d1zgka1         168 CYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQ---DQLNSVERYDVE--TETWTFVAPMKHRR------SAL  236 (288)
T ss_dssp             EEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCSS---SBCCCEEEEETT--TTEEEECCCCSSCC------BSC
T ss_pred             EeeccccccccccccccccccccccceeeeEEEecCcccc---ccccceeeeeec--ceeeecccCccCcc------cce
Confidence            667766666665443 222344666778999988865421   122334444432  26787765443322      122


Q ss_pred             EEEEeeecCCCcEEEEEcCc-----ceEEEEECCCCeEEEeeccc
Q 040165          300 TLCTATGTDGGDEIIMINKW-----REFISCNLNERTLEEIYRPN  339 (358)
Q Consensus       300 ~~~~~~~~~~g~i~~~~~~~-----~~l~~yd~~t~~~~~v~~~~  339 (358)
                      .+++    .+|+|++.....     ..++.||+++++|+.+-.++
T Consensus       237 ~~~~----~~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~~p  277 (288)
T d1zgka1         237 GITV----HQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMT  277 (288)
T ss_dssp             EEEE----ETTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEECS
T ss_pred             EEEE----ECCEEEEEecCCCCeecceEEEEECCCCEEEECCCCC
Confidence            2333    257788865321     25899999999999994444
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure