Citrus Sinensis ID: 040166

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MQGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG
cccEEEEEEEccccccEEEEEEcccccccccccccccHHHHHcccEEcHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHccEEEEcHHHHHHHHcccccccHHHHHHHHHHccccEEEEEcccccEEEEEcccEEEEcc
cccEEEEEEEEcccccEEEEEEEcccHHHcccHHHccHHHHHEHHHcccccHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHccEEEEcHHHHHHHcccccHHHHHHHHHHHHcccccEEEEEcccccEEEEEccccEEccc
MQGLHWLFVTLTAegergfmffrnpsaEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSgcilsydpnarllpwpsaeaarggiisiWDEADMIKISEEELTLLIEgcdasddnvVLEKLFHSNLKLLLVTEgsngckyytqefkghvgg
MQGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQefkghvgg
MQGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG
***LHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEF******
*QGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVG*
MQGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG
*QGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
SSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRSAHIAAMEMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
O82616324 Putative fructokinase-5 O no no 0.942 0.453 0.573 6e-44
Q0J8G4336 Fructokinase-2 OS=Oryza s yes no 0.942 0.437 0.547 1e-42
A2YQL4336 Fructokinase-2 OS=Oryza s N/A no 0.942 0.437 0.547 1e-42
Q0JGZ6323 Fructokinase-1 OS=Oryza s no no 0.929 0.448 0.554 2e-41
A2WXV8323 Fructokinase-1 OS=Oryza s N/A no 0.929 0.448 0.554 4e-41
Q42896328 Fructokinase-2 OS=Solanum N/A no 0.942 0.448 0.554 1e-40
Q7XJ81328 Fructokinase-2 OS=Solanum N/A no 0.942 0.448 0.554 1e-40
Q9M1B9326 Probable fructokinase-4 O no no 0.929 0.444 0.541 2e-40
Q6XZ79323 Fructokinase-1 OS=Zea may N/A no 0.929 0.448 0.541 6e-40
Q9LNE3329 Probable fructokinase-2 O no no 0.929 0.440 0.541 2e-38
>sp|O82616|SCRK5_ARATH Putative fructokinase-5 OS=Arabidopsis thaliana GN=At4g10260 PE=2 SV=1 Back     alignment and function desciption
 Score =  176 bits (445), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 117/157 (74%), Gaps = 10/157 (6%)

Query: 8   FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKA--------SILLKPRRSAHIAAM 59
           FVTL  +GER FMF+RNPSA+MLL E+EL+ +LI+KA        S++ +P R+AH+AAM
Sbjct: 95  FVTLKKDGEREFMFYRNPSADMLLKESELNKDLIKKAKIFHYGSISLISEPCRTAHMAAM 154

Query: 60  EMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
           + AK +G +LSYDPN RL  WPS EAA  GI SIW+EAD+IK+S++E+T L  G DA  D
Sbjct: 155 KTAKDAGVLLSYDPNVRLPLWPSTEAAIEGIKSIWNEADIIKVSDDEVTFLTRG-DAEKD 213

Query: 120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG 156
           +VVL  L H  LKLL+VT+G  GC+YYT++FKG V G
Sbjct: 214 DVVLS-LMHDKLKLLIVTDGEKGCRYYTKKFKGRVPG 249
May play an important role in maintaining the flux of carbon towards starch formation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4
>sp|Q0J8G4|SCRK2_ORYSJ Fructokinase-2 OS=Oryza sativa subsp. japonica GN=FRK2 PE=1 SV=1 Back     alignment and function description
>sp|A2YQL4|SCRK2_ORYSI Fructokinase-2 OS=Oryza sativa subsp. indica GN=FRK2 PE=1 SV=2 Back     alignment and function description
>sp|Q0JGZ6|SCRK1_ORYSJ Fructokinase-1 OS=Oryza sativa subsp. japonica GN=FRK1 PE=1 SV=2 Back     alignment and function description
>sp|A2WXV8|SCRK1_ORYSI Fructokinase-1 OS=Oryza sativa subsp. indica GN=FRK1 PE=1 SV=1 Back     alignment and function description
>sp|Q42896|SCRK2_SOLLC Fructokinase-2 OS=Solanum lycopersicum GN=FRK2 PE=2 SV=2 Back     alignment and function description
>sp|Q7XJ81|SCRK2_SOLHA Fructokinase-2 OS=Solanum habrochaites GN=FRK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1B9|SCRK4_ARATH Probable fructokinase-4 OS=Arabidopsis thaliana GN=At3g59480 PE=2 SV=1 Back     alignment and function description
>sp|Q6XZ79|SCRK1_MAIZE Fructokinase-1 OS=Zea mays GN=FRK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LNE3|SCRK2_ARATH Probable fructokinase-2 OS=Arabidopsis thaliana GN=At1g06030 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
357500871 349 Fructokinase [Medicago truncatula] gi|35 0.955 0.426 0.668 3e-55
350535657 375 fructokinase [Solanum lycopersicum] gi|2 0.955 0.397 0.675 1e-54
356574458 341 PREDICTED: putative fructokinase-5-like 0.955 0.436 0.681 1e-54
356534175 347 PREDICTED: putative fructokinase-5-like 0.955 0.429 0.687 2e-54
356530913 346 PREDICTED: putative fructokinase-5-like 0.955 0.430 0.649 1e-52
359489519 371 PREDICTED: putative fructokinase-5-like 0.955 0.401 0.662 1e-52
21700777205 fructokinase [Citrus unshiu] 0.955 0.726 0.649 3e-52
255541404 381 fructokinase, putative [Ricinus communis 0.955 0.391 0.649 7e-52
357444147 356 Fructokinase [Medicago truncatula] gi|35 0.955 0.418 0.662 1e-51
147840622 371 hypothetical protein VITISV_012349 [Viti 0.955 0.401 0.656 1e-51
>gi|357500871|ref|XP_003620724.1| Fructokinase [Medicago truncatula] gi|355495739|gb|AES76942.1| Fructokinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 105/157 (66%), Positives = 129/157 (82%), Gaps = 8/157 (5%)

Query: 8   FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKA--------SILLKPRRSAHIAAM 59
           FVTL ++GER F+FFRNPSA+MLL E+ELD++L++KA        S++  P +SAHIAAM
Sbjct: 117 FVTLRSDGEREFLFFRNPSADMLLHESELDIDLLKKARIFHYGSISLIDDPCKSAHIAAM 176

Query: 60  EMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
            +AK+SGCILSYDPN RL  WPSAEAAR GI+SIWD+AD+IKISEEE+T L  G D  DD
Sbjct: 177 RIAKSSGCILSYDPNLRLALWPSAEAARNGIMSIWDQADVIKISEEEITFLTGGDDPYDD 236

Query: 120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG 156
           +VVL+KLFH NLKLL+VTEGS GC+YYT+EF+G VGG
Sbjct: 237 DVVLKKLFHRNLKLLIVTEGSKGCRYYTKEFRGRVGG 273

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|350535657|ref|NP_001234206.1| fructokinase [Solanum lycopersicum] gi|23476263|gb|AAM44084.1| fructokinase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356574458|ref|XP_003555364.1| PREDICTED: putative fructokinase-5-like [Glycine max] Back     alignment and taxonomy information
>gi|356534175|ref|XP_003535633.1| PREDICTED: putative fructokinase-5-like [Glycine max] Back     alignment and taxonomy information
>gi|356530913|ref|XP_003534023.1| PREDICTED: putative fructokinase-5-like [Glycine max] Back     alignment and taxonomy information
>gi|359489519|ref|XP_002272526.2| PREDICTED: putative fructokinase-5-like [Vitis vinifera] gi|296089121|emb|CBI38824.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|21700777|gb|AAM68123.1| fructokinase [Citrus unshiu] Back     alignment and taxonomy information
>gi|255541404|ref|XP_002511766.1| fructokinase, putative [Ricinus communis] gi|223548946|gb|EEF50435.1| fructokinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357444147|ref|XP_003592351.1| Fructokinase [Medicago truncatula] gi|355481399|gb|AES62602.1| Fructokinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|147840622|emb|CAN61782.1| hypothetical protein VITISV_012349 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
TAIR|locus:2165361343 AT5G51830 [Arabidopsis thalian 0.955 0.434 0.617 1.3e-45
TAIR|locus:2028987384 AT1G66430 [Arabidopsis thalian 0.948 0.385 0.611 4.5e-43
TAIR|locus:2122789324 AT4G10260 [Arabidopsis thalian 0.942 0.453 0.573 1.6e-40
TAIR|locus:2097553326 AT3G59480 [Arabidopsis thalian 0.929 0.444 0.541 4.3e-38
TAIR|locus:2198831329 AT1G06030 [Arabidopsis thalian 0.929 0.440 0.541 4.4e-36
TAIR|locus:2061320325 AT2G31390 [Arabidopsis thalian 0.929 0.446 0.535 9.2e-36
TAIR|locus:2198821345 AT1G06020 [Arabidopsis thalian 0.929 0.420 0.529 6.5e-35
TAIR|locus:2026465 616 FLN2 "fructokinase-like 2" [Ar 0.846 0.214 0.324 5.4e-13
UNIPROTKB|Q481A7336 CPS_2648 "Carbohydrate kinase, 0.871 0.404 0.310 1e-10
TIGR_CMR|CPS_2648336 CPS_2648 "carbohydrate kinase, 0.871 0.404 0.310 1e-10
TAIR|locus:2165361 AT5G51830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 479 (173.7 bits), Expect = 1.3e-45, P = 1.3e-45
 Identities = 97/157 (61%), Positives = 121/157 (77%)

Query:     8 FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKA--------SILLKPRRSAHIAAM 59
             FVTL  +GER F+FFR+PSA+MLL E+ELD NLI+KA        S++ +P RS  + AM
Sbjct:   112 FVTLRGDGEREFLFFRHPSADMLLLESELDKNLIQKAKIFHYGSISLIEEPCRSTQLVAM 171

Query:    60 EMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
             ++AK +G +LSYDPN RL  WPS EAAR  I+SIW+ AD+IKISE+E+T L  G D  DD
Sbjct:   172 KIAKAAGSLLSYDPNLRLPLWPSEEAARKEIMSIWNLADVIKISEDEITFLTGGDDPYDD 231

Query:   120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG 156
             +VVL+KLFH NLKLL+V+EG NGC+YYTQEFKG VGG
Sbjct:   232 DVVLQKLFHPNLKLLVVSEGPNGCRYYTQEFKGRVGG 268
GO:0004747 "ribokinase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006014 "D-ribose metabolic process" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2028987 AT1G66430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122789 AT4G10260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097553 AT3G59480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198831 AT1G06030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061320 AT2G31390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198821 AT1G06020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026465 FLN2 "fructokinase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q481A7 CPS_2648 "Carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2648 CPS_2648 "carbohydrate kinase, PfkB family" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00026311001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (314 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00014624001
RecName- Full=Glucose-6-phosphate isomerase; EC=5.3.1.9; (340 aa)
     •• 0.914
GSVIVG00012394001
SubName- Full=Chromosome undetermined scaffold_376, whole genome shotgun sequence;; Involved in [...] (366 aa)
•    •  0.905
GSVIVG00012389001
SubName- Full=Chromosome undetermined scaffold_376, whole genome shotgun sequence; (365 aa)
•    •  0.904
GSVIVG00031456001
RecName- Full=Xylose isomerase; EC=5.3.1.5; (477 aa)
     •• 0.902
GSVIVG00015125001
RecName- Full=Glucose-6-phosphate isomerase; EC=5.3.1.9; (623 aa)
     •• 0.900
GSVIVG00038234001
RecName- Full=Mannose-6-phosphate isomerase; EC=5.3.1.8; (420 aa)
     •  0.899
GSVIVG00032133001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (488 aa)
     •  0.899
GSVIVG00031779001
SubName- Full=Chromosome chr18 scaffold_59, whole genome shotgun sequence; (338 aa)
     •  0.899
GSVIVG00025935001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (563 aa)
     •  0.899
GSVIVG00024062001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (756 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
PLN02323330 PLN02323, PLN02323, probable fructokinase 3e-82
cd01167295 cd01167, bac_FRK, Fructokinases (FRKs) mainly from 2e-37
PRK09434304 PRK09434, PRK09434, aminoimidazole riboside kinase 4e-19
PLN02967 581 PLN02967, PLN02967, kinase 2e-18
cd01166294 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (Kdg 8e-17
COG0524311 COG0524, RbsK, Sugar kinases, ribokinase family [C 5e-15
PLN02543496 PLN02543, PLN02543, pfkB-type carbohydrate kinase 1e-11
pfam00294298 pfam00294, PfkB, pfkB family carbohydrate kinase 2e-11
cd00287196 cd00287, ribokinase_pfkB_like, ribokinase/pfkB sup 3e-05
>gnl|CDD|215183 PLN02323, PLN02323, probable fructokinase Back     alignment and domain information 
 Score =  245 bits (627), Expect = 3e-82
 Identities = 98/157 (62%), Positives = 120/157 (76%), Gaps = 10/157 (6%)

Query: 8   FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASIL--------LKPRRSAHIAAM 59
           FVTL ++GER FMF+RNPSA+MLL E+ELD++LI KA I          +P RSAH+AAM
Sbjct: 101 FVTLRSDGEREFMFYRNPSADMLLRESELDLDLIRKAKIFHYGSISLITEPCRSAHLAAM 160

Query: 60  EMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
           ++AK +G +LSYDPN RL  WPSAEAAR GI+SIWDEAD+IK+S+EE+  L  G D  DD
Sbjct: 161 KIAKEAGALLSYDPNLRLPLWPSAEAAREGIMSIWDEADIIKVSDEEVEFLTGGDDPDDD 220

Query: 120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG 156
            VV  KL+H NLKLLLVTEG  GC+YYT++FKG V G
Sbjct: 221 TVV--KLWHPNLKLLLVTEGEEGCRYYTKDFKGRVEG 255

Length = 330
>gnl|CDD|238572 cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>gnl|CDD|236514 PRK09434, PRK09434, aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>gnl|CDD|215521 PLN02967, PLN02967, kinase Back     alignment and domain information
>gnl|CDD|238571 cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>gnl|CDD|223598 COG0524, RbsK, Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215299 PLN02543, PLN02543, pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>gnl|CDD|215842 pfam00294, PfkB, pfkB family carbohydrate kinase Back     alignment and domain information
>gnl|CDD|238177 cd00287, ribokinase_pfkB_like, ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
PLN02967 581 kinase 99.9
PLN02543496 pfkB-type carbohydrate kinase family protein 99.89
PLN02323330 probable fructokinase 99.88
PRK15074 434 inosine/guanosine kinase; Provisional 99.86
PRK09434304 aminoimidazole riboside kinase; Provisional 99.85
cd01166294 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phospho 99.85
cd01167295 bac_FRK Fructokinases (FRKs) mainly from bacteria 99.84
cd01168312 adenosine_kinase Adenosine kinase (AK) catalyzes t 99.82
COG0524311 RbsK Sugar kinases, ribokinase family [Carbohydrat 99.82
PLN02341 470 pfkB-type carbohydrate kinase family protein 99.79
PTZ00292326 ribokinase; Provisional 99.79
PLN02379367 pfkB-type carbohydrate kinase family protein 99.79
PLN02813426 pfkB-type carbohydrate kinase family protein 99.79
PTZ00247345 adenosine kinase; Provisional 99.78
PRK11142306 ribokinase; Provisional 99.77
cd01944289 YegV_kinase_like YegV-like sugar kinase. Found onl 99.77
cd01174292 ribokinase Ribokinase catalyses the phosphorylatio 99.77
TIGR02152293 D_ribokin_bact ribokinase. This model describes ri 99.72
cd01943328 MAK32 MAK32 kinase. MAK32 is a protein found prima 99.71
KOG2855330 consensus Ribokinase [Carbohydrate transport and m 99.7
cd01942279 ribokinase_group_A Ribokinase-like subgroup A. Fou 99.69
PF00294301 PfkB: pfkB family carbohydrate kinase; InterPro: I 99.69
cd01945284 ribokinase_group_B Ribokinase-like subgroup B. Fou 99.66
PLN02548332 adenosine kinase 99.66
PRK09850313 pseudouridine kinase; Provisional 99.62
cd01940264 Fructoselysine_kinase_like Fructoselysine kinase-l 99.62
cd01939290 Ketohexokinase Ketohexokinase (fructokinase, KHK) 99.6
PLN02630 335 pfkB-type carbohydrate kinase family protein 99.6
cd01941288 YeiC_kinase_like YeiC-like sugar kinase. Found in 99.59
PRK13508309 tagatose-6-phosphate kinase; Provisional 99.58
cd01947265 Guanosine_kinase_like Guanosine kinase-like sugar 99.58
TIGR01231309 lacC tagatose-6-phosphate kinase. This enzyme is p 99.58
PRK09954362 putative kinase; Provisional 99.55
PRK10294309 6-phosphofructokinase 2; Provisional 99.54
TIGR03168303 1-PFK hexose kinase, 1-phosphofructokinase family. 99.53
TIGR03828304 pfkB 1-phosphofructokinase. This enzyme acts in co 99.52
PRK09813260 fructoselysine 6-kinase; Provisional 99.49
cd00287196 ribokinase_pfkB_like ribokinase/pfkB superfamily: 99.48
PRK09513312 fruK 1-phosphofructokinase; Provisional 99.48
cd01172304 RfaE_like RfaE encodes a bifunctional ADP-heptose 99.48
cd01164289 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 99.47
cd01937254 ribokinase_group_D Ribokinase-like subgroup D. Fou 99.47
cd01946277 ribokinase_group_C Ribokinase-like subgroup C. Fou 99.41
TIGR02198315 rfaE_dom_I rfaE bifunctional protein, domain I. Rf 99.37
cd01173254 pyridoxal_pyridoxamine_kinase Pyridoxal kinase pla 99.37
KOG2854343 consensus Possible pfkB family carbohydrate kinase 99.37
PRK12413253 phosphomethylpyrimidine kinase; Provisional 99.35
PRK07105284 pyridoxamine kinase; Validated 99.3
COG1105310 FruK Fructose-1-phosphate kinase and related fruct 99.29
PRK05756286 pyridoxamine kinase; Validated 99.28
PRK11316 473 bifunctional heptose 7-phosphate kinase/heptose 1- 99.25
cd01169242 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrim 99.24
PRK08176281 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpy 99.23
TIGR00687286 pyridox_kin pyridoxal kinase. ThiD and related pro 99.2
TIGR00097254 HMP-P_kinase phosphomethylpyrimidine kinase. This 99.19
PRK08573 448 phosphomethylpyrimidine kinase; Provisional 99.17
PRK06427266 bifunctional hydroxy-methylpyrimidine kinase/ hydr 99.17
PRK12412268 pyridoxal kinase; Reviewed 99.14
PTZ00344296 pyridoxal kinase; Provisional 99.06
PRK12616270 pyridoxal kinase; Reviewed 99.04
PLN02978308 pyridoxal kinase 98.94
PTZ00347504 phosphomethylpyrimidine kinase; Provisional 98.75
PF08543246 Phos_pyr_kin: Phosphomethylpyrimidine kinase; Inte 98.67
PRK14713 530 multifunctional hydroxymethylpyrimidine phosphokin 98.67
PLN02898 502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 98.63
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 98.61
COG0351263 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidi 98.59
cd01170242 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (T 98.55
COG2240281 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coe 98.4
COG2870 467 RfaE ADP-heptose synthase, bifunctional sugar kina 98.37
TIGR00694249 thiM hydroxyethylthiazole kinase. This model repre 98.11
KOG2599 308 consensus Pyridoxal/pyridoxine/pyridoxamine kinase 98.04
cd01171254 YXKO-related B.subtilis YXKO protein of unknown fu 98.02
TIGR00196272 yjeF_cterm yjeF C-terminal region, hydroxyethylthi 98.01
PRK09355263 hydroxyethylthiazole kinase; Validated 97.95
PTZ00493 321 phosphomethylpyrimidine kinase; Provisional 97.89
COG2145265 ThiM Hydroxyethylthiazole kinase, sugar kinase fam 97.27
PF02110246 HK: Hydroxyethylthiazole kinase family; InterPro: 97.22
KOG2598 523 consensus Phosphomethylpyrimidine kinase [Coenzyme 96.97
KOG2947308 consensus Carbohydrate kinase [Carbohydrate transp 96.69
PRK14038453 ADP-dependent glucokinase; Provisional 94.14
TIGR02045446 P_fruct_ADP ADP-specific phosphofructokinase. Phos 92.51
PRK10076213 pyruvate formate lyase II activase; Provisional 92.45
PRK14039 453 ADP-dependent glucokinase; Provisional 90.33
PRK10565508 putative carbohydrate kinase; Provisional 88.16
COG1180260 PflA Pyruvate-formate lyase-activating enzyme [Pos 87.68
KOG3974306 consensus Predicted sugar kinase [Carbohydrate tra 87.02
KOG3009614 consensus Predicted carbohydrate kinase, contains 86.23
PF04587 444 ADP_PFK_GK: ADP-specific Phosphofructokinase/Gluco 83.43
PRK03979463 ADP-specific phosphofructokinase; Provisional 80.18
>PLN02967 kinase Back     alignment and domain information 
Probab=99.90  E-value=2.2e-22  Score=159.63  Aligned_cols=148  Identities=28%  Similarity=0.477  Sum_probs=118.9

Q ss_pred             CcceEEEEEeeCCCceeeeeecCCccccccccccCChhhhhcCCc--------CchhhHHHHHHHHHHHHHcCCeEEEec
Q 040166            2 QGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASI--------LLKPRRSAHIAAMEMAKTSGCILSYDP   73 (156)
Q Consensus         2 ~~t~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~i~~~~l~~~~~--------~~~~~~~~~~~~~~~a~~~g~~i~~D~   73 (156)
                      .+|++++|.++++|+|+++ ++.++|+..+.+++++...+.++++        +.+...+++..+++.+++.|++|+||+
T Consensus       295 ~~Tgla~V~vd~~Gerr~~-~~~~gAd~~L~~~di~~~~l~~A~i~hfgg~~ll~e~~~~all~alk~Ak~~Gv~VsFDp  373 (581)
T PLN02967        295 RATAVSTMKIAKRGRLKTT-CVKPCAEDSLSKSEINIDVLKEAKMFYFNTHSLLDPTMRSTTLRAIKISKKLGGVIFYDL  373 (581)
T ss_pred             CCCcEEEEEECCCCceEEE-EecCChhhhCChhhcCHhHhcCCCEEEEeCchhcccchHHHHHHHHHHHHHCCCEEEEEC
Confidence            4799999999999998886 4335788888888888777777776        234456788899999999999999999


Q ss_pred             CCCCCCCCCHHHHHHHHHHhhhhCcEEecCHHHHhHhhCCCCCCc--------------hHHHHHHHHhCCCcEEEEeec
Q 040166           74 NARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASD--------------DNVVLEKLFHSNLKLLLVTEG  139 (156)
Q Consensus        74 ~~r~~~~~~~~~~~~~l~~~l~~~dil~~n~~E~~~l~g~~~~~~--------------~~~~~~~l~~~g~~~vvit~G  139 (156)
                      |+|+.+|.+.+.+.+.+.++++++|||++|++|+..|+|..+.++              ....+..++..|++.||||+|
T Consensus       374 NlR~~lw~~~e~~~e~i~elL~~aDILk~NeeEl~~LtG~~~~~e~~~~~~~~~~~~~~~~e~a~~l~~~g~k~VVVTlG  453 (581)
T PLN02967        374 NLPLPLWSSSEETKSFIQEAWNLADIIEVTKQELEFLCGIEPTEEFDTKDNDKSKFVHYSPEVVAPLWHENLKVLFVTNG  453 (581)
T ss_pred             CCCcccccchHHHHHHHHHHHHhCCEEEECHHHHHHHhCCCccccccccccchhccccchHHHHHHHHhCCCCEEEEEEC
Confidence            999999976666777889999999999999999999998542110              001235566679999999999


Q ss_pred             CCceEEEecCe
Q 040166          140 SNGCKYYTQEF  150 (156)
Q Consensus       140 ~~G~~~~~~~~  150 (156)
                      ++|+++++++.
T Consensus       454 ~~Ga~~~~~~~  464 (581)
T PLN02967        454 TSKIHYYTKEH  464 (581)
T ss_pred             ccceEEEECCC
Confidence            99999988653

>PLN02543 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02323 probable fructokinase Back     alignment and domain information
>PRK15074 inosine/guanosine kinase; Provisional Back     alignment and domain information
>PRK09434 aminoimidazole riboside kinase; Provisional Back     alignment and domain information
>cd01166 KdgK 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP) Back     alignment and domain information
>cd01167 bac_FRK Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate Back     alignment and domain information
>cd01168 adenosine_kinase Adenosine kinase (AK) catalyzes the phosphorylation of ribofuranosyl-containing nucleoside analogues at the 5'-hydroxyl using ATP or GTP as the phosphate donor Back     alignment and domain information
>COG0524 RbsK Sugar kinases, ribokinase family [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02341 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PTZ00292 ribokinase; Provisional Back     alignment and domain information
>PLN02379 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PLN02813 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>PTZ00247 adenosine kinase; Provisional Back     alignment and domain information
>PRK11142 ribokinase; Provisional Back     alignment and domain information
>cd01944 YegV_kinase_like YegV-like sugar kinase Back     alignment and domain information
>cd01174 ribokinase Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP Back     alignment and domain information
>TIGR02152 D_ribokin_bact ribokinase Back     alignment and domain information
>cd01943 MAK32 MAK32 kinase Back     alignment and domain information
>KOG2855 consensus Ribokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01942 ribokinase_group_A Ribokinase-like subgroup A Back     alignment and domain information
>PF00294 PfkB: pfkB family carbohydrate kinase; InterPro: IPR011611 This entry includes a variety of carbohydrate and pyrimidine kinases Back     alignment and domain information
>cd01945 ribokinase_group_B Ribokinase-like subgroup B Back     alignment and domain information
>PLN02548 adenosine kinase Back     alignment and domain information
>PRK09850 pseudouridine kinase; Provisional Back     alignment and domain information
>cd01940 Fructoselysine_kinase_like Fructoselysine kinase-like Back     alignment and domain information
>cd01939 Ketohexokinase Ketohexokinase (fructokinase, KHK) catalyzes the phosphorylation of fructose to fructose-1-phosphate (F1P), the first step in the metabolism of dietary fructose Back     alignment and domain information
>PLN02630 pfkB-type carbohydrate kinase family protein Back     alignment and domain information
>cd01941 YeiC_kinase_like YeiC-like sugar kinase Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>cd01947 Guanosine_kinase_like Guanosine kinase-like sugar kinases Back     alignment and domain information
>TIGR01231 lacC tagatose-6-phosphate kinase Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK10294 6-phosphofructokinase 2; Provisional Back     alignment and domain information
>TIGR03168 1-PFK hexose kinase, 1-phosphofructokinase family Back     alignment and domain information
>TIGR03828 pfkB 1-phosphofructokinase Back     alignment and domain information
>PRK09813 fructoselysine 6-kinase; Provisional Back     alignment and domain information
>cd00287 ribokinase_pfkB_like ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group Back     alignment and domain information
>PRK09513 fruK 1-phosphofructokinase; Provisional Back     alignment and domain information
>cd01172 RfaE_like RfaE encodes a bifunctional ADP-heptose synthase involved in the biosynthesis of the lipopolysaccharide (LPS) core precursor ADP-L-glycero-D-manno-heptose Back     alignment and domain information
>cd01164 FruK_PfkB_like 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases Back     alignment and domain information
>cd01937 ribokinase_group_D Ribokinase-like subgroup D Back     alignment and domain information
>cd01946 ribokinase_group_C Ribokinase-like subgroup C Back     alignment and domain information
>TIGR02198 rfaE_dom_I rfaE bifunctional protein, domain I Back     alignment and domain information
>cd01173 pyridoxal_pyridoxamine_kinase Pyridoxal kinase plays a key role in the synthesis of the active coenzyme pyridoxal-5'-phosphate (PLP), by catalyzing the phosphorylation of the precursor vitamin B6 in the presence of Zn2+ and ATP Back     alignment and domain information
>KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12413 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK07105 pyridoxamine kinase; Validated Back     alignment and domain information
>COG1105 FruK Fructose-1-phosphate kinase and related fructose-6-phosphate kinase (PfkB) [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05756 pyridoxamine kinase; Validated Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>cd01169 HMPP_kinase 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1 Back     alignment and domain information
>PRK08176 pdxK pyridoxal-pyridoxamine kinase/hydroxymethylpyrimidine kinase; Reviewed Back     alignment and domain information
>TIGR00687 pyridox_kin pyridoxal kinase Back     alignment and domain information
>TIGR00097 HMP-P_kinase phosphomethylpyrimidine kinase Back     alignment and domain information
>PRK08573 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PRK06427 bifunctional hydroxy-methylpyrimidine kinase/ hydroxy-phosphomethylpyrimidine kinase; Reviewed Back     alignment and domain information
>PRK12412 pyridoxal kinase; Reviewed Back     alignment and domain information
>PTZ00344 pyridoxal kinase; Provisional Back     alignment and domain information
>PRK12616 pyridoxal kinase; Reviewed Back     alignment and domain information
>PLN02978 pyridoxal kinase Back     alignment and domain information
>PTZ00347 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>PF08543 Phos_pyr_kin: Phosphomethylpyrimidine kinase; InterPro: IPR013749 This enzyme 2 Back     alignment and domain information
>PRK14713 multifunctional hydroxymethylpyrimidine phosphokinase/4-amino-5-aminomethyl-2-methylpyrimidine hydrolase; Provisional Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>COG0351 ThiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [Coenzyme metabolism] Back     alignment and domain information
>cd01170 THZ_kinase 4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz Back     alignment and domain information
>COG2240 PdxK Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme metabolism] Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00694 thiM hydroxyethylthiazole kinase Back     alignment and domain information
>KOG2599 consensus Pyridoxal/pyridoxine/pyridoxamine kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01171 YXKO-related B Back     alignment and domain information
>TIGR00196 yjeF_cterm yjeF C-terminal region, hydroxyethylthiazole kinase-related Back     alignment and domain information
>PRK09355 hydroxyethylthiazole kinase; Validated Back     alignment and domain information
>PTZ00493 phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>COG2145 ThiM Hydroxyethylthiazole kinase, sugar kinase family [Coenzyme metabolism] Back     alignment and domain information
>PF02110 HK: Hydroxyethylthiazole kinase family; InterPro: IPR000417 Thiamine pyrophosphate (TPP), a required cofactor for many enzymes in the cell, is synthesised de novo in Salmonella typhimurium [] Back     alignment and domain information
>KOG2598 consensus Phosphomethylpyrimidine kinase [Coenzyme transport and metabolism; Transcription] Back     alignment and domain information
>KOG2947 consensus Carbohydrate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14038 ADP-dependent glucokinase; Provisional Back     alignment and domain information
>TIGR02045 P_fruct_ADP ADP-specific phosphofructokinase Back     alignment and domain information
>PRK10076 pyruvate formate lyase II activase; Provisional Back     alignment and domain information
>PRK14039 ADP-dependent glucokinase; Provisional Back     alignment and domain information
>PRK10565 putative carbohydrate kinase; Provisional Back     alignment and domain information
>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3974 consensus Predicted sugar kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3009 consensus Predicted carbohydrate kinase, contains PfkB domain [General function prediction only] Back     alignment and domain information
>PF04587 ADP_PFK_GK: ADP-specific Phosphofructokinase/Glucokinase conserved region; InterPro: IPR007666 Although ATP is the most common phosphoryl group donor for kinases, certain hyperthermophilic archaea, such as Thermococcus litoralis and Pyrococcus furiosus, utilise unusual ADP-dependent glucokinases (ADPGKs) and phosphofructokinases (ADPPKKs) in their glycolytic pathways [, , ] Back     alignment and domain information
>PRK03979 ADP-specific phosphofructokinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3ljs_A338 Crystal Structure Of Fructokinase From Xylella Fast 9e-14
2qcv_A332 Crystal Structure Of A Putative 5-Dehydro-2-Deoxygl 1e-05
3hj6_A327 Structure Of Halothermothrix Orenii Fructokinase (F 5e-05
3iq0_A330 Crystal Structure Of A Putative Ribokinase Ii In Co 4e-04
>pdb|3LJS|A Chain A, Crystal Structure Of Fructokinase From Xylella Fastidiosa Length = 338 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 75/155 (48%), Gaps = 9/155 (5%)
Query: 8   FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILLKPRRS---AHIAAMEM--- 61
           FV L A GER F F+R P+A++L             A I      S   A IA +     
Sbjct: 94  FVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSXTDADIAEVTFEGX 153
Query: 62  --AKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
             A+ +G I+S+D N R   WP+ E     +      AD++K+S EEL  L     A+D 
Sbjct: 154 RRAQAAGAIVSFDLNFRPXLWPNGENPASRLWKGLSLADVVKLSSEELDYLANTL-AADA 212
Query: 120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHV 154
           N V+++L+    +LLLVT+ +    +YT+   G V
Sbjct: 213 NAVIQQLWQGRAQLLLVTDAAGPVHWYTRTAGGEV 247
>pdb|2QCV|A Chain A, Crystal Structure Of A Putative 5-Dehydro-2-Deoxygluconokinase (Iolc) From Bacillus Halodurans C-125 At 1.90 A Resolution Length = 332 Back     alignment and structure
>pdb|3HJ6|A Chain A, Structure Of Halothermothrix Orenii Fructokinase (Frk) Length = 327 Back     alignment and structure
>pdb|3IQ0|A Chain A, Crystal Structure Of A Putative Ribokinase Ii In Complex With Atp And Mg+2 From E.Coli Length = 330 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 9e-51
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 5e-47
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 2e-45
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 5e-45
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 5e-44
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 2e-43
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 6e-42
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 2e-39
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 8e-39
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 2e-36
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 4e-36
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 2e-35
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 9e-35
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 1e-31
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 2e-29
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 3e-16
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 2e-15
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 6e-09
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 6e-09
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 1e-08
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 1e-05
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 2e-05
3bf5_A306 Ribokinase related protein; 10640157, putative rib 2e-05
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 7e-05
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 2e-04
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} PDB: 3lki_A* Length = 338 Back     alignment and structure
 Score =  164 bits (417), Expect = 9e-51
 Identities = 48/157 (30%), Positives = 72/157 (45%), Gaps = 9/157 (5%)

