Citrus Sinensis ID: 040376


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
cccccccEEEEEcccccccccEEEEEccccccccccEEEEEEEEEccHHHHHHHHccccccccccccccccccccEEEEEEEccccccccccEEEEEccc
ccccccEEEEEEEccccccHccEEEEccccccccccEEEEEEEEEEccHcHHHHcccccccccccccEEccccccEEEEEEcccccccccccEEEEEEcc
magkplmhavqynsygggaadlkhvelpvptpskdEVLLKLEAtalnpvdwkiqkgqlrpflprkfpcipgilvLPLIFCElesfnnfcpsrtyfdvyds
MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEAtalnpvdwkiQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
*********VQYNSYGGGAADLKHVELPV*****DEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVY**
****PLM*AVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
****PLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELESFNNFCPSRTYFDVYDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
Q9SV68 329 Putative quinone-oxidored yes no 0.87 0.264 0.681 2e-28
Q8H0M1 329 Quinone-oxidoreductase ho N/A no 0.7 0.212 0.704 5e-24
O97764 330 Zeta-crystallin OS=Bos ta yes no 0.82 0.248 0.329 4e-05
Q28452 330 Quinone oxidoreductase OS N/A no 0.72 0.218 0.333 6e-05
Q0MVN8 329 Quinone oxidoreductase OS yes no 0.91 0.276 0.288 9e-05
Q54II4 352 Reticulon-4-interacting p yes no 0.65 0.184 0.367 0.0004
>sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 68/88 (77%), Gaps = 1/88 (1%)

Query: 1  MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRP 60
          MAGK LMHA+QYNSYGGGAA L+HV++PVPTP  +EV LKLEAT+LNPVDWKIQKG +RP
Sbjct: 1  MAGK-LMHALQYNSYGGGAAGLEHVQVPVPTPKSNEVCLKLEATSLNPVDWKIQKGMIRP 59

Query: 61 FLPRKFPCIPGILVLPLIFCELESFNNF 88
          FLPRKFPCIP   V   +        NF
Sbjct: 60 FLPRKFPCIPATDVAGEVVEVGSGVKNF 87





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 Back     alignment and function description
>sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 Back     alignment and function description
>sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
312283475 329 unnamed protein product [Thellungiella h 0.7 0.212 0.802 5e-27
15235549 329 putative quinone-oxidoreductase-like pro 0.87 0.264 0.681 6e-27
297790792 329 oxidoreductase [Arabidopsis lyrata subsp 0.87 0.264 0.681 9e-27
224056699 332 predicted protein [Populus trichocarpa] 0.7 0.210 0.774 2e-26
224060149 335 predicted protein [Populus trichocarpa] 0.73 0.217 0.756 3e-25
356567800 329 PREDICTED: putative quinone-oxidoreducta 0.69 0.209 0.739 2e-24
118488767 329 unknown [Populus trichocarpa] 0.7 0.212 0.746 3e-24
224121506 329 predicted protein [Populus trichocarpa] 0.71 0.215 0.763 5e-24
255580501109 conserved hypothetical protein [Ricinus 0.69 0.633 0.771 1e-23
224060147 279 predicted protein [Populus trichocarpa] 0.66 0.236 0.772 2e-23
>gi|312283475|dbj|BAJ34603.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 57/71 (80%), Positives = 64/71 (90%), Gaps = 1/71 (1%)

Query: 1  MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRP 60
          MAGK LMHA+QY SYGGGAA LKHV++PVP+P  +EVLLKLEAT+LNPVDWKIQKG +RP
Sbjct: 1  MAGK-LMHALQYESYGGGAAALKHVQVPVPSPMSNEVLLKLEATSLNPVDWKIQKGMIRP 59

Query: 61 FLPRKFPCIPG 71
          FLPRKFPCIP 
Sbjct: 60 FLPRKFPCIPA 70




Source: Thellungiella halophila

Species: Eutrema halophilum

Genus: Eutrema

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|15235549|ref|NP_193037.1| putative quinone-oxidoreductase-like protein [Arabidopsis thaliana] gi|67460977|sp|Q9SV68.1|QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog, chloroplastic gi|15724256|gb|AAL06521.1|AF412068_1 AT4g13010/F25G13_100 [Arabidopsis thaliana] gi|5123942|emb|CAB45500.1| putative protein [Arabidopsis thaliana] gi|7268003|emb|CAB78343.1| putative protein [Arabidopsis thaliana] gi|15028001|gb|AAK76531.1| unknown protein [Arabidopsis thaliana] gi|15912237|gb|AAL08252.1| AT4g13010/F25G13_100 [Arabidopsis thaliana] gi|21436057|gb|AAM51229.1| unknown protein [Arabidopsis thaliana] gi|332657813|gb|AEE83213.1| putative quinone-oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297790792|ref|XP_002863281.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297309115|gb|EFH39540.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224056699|ref|XP_002298979.1| predicted protein [Populus trichocarpa] gi|222846237|gb|EEE83784.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224060149|ref|XP_002300061.1| predicted protein [Populus trichocarpa] gi|222847319|gb|EEE84866.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567800|ref|XP_003552103.1| PREDICTED: putative quinone-oxidoreductase homolog, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|118488767|gb|ABK96194.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224121506|ref|XP_002330717.1| predicted protein [Populus trichocarpa] gi|222872493|gb|EEF09624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255580501|ref|XP_002531075.1| conserved hypothetical protein [Ricinus communis] gi|223529321|gb|EEF31289.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224060147|ref|XP_002300060.1| predicted protein [Populus trichocarpa] gi|222847318|gb|EEE84865.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
TAIR|locus:2123206 329 AT4G13010 [Arabidopsis thalian 0.69 0.209 0.814 8.2e-28
TIGR_CMR|BA_3435 317 BA_3435 "alcohol dehydrogenase 0.64 0.201 0.338 4.9e-06
UNIPROTKB|Q28452 330 CRYZ "Quinone oxidoreductase" 0.74 0.224 0.355 1.5e-05
UNIPROTKB|O53146 328 qor "NADPH2:quinone reductase" 0.6 0.182 0.369 2.4e-05
UNIPROTKB|O97764 330 CRYZ "Zeta-crystallin" [Bos ta 0.82 0.248 0.329 3.1e-05
TIGR_CMR|BA_3566 332 BA_3566 "alcohol dehydrogenase 0.63 0.189 0.323 3.1e-05
UNIPROTKB|G4NG94 356 MGG_12228 "Uncharacterized pro 0.38 0.106 0.552 3.5e-05
UNIPROTKB|Q0MVN8 329 CRYZ "Quinone oxidoreductase" 0.91 0.276 0.288 4e-05
UNIPROTKB|Q19QT8 330 CRYZ "Uncharacterized protein" 0.91 0.275 0.288 4e-05
DICTYBASE|DDB_G0288729 352 DDB_G0288729 "zinc-containing 0.65 0.184 0.367 4.5e-05
TAIR|locus:2123206 AT4G13010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
 Identities = 57/70 (81%), Positives = 64/70 (91%)

Query:     1 MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRP 60
             MAGK LMHA+QYNSYGGGAA L+HV++PVPTP  +EV LKLEAT+LNPVDWKIQKG +RP
Sbjct:     1 MAGK-LMHALQYNSYGGGAAGLEHVQVPVPTPKSNEVCLKLEATSLNPVDWKIQKGMIRP 59

Query:    61 FLPRKFPCIP 70
             FLPRKFPCIP
Sbjct:    60 FLPRKFPCIP 69




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005794 "Golgi apparatus" evidence=RCA
TIGR_CMR|BA_3435 BA_3435 "alcohol dehydrogenase, zinc-containing" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q28452 CRYZ "Quinone oxidoreductase" [Lama guanicoe (taxid:9840)] Back     alignment and assigned GO terms
UNIPROTKB|O53146 qor "NADPH2:quinone reductase" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms
UNIPROTKB|O97764 CRYZ "Zeta-crystallin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3566 BA_3566 "alcohol dehydrogenase, zinc-containing" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|G4NG94 MGG_12228 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|Q0MVN8 CRYZ "Quinone oxidoreductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q19QT8 CRYZ "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288729 DDB_G0288729 "zinc-containing alcohol dehydrogenase (ADH)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
cd08267 319 cd08267, MDR1, Medium chain dehydrogenases/reducta 3e-21
cd05289 309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 1e-20
COG0604 326 COG0604, Qor, NADPH:quinone reductase and related 1e-15
cd08253 325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 2e-13
cd08272 326 cd08272, MDR6, Medium chain dehydrogenases/reducta 1e-11
cd08249 339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 2e-11
cd08266 342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 8e-11
cd08271 325 cd08271, MDR5, Medium chain dehydrogenases/reducta 9e-11
cd08252 336 cd08252, AL_MDR, Arginate lyase and other MDR fami 2e-08
cd08248 350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 5e-08
cd08244 324 cd08244, MDR_enoyl_red, Possible enoyl reductase 1e-07
cd08291 324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 2e-07
cd05286 320 cd05286, QOR2, Quinone oxidoreductase (QOR) 2e-07
cd08268 328 cd08268, MDR2, Medium chain dehydrogenases/reducta 3e-07
cd05284 340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 5e-07
cd08276 336 cd08276, MDR7, Medium chain dehydrogenases/reducta 5e-07
COG1064 339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 1e-06
cd08260 345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 4e-06
cd05282 323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 5e-06
cd05276 323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 5e-06
cd05188 271 cd05188, MDR, Medium chain reductase/dehydrogenase 9e-06
cd08274 350 cd08274, MDR9, Medium chain dehydrogenases/reducta 5e-05
cd08247 352 cd08247, AST1_like, AST1 is a cytoplasmic protein 2e-04
cd08243 320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 2e-04
TIGR02817 336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 2e-04
cd08297 341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 2e-04
PTZ00354 334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 3e-04
cd08236 343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 3e-04
cd08298 329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 3e-04
cd08264 325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 4e-04
cd08241 323 cd08241, QOR1, Quinone oxidoreductase (QOR) 5e-04
cd08254 338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 7e-04
cd08259 332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 7e-04
cd08240 350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 8e-04
TIGR02824 325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 0.002
PRK13771 334 PRK13771, PRK13771, putative alcohol dehydrogenase 0.002
cd08234 334 cd08234, threonine_DH_like, L-threonine dehydrogen 0.002
cd08235 343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 0.002
cd08263 367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 0.004
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
 Score = 85.0 bits (211), Expect = 3e-21
 Identities = 30/64 (46%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 10 VQYNSYGGGA-ADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPC 68
          V Y  YG      L  VE+P+PTP   EVL+K+ A ++NPVDWK+++G  +  L R FP 
Sbjct: 1  VVYTRYGSPEVLLLLEVEVPIPTPKPGEVLVKVHAASVNPVDWKLRRGPPKLLLGRPFPP 60

Query: 69 IPGI 72
          IPG+
Sbjct: 61 IPGM 64


This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 319

>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 99.93
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 99.89
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.89
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 99.88
KOG1197 336 consensus Predicted quinone oxidoreductase [Energy 99.86
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 99.86
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.83
PLN02740 381 Alcohol dehydrogenase-like 99.83
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.83
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.83
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.82
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.82
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 99.81
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.81
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.81
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 99.8
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.8
cd08291 324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.78
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.77
PLN02827 378 Alcohol dehydrogenase-like 99.77
PLN02586 360 probable cinnamyl alcohol dehydrogenase 99.77
KOG0025 354 consensus Zn2+-binding dehydrogenase (nuclear rece 99.77
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.76
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.76
PLN02514 357 cinnamyl-alcohol dehydrogenase 99.75
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 99.75
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.75
PLN02178 375 cinnamyl-alcohol dehydrogenase 99.75
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.73
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.73
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.73
cd05284 340 arabinose_DH_like D-arabinose dehydrogenase. This 99.72
cd08290 341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.72
cd08278 365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.71
PRK05396 341 tdh L-threonine 3-dehydrogenase; Validated 99.71
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.7
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 99.7
PRK10754 327 quinone oxidoreductase, NADPH-dependent; Provision 99.7
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.7
PRK10083 339 putative oxidoreductase; Provisional 99.7
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.7
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 99.7
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.7
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 99.7
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.69
cd08285 351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.69
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.69
PTZ00354 334 alcohol dehydrogenase; Provisional 99.69
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.68
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.68
cd08279 363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.68
PRK13771 334 putative alcohol dehydrogenase; Provisional 99.67
cd05278 347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.67
cd05280 325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.67
cd08240 350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.67
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.67
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.66
cd08274 350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.66
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.66
cd08273 331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.66
cd08286 345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.66
cd08256 350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.66
cd08258 306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.66
PRK09422 338 ethanol-active dehydrogenase/acetaldehyde-active r 99.65
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.65
cd08263 367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.65
cd08297 341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.65
TIGR01751 398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.65
cd08276 336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.65
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.64
cd08249 339 enoyl_reductase_like enoyl_reductase_like. Member 99.64
cd08235 343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.64
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.64
cd08272 326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.64
cd08287 345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.64
cd08262 341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.64
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.64
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.64
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.63
cd05283 337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.63
cd05279 365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.63
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.63
TIGR02823 323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.63
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.63
cd08236 343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.63
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.62
cd05281 341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.62
PLN02702 364 L-idonate 5-dehydrogenase 99.62
cd08264 325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.62
cd08252 336 AL_MDR Arginate lyase and other MDR family members 99.62
cd08298 329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.62
cd08271 325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.62
cd08284 344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.61
cd05289 309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.6
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.6
cd08246 393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.6
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.6
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 99.59
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.58
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 99.58
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.58
TIGR00692 340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.57
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.57
cd08247 352 AST1_like AST1 is a cytoplasmic protein associated 99.56
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 99.55
cd08232 339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.55
TIGR02824 325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.54
cd05282 323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.54
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.53
cd05285 343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.53
cd08275 337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.53
cd08265 384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.52
cd05286 320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.5
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.49
cd08269 312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.49
cd08267 319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.49
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.48
cd08251 303 polyketide_synthase polyketide synthase. Polyketid 99.34
cd05188 271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.25
cd05195 293 enoyl_red enoyl reductase of polyketide synthase. 99.18
COG2130 340 Putative NADP-dependent oxidoreductases [General f 99.12
smart00829 288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 98.88
KOG1198 347 consensus Zinc-binding oxidoreductase [Energy prod 98.85
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 98.25
KOG1196 343 consensus Predicted NAD-dependent oxidoreductase [ 97.61
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 94.29
cd0032093 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); C 93.77
PTZ00414100 10 kDa heat shock protein; Provisional 93.3
PRK0036495 groES co-chaperonin GroES; Reviewed 92.97
PRK1453391 groES co-chaperonin GroES; Provisional 91.18
COG023496 GroS Co-chaperonin GroES (HSP10) [Posttranslationa 90.72
PF1382323 ADH_N_assoc: Alcohol dehydrogenase GroES-associate 90.67
PF0016693 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR0208 90.47
KOG1641104 consensus Mitochondrial chaperonin [Posttranslatio 82.15
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=99.93  E-value=8.3e-26  Score=151.88  Aligned_cols=86  Identities=28%  Similarity=0.373  Sum_probs=80.7

Q ss_pred             cceeeEEEcccCCCCcceEEeeccCCCCCCCcEEEEEeEeeeChhhHHHHhCCCCCCCCCCCCccccccceEEEEeecCC
Q 040376            5 PLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCELES   84 (100)
Q Consensus         5 ~~~ka~~~~~~~~~~~~~~~~~~~~p~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~~~p~~~G~e~~G~V~~vG~~   84 (100)
                      .+|||+++.+++++   +++.+.+.|.|+++||+|+++|||+|++|++.++|.++   ...+|.++|||.+|+|+++|++
T Consensus         2 ~~mkA~~~~~~~~p---l~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~---~~~~P~ipGHEivG~V~~vG~~   75 (339)
T COG1064           2 MTMKAAVLKKFGQP---LEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWP---VPKLPLIPGHEIVGTVVEVGEG   75 (339)
T ss_pred             cceEEEEEccCCCC---ceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCC---CCCCCccCCcceEEEEEEecCC
Confidence            46999999999887   89999999999999999999999999999999999987   4459999999999999999999


Q ss_pred             CCccCCCCEEEe
Q 040376           85 FNNFCPSRTYFD   96 (100)
Q Consensus        85 v~~~~~Gd~V~~   96 (100)
                      |++|++||||..
T Consensus        76 V~~~k~GDrVgV   87 (339)
T COG1064          76 VTGLKVGDRVGV   87 (339)
T ss_pred             CccCCCCCEEEe
Confidence            999999999965



>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>PTZ00414 10 kDa heat shock protein; Provisional Back     alignment and domain information
>PRK00364 groES co-chaperonin GroES; Reviewed Back     alignment and domain information
>PRK14533 groES co-chaperonin GroES; Provisional Back     alignment and domain information
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B Back     alignment and domain information
>PF00166 Cpn10: Chaperonin 10 Kd subunit; InterPro: IPR020818 The chaperonins are `helper' molecules required for correct folding and subsequent assembly of some proteins [] Back     alignment and domain information
>KOG1641 consensus Mitochondrial chaperonin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1yb5_A 351 Crystal Structure Of Human Zeta-crystallin With Bou 7e-05
2eih_A 343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 1e-04
3tqh_A 321 Structure Of The Quinone Oxidoreductase From Coxiel 1e-04
4dvj_A 363 Crystal Structure Of A Putative Zinc-Dependent Alco 6e-04
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 7e-05, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Query: 3 GKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQL--RP 60 G+ LM AV+ +GG ++ VP P +VL+K+ A +NPV+ I+ G +P Sbjct: 26 GQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKP 85 Query: 61 FLP 63 LP Sbjct: 86 LLP 88
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|3TQH|A Chain A, Structure Of The Quinone Oxidoreductase From Coxiella Burnetii Length = 321 Back     alignment and structure
>pdb|4DVJ|A Chain A, Crystal Structure Of A Putative Zinc-Dependent Alcohol Dehydrogenase Protein From Rhizobium Etli Cfn 42 Length = 363 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 4e-20
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 1e-19
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 2e-16
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 5e-16
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 5e-16
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 2e-15
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 8e-14
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 1e-13
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 2e-12
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 1e-11
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 3e-11
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 1e-10
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 1e-10
3gms_A 340 Putative NADPH:quinone reductase; structural genom 1e-10
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 2e-10
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 3e-10
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 5e-10
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 1e-09
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 2e-09
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 3e-09
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 5e-09
4eye_A 342 Probable oxidoreductase; structural genomics, niai 6e-09
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 1e-08
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 2e-08
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 3e-08
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 3e-08
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 3e-08
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 5e-08
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 9e-08
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 2e-07
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 2e-07
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 4e-05
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 1e-04
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 3e-04
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 4e-04
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 8e-04
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
 Score = 81.1 bits (201), Expect = 4e-20
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 7  MHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQ--LRPFLPR 64
          M A+Q++ +G     LK V+ P P   K+++L+K+ A +LNP+D+K + G   +   L  
Sbjct: 7  MKAIQFDQFGP-PKVLKLVDTPTPEYRKNQMLIKVHAASLNPIDYKTRNGSGFVAKKLKN 65

Query: 65 KFPCIPG 71
            P   G
Sbjct: 66 NLPSGLG 72


>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 99.94
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 99.93
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 99.92
4eye_A 342 Probable oxidoreductase; structural genomics, niai 99.91
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 99.91
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 99.91
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 99.91
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 99.91
3gms_A 340 Putative NADPH:quinone reductase; structural genom 99.91
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 99.91
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 99.91
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 99.91
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 99.91
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 99.91
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 99.91
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 99.91
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 99.91
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 99.91
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 99.9
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 99.9
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 99.9
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 99.9
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 99.9
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 99.9
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 99.9
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 99.9
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 99.89
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 99.89
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 99.89
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 99.89
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 99.89
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 99.89
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 99.89
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 99.89
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 99.89
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 99.89
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 99.89
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 99.89
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 99.89
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 99.88
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 99.88
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 99.88
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 99.88
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 99.88
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 99.88
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 99.88
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 99.88
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 99.87
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 99.87
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 99.87
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 99.87
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 99.87
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 99.86
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.86
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 99.86
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 99.86
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 99.86
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 99.85
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 99.85
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 99.85
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 99.85
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 99.84
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 99.83
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 99.81
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.81
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 99.76
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.74
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 99.71
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.7
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.48
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes 93.76
1g31_A111 GP31; chaperone, CO-chaperonin, groes, in VIVO pro 93.65
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 91.0
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 90.72
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, fl 90.36
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
Probab=99.94  E-value=5.9e-26  Score=153.14  Aligned_cols=95  Identities=22%  Similarity=0.292  Sum_probs=86.9

Q ss_pred             CCcccceeeEEEcccCCCCcceEEeeccCCCCCCCcEEEEEeEeeeChhhHHHHhCCCCCCCCCCCCccccccceEEEEe
Q 040376            1 MAGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFC   80 (100)
Q Consensus         1 m~~~~~~ka~~~~~~~~~~~~~~~~~~~~p~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~~~p~~~G~e~~G~V~~   80 (100)
                      |+++.+|||+++.+++++ +.+++++.+.|.|+++||+||+++++||++|++.+.|.++.  ...+|.++|||++|+|++
T Consensus        23 ~~~p~~MkA~~~~~~