Query: 8   FVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASILL--------KPRRSAHIAAM 59
           FV L A GER F F+R P+A++L             A I                    M
Sbjct: 94  FVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSMTDADIAEVTFEGM 153

Query: 60  EMAKTSGCILSYDPNARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDD 119
             A+ +G I+S+D N R + WP+ E     +      AD++K+S EEL  L     A+D 
Sbjct: 154 RRAQAAGAIVSFDLNFRPMLWPNGENPASRLWKGLSLADVVKLSSEELDYL-ANTLAADA 212

Query: 120 NVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGHVGG 156
           N V+++L+    +LLLVT+ +    +YT+   G V  
Sbjct: 213 NAVIQQLWQGRAQLLLVTDAAGPVHWYTRTAGGEVPT 249
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Length = 332 Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Length = 339 Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} PDB: 3k9e_A Length = 330 Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} Length = 319 Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Length = 327 Back     alignment and structure
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Length = 336 Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Length = 319 Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Length = 328 Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Length = 296 Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Length = 313 Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Length = 313 Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Length = 309 Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Length = 311 Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Length = 325 Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Length = 351 Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Length = 346 Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Length = 302 Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Length = 313 Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Length = 312 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Length = 298 Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Length = 334 Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Length = 306 Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Length = 326 Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Length = 311 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
3ljs_A338 Fructokinase; fructokianse, PSI2, NYSGXRC, structu 99.92
4du5_A336 PFKB; structural genomics, PSI-biology, NEW YORK s 99.91
4e69_A328 2-dehydro-3-deoxygluconokinase; putative sugar kin 99.9
3pl2_A319 Sugar kinase, ribokinase family; PFKB PFAM motif, 99.9
3iq0_A330 Putative ribokinase II; transferase,kinase,SAD,rib 99.89
3lhx_A319 Ketodeoxygluconokinase; structural genomics, PSI-2 99.89
2qcv_A332 Putative 5-dehydro-2-deoxygluconokinase; structura 99.89
1tyy_A339 Putative sugar kinase; ribokinase fold, alpha/beta 99.88
3hj6_A327 Fructokinase, FRK; fructose, transferase, carbohyd 99.88
3ktn_A346 Carbohydrate kinase, PFKB family; PFKB family,ribo 99.87
2v78_A313 Fructokinase; transferase, PFKB family carbohydrat 99.87
1v1a_A309 2-keto-3-deoxygluconate kinase; ATP, structural ge 99.86
3h49_A325 Ribokinase; transferase,PFKB family,sugar kinase Y 99.85
2dcn_A311 Hypothetical fructokinase; 2-keto-3-deoxygluconate 99.85
4e3a_A352 Sugar kinase protein; structural genomics, protein 99.84
2rbc_A343 Sugar kinase, AGR_C_4560P; ribokinase family, ATP- 99.81
2qhp_A296 Fructokinase; NP_810670.1, PFKB family carbohydrat 99.81
3ry7_A304 Ribokinase; transferase; 2.15A {Staphylococcus aur 99.81
1rkd_A309 Ribokinase; carbohydrate kinase, ribose, nucleotid 99.81
3otx_A347 Adenosine kinase, putative; AP5A, transferase-tran 99.8
3vas_A370 Putative adenosine kinase; ribokinase, enzyme, tra 99.8
3loo_A365 Anopheles gambiae adenosine kinase; AP4A, P4-DI(ad 99.8
2fv7_A331 Ribokinase; structural genomics, structural genomi 99.8
2afb_A351 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro- 99.8
1vm7_A311 Ribokinase; TM0960, structural genomics, JCSG, pro 99.78
3ewm_A313 Uncharacterized sugar kinase PH1459; carbohydrate 99.78
3b1n_A326 Ribokinase, putative; rossmann fold, ATP binding, 99.77
2c4e_A302 Sugar kinase MJ0406; transferase, nucleoside kinas 99.77
2pkf_A334 Adenosine kinase; transferase, S genomics, TB stru 99.77
2nwh_A317 AGR_C_3442P, carbohydrate kinase; structural genom 99.76
1bx4_A345 Protein (adenosine kinase); human adenosine kinase 99.76
3kzh_A328 Probable sugar kinase; NYSGXRC, PSI-II, protein st 99.75
3go6_A310 Ribokinase RBSK; phosphofructokinase, carbohydrate 99.74
4gm6_A351 PFKB family carbohydrate kinase; enzyme function i 99.73
3ikh_A299 Carbohydrate kinase; transferase,kinase,SAD,ribose 99.72
3uq6_A372 Adenosine kinase, putative; ribokinase, transferas 99.72
2abs_A383 Adenosine kinase, AK; ribokinase fold, alpha/beta, 99.7
2hlz_A312 Ketohexokinase; non-protein kinase, creatine kinas 99.64
4e84_A352 D-beta-D-heptose 7-phosphate kinase; LPS-heptose b 99.63
2jg1_A330 Tagatose-6-phosphate kinase; phosphoryl transfer, 99.62
3umo_A309 6-phosphofructokinase isozyme 2; glycolysis, trans 99.61
2abq_A306 Fructose 1-phosphate kinase; dimer, structural gen 99.6
1vk4_A298 PFKB carbohydrate kinase TM0415; structural genomi 99.6
2f02_A323 Tagatose-6-phosphate kinase; LACC, structural geno 99.6
3ie7_A320 LIN2199 protein; phosphofructokinases, transferase 99.6
3cqd_A309 6-phosphofructokinase isozyme 2; phosphofructokina 99.57
2ajr_A331 Sugar kinase, PFKB family; TM0828, possible 1-phos 99.57
3kd6_A313 Carbohydrate kinase, PFKB family; nucleoside kinas 99.53
2jg5_A306 Fructose 1-phosphate kinase; 1-phosphofructokinase 99.52
3bf5_A306 Ribokinase related protein; 10640157, putative rib 99.5
2ddm_A283 Pyridoxine kinase; pyridoxal kinase, ribokinase, p 99.47
3mbh_A291 Putative phosphomethylpyrimidine kinase; structura 99.43
1jxh_A288 Phosphomethylpyrimidine kinase; THID, ribokinase f 99.43
1ub0_A258 THID, phosphomethylpyrimidine kinase; thiamin bios 99.41
2i5b_A271 Phosphomethylpyrimidine kinase; ADP complex, PDXK, 99.37
3h74_A282 Pyridoxal kinase; PSI-II, structural genomics, pro 99.36
2yxt_A 312 Pyridoxal kinase; beta sheet with alpha helix, met 99.33
3zs7_A300 Pyridoxal kinase; transferase, sleeping sickness; 99.33
3pzs_A289 PM kinase, pyridoxamine kinase; structural genomic 99.27
1ekq_A272 Hydroxyethylthiazole kinase; alpha-beta, transfera 98.89
3rm5_A 550 Hydroxymethylpyrimidine/phosphomethylpyrimidine K 98.89
1v8a_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 98.39
3dzv_A273 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_ 97.78
3hpd_A265 Hydroxyethylthiazole kinase; alpha-beta, ATP bindi 97.42
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 97.03
3bgk_A311 SMU.573, putative uncharacterized protein; alpha/b 96.7
2r3b_A310 YJEF-related protein; putative kinase in the ribok 96.68
3drw_A 474 ADP-specific phosphofructokinase; AMP, GLYC kinase 95.04
3rss_A502 Putative uncharacterized protein; unknown function 94.36
3rpz_A279 ADP/ATP-dependent NAD(P)H-hydrate dehydratase; str 93.17
1ua4_A 455 Glucokinase, ADP-dependent glucokinase; transferas 90.55
1l2l_A 457 ADP-dependent glucokinase; ADP glucokinase APO, tr 81.21
>3ljs_A Fructokinase; fructokianse, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.97A {Xylella fastidiosa TEMECULA1} SCOP: c.72.1.0 PDB: 3lki_A* Back     alignment and structure
Probab=99.92  E-value=1.5e-24  Score=162.88  Aligned_cols=154  Identities=30%  Similarity=0.471  Sum_probs=129.9

Q ss_pred             CcceEEEEEeeCCCceeeeeecCCccccccccccCChhhhhcCCc--------CchhhHHHHHHHHHHHHHcCCeEEEec
Q 040166            2 QGLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASI--------LLKPRRSAHIAAMEMAKTSGCILSYDP   73 (156)
Q Consensus         2 ~~t~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~i~~~~l~~~~~--------~~~~~~~~~~~~~~~a~~~g~~i~~D~   73 (156)
                      .+|+++++.++++|+|++.+++.++++..+++++++...+..+++        ..+...+.+..+++.+++.|++++|||
T Consensus        88 ~~T~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~a~~~g~~v~~Dp  167 (338)
T 3ljs_A           88 AKTALAFVALDAHGERSFSFYRPPAADLLFRVEHFQDASFSDALIFHACSNSMTDADIAEVTFEGMRRAQAAGAIVSFDL  167 (338)
T ss_dssp             SCCCEEEEECCSTTCCEEEEECSSCGGGGCCGGGCCHHHHHTEEEEEEEGGGGSSHHHHHHHHHHHHHHHHTTCEEEEEC
T ss_pred             CCceEEEEEECCCCCeEEEEeCCCChhHhCCHhhcCHhHhcCCCEEEECChHhcCchHHHHHHHHHHHHHHcCCEEEEEC
Confidence            479999999998899999888877788888999998767777765        234567888999999999999999999


Q ss_pred             CCCCCCCCCHHHHHHHHHHhhhhCcEEecCHHHHhHhhCCCCCCchHHHHHHHHhCCCcEEEEeecCCceEEEecCeeeE
Q 040166           74 NARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGH  153 (156)
Q Consensus        74 ~~r~~~~~~~~~~~~~l~~~l~~~dil~~n~~E~~~l~g~~~~~~~~~~~~~l~~~g~~~vvit~G~~G~~~~~~~~~~~  153 (156)
                      ++|+.+|.+.+..++.+.++++++|++++|++|+..|+|..+.++. .++++|++.|++.||||+|++|++++++++.++
T Consensus       168 ~~~~~~~~~~~~~~~~~~~ll~~~dil~~N~~E~~~l~g~~~~~~~-~~~~~l~~~g~~~vvvT~G~~G~~~~~~~~~~~  246 (338)
T 3ljs_A          168 NFRPMLWPNGENPASRLWKGLSLADVVKLSSEELDYLANTLAADAN-AVIQQLWQGRAQLLLVTDAAGPVHWYTRTAGGE  246 (338)
T ss_dssp             CCCGGGSCTTCCTHHHHHHHHHTCSEEEEEHHHHHHHHHHHTSCHH-HHHHHHTTTTCCEEEEEETTEEEEEEESSCEEE
T ss_pred             CCChhhcCCHHHHHHHHHHHHhhCCEEEecHHHHHHHhCCCChhHH-HHHHHHHhcCCCEEEEeeCCCceEEEECCceEE
Confidence            9999999755556678899999999999999999999997666551 124788888999999999999999999888777


Q ss_pred             eCC
Q 040166          154 VGG  156 (156)
Q Consensus       154 ~p~  156 (156)
                      +|+
T Consensus       247 ~~~  249 (338)
T 3ljs_A          247 VPT  249 (338)
T ss_dssp             ECC
T ss_pred             eCC
Confidence            774
>4du5_A PFKB; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.70A {Polaromonas SP} Back     alignment and structure
>4e69_A 2-dehydro-3-deoxygluconokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Oceanicola granulosus} PDB: 4ebu_A* 4eum_A* Back     alignment and structure
>3pl2_A Sugar kinase, ribokinase family; PFKB PFAM motif, inositol phosphate metabolism, ribokinase-L structural genomics; HET: MSE CIT; 1.89A {Corynebacterium glutamicum} SCOP: c.72.1.0 Back     alignment and structure
>3iq0_A Putative ribokinase II; transferase,kinase,SAD,ribose, D-ribose metabolic process, PFKB family,11206G, PSI-II, NYSGXRC, structural genomics; HET: ATP; 1.79A {Escherichia coli O6} SCOP: c.72.1.0 PDB: 3k9e_A Back     alignment and structure
>3lhx_A Ketodeoxygluconokinase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.87A {Shigella flexneri} Back     alignment and structure
>2qcv_A Putative 5-dehydro-2-deoxygluconokinase; structural genomic center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.90A {Bacillus halodurans c-125} Back     alignment and structure
>1tyy_A Putative sugar kinase; ribokinase fold, alpha/beta, transferase; 2.60A {Salmonella typhimurium LT2} SCOP: c.72.1.1 PDB: 1tz3_A* 1tz6_A* Back     alignment and structure
>3hj6_A Fructokinase, FRK; fructose, transferase, carbohydrate ME; 2.80A {Halothermothrix orenii} Back     alignment and structure
>3ktn_A Carbohydrate kinase, PFKB family; PFKB family,ribokianse,2-keto-3-deoxygluconate kinase,PSI-II, NYSGXRC,, structural genomics; 2.26A {Enterococcus faecalis} Back     alignment and structure
>2v78_A Fructokinase; transferase, PFKB family carbohydrate kinase, 2- keto-3-deoxygluconate kinase; 2.00A {Sulfolobus solfataricus} PDB: 2var_A* Back     alignment and structure
>1v1a_A 2-keto-3-deoxygluconate kinase; ATP, structural genomics, transferase, riken structural genomics/proteomics initiative, RSGI; HET: KDG ADP; 2.1A {Thermus thermophilus} SCOP: c.72.1.1 PDB: 1v19_A* 1v1b_A* 1v1s_A Back     alignment and structure
>3h49_A Ribokinase; transferase,PFKB family,sugar kinase YDJH, NYSGXRC,11206A,PSI2,, structural genomics, protein structure initiative; 1.80A {Escherichia coli k-12} PDB: 3in1_A* Back     alignment and structure
>2dcn_A Hypothetical fructokinase; 2-keto-3-deoxygluconate kinase, 2-keto- gluconate, transferase; HET: CKP ADP; 2.25A {Sulfolobus tokodaii} SCOP: c.72.1.1 PDB: 1wye_A* Back     alignment and structure
>4e3a_A Sugar kinase protein; structural genomics, protein structure initiative, nysgrc, S kinase, PSI-biology; HET: ADN; 1.63A {Rhizobium etli} PDB: 3ubo_A* Back     alignment and structure
>2rbc_A Sugar kinase, AGR_C_4560P; ribokinase family, ATP-binding site, structura genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qhp_A Fructokinase; NP_810670.1, PFKB family carbohydrate kinase, structural genomics, joint center for structural genomics; HET: MSE; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3ry7_A Ribokinase; transferase; 2.15A {Staphylococcus aureus} Back     alignment and structure
>1rkd_A Ribokinase; carbohydrate kinase, ribose, nucleotide binding, transferase; HET: RIB ADP; 1.84A {Escherichia coli} SCOP: c.72.1.1 PDB: 1gqt_A* 1rka_A 1rk2_A* 1rks_A* Back     alignment and structure
>3otx_A Adenosine kinase, putative; AP5A, transferase-transferase inhibitor CO; HET: AP5; 1.55A {Trypanosoma brucei} PDB: 2xtb_A* Back     alignment and structure
>3vas_A Putative adenosine kinase; ribokinase, enzyme, transferase; HET: ADN; 2.26A {Schistosoma mansoni} PDB: 4dc3_A* 3vaq_A* 3uq6_A* 3uq9_A* Back     alignment and structure
>3loo_A Anopheles gambiae adenosine kinase; AP4A, P4-DI(adenosi tetraphosphate, transferase; HET: B4P; 2.00A {Anopheles gambiae} Back     alignment and structure
>2fv7_A Ribokinase; structural genomics, structural genomics consort transferase; HET: ADP; 2.10A {Homo sapiens} SCOP: c.72.1.1 Back     alignment and structure
>2afb_A 2-keto-3-deoxygluconate kinase; TM0067, 2-dehydro-3- deoxygluconokinase, PFKB family carbohy kinase, structural genomics; 2.05A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>1vm7_A Ribokinase; TM0960, structural genomics, JCSG, protein struc initiative, PSI, joint center for structural genomics, TRAN; 2.15A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3ewm_A Uncharacterized sugar kinase PH1459; carbohydrate kinase, PFKB family, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 1.90A {Pyrococcus horikoshii} PDB: 3ih0_A* 3gbu_A* Back     alignment and structure
>3b1n_A Ribokinase, putative; rossmann fold, ATP binding, Mg binding, nucleoside B transferase; HET: MZR ADP; 1.55A {Burkholderia thailandensis} PDB: 3b1o_A 3b1p_A* 3b1q_A* 3b1r_A* Back     alignment and structure
>2c4e_A Sugar kinase MJ0406; transferase, nucleoside kinase, hyperthermophIle, ribokinase ribokinase fold; 1.70A {Methanococcus jannaschii} PDB: 2c49_A Back     alignment and structure
>2pkf_A Adenosine kinase; transferase, S genomics, TB structural genomics consortium, TBSGC; 1.50A {Mycobacterium tuberculosis} PDB: 2pkk_A* 2pkm_A* 2pkn_A* Back     alignment and structure
>2nwh_A AGR_C_3442P, carbohydrate kinase; structural genomics, APC6199, PSI-2, PR structure initiative 2; 1.86A {Agrobacterium tumefaciens str} Back     alignment and structure
>1bx4_A Protein (adenosine kinase); human adenosine kinase, transferase; HET: ADN; 1.50A {Homo sapiens} SCOP: c.72.1.1 PDB: 2i6a_A* 2i6b_A* Back     alignment and structure
>3kzh_A Probable sugar kinase; NYSGXRC, PSI-II, protein structure initiative, modified lysin, structural genomics; HET: BGC; 2.45A {Clostridium perfringens} Back     alignment and structure
>3go6_A Ribokinase RBSK; phosphofructokinase, carbohydrate kinase, transferase; HET: RIB ADP; 1.98A {Mycobacterium tuberculosis} PDB: 3go7_A* Back     alignment and structure
>4gm6_A PFKB family carbohydrate kinase; enzyme function initiative, transferase; 2.00A {Listeria grayi dsm 20601} Back     alignment and structure
>3ikh_A Carbohydrate kinase; transferase,kinase,SAD,ribose,D-ribose metabolic process,ATP ribokinase, PFKB family,11206L1,PSI-II,nysgxrc; HET: ATP; 1.88A {Klebsiella pneumoniae subsp} PDB: 3i3y_A* Back     alignment and structure
>3uq6_A Adenosine kinase, putative; ribokinase, transferase; HET: ADN AMP; 2.30A {Schistosoma mansoni} PDB: 3uq9_A* Back     alignment and structure
>2abs_A Adenosine kinase, AK; ribokinase fold, alpha/beta, intermediate conformation, signaling protein,transferase; HET: ACP; 1.10A {Toxoplasma gondii} SCOP: c.72.1.1 PDB: 2a9z_A* 2aa0_A* 2ab8_A* 2a9y_A* 1dgm_A* 1lio_A 1lii_A* 1lij_A* 1lik_A* Back     alignment and structure
>2hlz_A Ketohexokinase; non-protein kinase, creatine kinase, fructokinase, isoform A, structural genomics, structural genomics consortium, SGC transferase; 1.85A {Homo sapiens} PDB: 2hqq_A 2hw1_A* 3nbv_A* 3nbw_A* 3nc2_A* 3nc9_A* 3nca_A* 3q92_A* 3qa2_A* 3qai_A* 3ro4_A* 3b3l_A Back     alignment and structure
>4e84_A D-beta-D-heptose 7-phosphate kinase; LPS-heptose biosynthesis, beta-clAsp dimerization region, PF carbohydrate kinase, phosphorylation; HET: MSE ANP M7B GMZ; 2.60A {Burkholderia cenocepacia} PDB: 4e8w_A* 4e8y_A* 4e8z_A* Back     alignment and structure
>2jg1_A Tagatose-6-phosphate kinase; phosphoryl transfer, conformational changes, transferase, lactose metabolism; HET: MSE ANP TA6; 2.00A {Staphylococcus aureus} PDB: 2jgv_A* 2q5r_A* Back     alignment and structure
>3umo_A 6-phosphofructokinase isozyme 2; glycolysis, transferase, PFK, enzyme; HET: ATP; 1.70A {Escherichia coli} PDB: 3n1c_A* 3cqd_A* 3ump_A* 3uqd_A* 3uqe_A* Back     alignment and structure
>2abq_A Fructose 1-phosphate kinase; dimer, structural genomics, PSI, protein structure initiative; 2.10A {Bacillus halodurans} SCOP: c.72.1.1 Back     alignment and structure
>1vk4_A PFKB carbohydrate kinase TM0415; structural genomics, JCSG, protein structure initiative, joint center for structural G transferase; 1.91A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>2f02_A Tagatose-6-phosphate kinase; LACC, structural genomics, PSI, protein structure initiative YORK SGX research center for structural genomics; HET: ATP; 1.90A {Enterococcus faecalis} SCOP: c.72.1.1 PDB: 2awd_A* Back     alignment and structure
>3ie7_A LIN2199 protein; phosphofructokinases, transferase, glycero ION, PSI-II, NYSGXRC, kinase, structural genomics, structure initiative; HET: ATP; 1.60A {Listeria innocua} PDB: 3hic_A* 3jul_A* 3q1y_A Back     alignment and structure
>3cqd_A 6-phosphofructokinase isozyme 2; phosphofructokinases, PFK-2, glycolysis, transferase; HET: ATP; 1.98A {Escherichia coli} PDB: 3n1c_A* Back     alignment and structure
>2ajr_A Sugar kinase, PFKB family; TM0828, possible 1-phosphofructokinase (EC 2.7.1.56), struct genomics, joint center for structural genomics, JCSG; HET: MSE; 2.46A {Thermotoga maritima} SCOP: c.72.1.1 Back     alignment and structure
>3kd6_A Carbohydrate kinase, PFKB family; nucleoside kinase, AMP, PSI-II, NYSGXRC, struc genomics, protein structure initiative; HET: AMP; 1.88A {Chlorobaculum tepidum} Back     alignment and structure
>2jg5_A Fructose 1-phosphate kinase; 1-phosphofructokinase, transferase; 2.3A {Staphylococcus aureus} Back     alignment and structure
>3bf5_A Ribokinase related protein; 10640157, putative ribokinase, structural genomics, joint CE structural genomics, JCSG; HET: MSE; 1.91A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2ddm_A Pyridoxine kinase; pyridoxal kinase, ribokinase, pyridoxal 5'-phosphate, vitamin B6, phosphorylation, transferase; 2.10A {Escherichia coli} PDB: 2ddo_A* 2ddw_A* Back     alignment and structure
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A* Back     alignment and structure
>1jxh_A Phosphomethylpyrimidine kinase; THID, ribokinase family, phophorylation, transferase; 2.30A {Salmonella typhimurium} SCOP: c.72.1.2 PDB: 1jxi_A* Back     alignment and structure
>1ub0_A THID, phosphomethylpyrimidine kinase; thiamin biosynthesis, ribokinase family, phosphorylati structural genomics; 2.05A {Thermus thermophilus} SCOP: c.72.1.2 Back     alignment and structure
>2i5b_A Phosphomethylpyrimidine kinase; ADP complex, PDXK, THID, ribokinase superfamily, transferase; HET: ADP; 2.80A {Bacillus subtilis} Back     alignment and structure
>3h74_A Pyridoxal kinase; PSI-II, structural genomics, prote structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.30A {Lactobacillus plantarum} PDB: 3hyo_A* 3ibq_A* Back     alignment and structure
>2yxt_A Pyridoxal kinase; beta sheet with alpha helix, metal ION, transferase; 2.00A {Homo sapiens} PDB: 2yxu_A* 3kbi_A* 3keu_A* 4en4_A* 4eoh_A* 2f7k_A 3fhy_A* 3fhx_A* 2ajp_A* 1lhp_A 1lhr_A* 1rft_A* 1rfu_A* 1rfv_A* 1ygj_A* 1ygk_A* 1yhj_A* Back     alignment and structure
>3zs7_A Pyridoxal kinase; transferase, sleeping sickness; HET: ATP; 2.00A {Trypanosoma brucei} Back     alignment and structure
>3pzs_A PM kinase, pyridoxamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; HET: MSE; 1.89A {Yersinia pestis} SCOP: c.72.1.5 PDB: 1td2_A* 1vi9_A* Back     alignment and structure
>1ekq_A Hydroxyethylthiazole kinase; alpha-beta, transferase; 1.50A {Bacillus subtilis} SCOP: c.72.1.2 PDB: 1ekk_A 1c3q_A 1esj_A 1esq_A* Back     alignment and structure
>3rm5_A Hydroxymethylpyrimidine/phosphomethylpyrimidine K THI20; HMP kinase (THID), thiaminase II, transferase; 2.68A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8a_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, structural genomics, riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} PDB: 3hpd_A Back     alignment and structure
>3dzv_A 4-methyl-5-(beta-hydroxyethyl)thiazole kinase; NP_816404.1, structural genomics, joint center for structural genomics, JCSG; HET: ADP; 2.57A {Enterococcus faecalis} Back     alignment and structure
>3hpd_A Hydroxyethylthiazole kinase; alpha-beta, ATP binding, transferase, ATP-binding, M metal-binding, nucleotide-binding, thiamine biosynthesis; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>3bgk_A SMU.573, putative uncharacterized protein; alpha/beta three layer sandwich, unknown function; 2.50A {Streptococcus mutans} Back     alignment and structure
>2r3b_A YJEF-related protein; putative kinase in the ribokinase-like superfamily, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 1.80A {Enterococcus faecalis} PDB: 2r3e_A Back     alignment and structure
>3drw_A ADP-specific phosphofructokinase; AMP, GLYC kinase, magnesium, metal-binding, transferase, structural G PSI-2, protein structure initiative; HET: AMP; 1.90A {Pyrococcus horikoshii} PDB: 1u2x_A Back     alignment and structure
>3rss_A Putative uncharacterized protein; unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydrat lyase; HET: NAP; 1.95A {Thermotoga maritima} PDB: 3rrb_A* 2ax3_A* 3rre_A* 3rrj_A* 3rs8_A* 3rs9_A* 3rsf_A* 3rsg_A* 3rrf_A* 3rsq_A* 3rt7_A* 3rt9_A* 3rta_A* 3rtb_A* 3rtc_A* 3rtd_A* 3rte_A* 3rtg_A* 3ru2_A* 3ru3_A* Back     alignment and structure
>3rpz_A ADP/ATP-dependent NAD(P)H-hydrate dehydratase; structural genomics, PSI-biology; HET: AMP NPW; 1.51A {Bacillus subtilis} PDB: 3rph_A* 3rq2_A* 3rq5_A* 3rq6_A* 3rq8_A* 3rqh_A* 3rqq_A* 3rqx_A* 1kyh_A Back     alignment and structure
>1ua4_A Glucokinase, ADP-dependent glucokinase; transferase; HET: GLC BGC AMP; 1.90A {Pyrococcus furiosus} SCOP: c.72.1.3 Back     alignment and structure
>1l2l_A ADP-dependent glucokinase; ADP glucokinase APO, transferase; 2.00A {Pyrococcus horikoshii} SCOP: c.72.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1v19a_302 2-keto-3-deoxygluconate kinase {Thermus thermophil 99.61
d2afba1333 2-keto-3-deoxygluconate kinase {Thermotoga maritim 99.51
d1tyya_304 Aminoimidazole riboside kinase {Salmonella typhimu 99.45
d1bx4a_342 Adenosine kinase {Human (Homo sapiens) [TaxId: 960 99.41
d2f02a1313 Tagatose-6-phosphate kinase LacC {Enterococcus fae 99.33
d1vm7a_299 Ribokinase {Thermotoga maritima [TaxId: 2336]} 99.31
d2dcna1308 Hypothetical fructokinase ST2478 {Sulfolobus tokod 99.29
d2absa1350 Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} 99.28
d2ajra1319 Putative sugar kinase TM0828 {Thermotoga maritima 99.23
d2abqa1306 Fructose 1-phosphate kinase FruB {Bacillus halodur 99.16
d2fv7a1308 Ribokinase {Human (Homo sapiens) [TaxId: 9606]} 99.15
d1rkda_306 Ribokinase {Escherichia coli [TaxId: 562]} 99.08
d1vi9a_288 Pyridoxamine kinase {Escherichia coli [TaxId: 562] 98.87
d1lhpa_ 309 Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940] 98.65
d1ub0a_258 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 98.37
d1jxha_266 4-amino-5-hydroxymethyl-2-methylpyrimidine phospha 98.27
d1vk4a_288 Hypothetical protein TM0415 {Thermotoga maritima [ 98.27
d1ekqa_269 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ba 97.86
d1v8aa_264 Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Ar 97.68
d1kyha_275 Hypothetical protein YxkO {Bacillus subtilis [TaxI 83.06
d1l2la_ 451 ADP-dependent glucokinase {Archaeon Thermococcus l 81.3
>d1v19a_ c.72.1.1 (A:) 2-keto-3-deoxygluconate kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribokinase-like
superfamily: Ribokinase-like
family: Ribokinase-like
domain: 2-keto-3-deoxygluconate kinase
species: Thermus thermophilus [TaxId: 274]

Probab=99.61  E-value=7.1e-14  Score=100.76  Aligned_cols=145  Identities=24%  Similarity=0.289  Sum_probs=114.9

Q ss_pred             cceEEEEEeeCCCceeeeeecCCccccccccccCChhhhhcCCc---------CchhhHHHHHHHHHHHHHcCCeEEEec
Q 040166            3 GLHWLFVTLTAEGERGFMFFRNPSAEMLLCEAELDVNLIEKASI---------LLKPRRSAHIAAMEMAKTSGCILSYDP   73 (156)
Q Consensus         3 ~t~~~~v~~~~~g~r~~~~~~~~~a~~~l~~~~i~~~~l~~~~~---------~~~~~~~~~~~~~~~a~~~g~~i~~D~   73 (156)
                      +++.+.+.+.++|++++..+..+.....+..++.....++..++         +.+...+.+..+++..++.++.+.+|+
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~  164 (302)
T d1v19a_          85 FTGLYLREYLPLGQGRVFYYRKGSAGSALAPGAFDPDYLEGVRFLHLSGITPALSPEARAFSLWAMEEAKRRGVRVSLDV  164 (302)
T ss_dssp             CCCEEEEEECTTSCEEEEEECTTCSGGGCCTTSSCGGGGTTCSEEEEETHHHHHCHHHHHHHHHHHHHHHTTTCEEEEEC
T ss_pred             cccccchhhccccccccccccccccchhhccccccHHHHhcccEEeeeccccccchhHHHHHHHHHHHHHhcCCcccccc
Confidence            46677778888899998888766666667777776667776665         234445677888999999999999999


Q ss_pred             CCCCCCCCCHHHHHHHHHHhhhhCcEEecCHHHHhHhhCCCCCCchHHHHHHHHhCCCcEEEEeecCCceEEEecCeeeE
Q 040166           74 NARLLPWPSAEAARGGIISIWDEADMIKISEEELTLLIEGCDASDDNVVLEKLFHSNLKLLLVTEGSNGCKYYTQEFKGH  153 (156)
Q Consensus        74 ~~r~~~~~~~~~~~~~l~~~l~~~dil~~n~~E~~~l~g~~~~~~~~~~~~~l~~~g~~~vvit~G~~G~~~~~~~~~~~  153 (156)
                      +.++..+. .......+.++++++|++++|++|+....+...        +.+...+.+.||||+|++|++++++++.++
T Consensus       165 ~~~~~~~~-~~~~~~~~~~~~~~~d~~~~~~~e~~~~~~~~~--------~~~~~~~~~~viit~G~~G~~~~~~~~~~~  235 (302)
T d1v19a_         165 NYRQTLWS-PEEARGFLERALPGVDLLFLSEEEAELLFGRVE--------EALRALSAPEVVLKRGAKGAWAFVDGRRVE  235 (302)
T ss_dssp             CCCTTTCC-HHHHHHHHHHHGGGCSEEEEEHHHHHHHHSSTT--------HHHHHTCCSEEEEECTTSCEEEEETTEEEE
T ss_pred             chhhhccc-hhhhHHHHHhhhhhccchhhhhhhhhhhhhhhh--------hhhhhccceEEEEecCCCCCcccccccccc
Confidence            99887664 445566788889999999999999988876421        344557889999999999999999999998


Q ss_pred             eCC
Q 040166          154 VGG  156 (156)
Q Consensus       154 ~p~  156 (156)
                      +|+
T Consensus       236 ~p~  238 (302)
T d1v19a_         236 GSA  238 (302)
T ss_dssp             CCC
T ss_pred             ccc
Confidence            885
>d1tyya_ c.72.1.1 (A:) Aminoimidazole riboside kinase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f02a1 c.72.1.1 (A:1-313) Tagatose-6-phosphate kinase LacC {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vm7a_ c.72.1.1 (A:) Ribokinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dcna1 c.72.1.1 (A:2-309) Hypothetical fructokinase ST2478 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2absa1 c.72.1.1 (A:10-359) Adenosine kinase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2ajra1 c.72.1.1 (A:1-319) Putative sugar kinase TM0828 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2abqa1 c.72.1.1 (A:1-306) Fructose 1-phosphate kinase FruB {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fv7a1 c.72.1.1 (A:15-322) Ribokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkda_ c.72.1.1 (A:) Ribokinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi9a_ c.72.1.5 (A:) Pyridoxamine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lhpa_ c.72.1.5 (A:) Pyridoxal kinase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ub0a_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jxha_ c.72.1.2 (A:) 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate kinase (HMP-phosphate kinase, ThiD) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vk4a_ c.72.1.1 (A:) Hypothetical protein TM0415 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v8aa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyha_ c.72.1.4 (A:) Hypothetical protein YxkO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l2la_ c.72.1.3 (A:) ADP-dependent glucokinase {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure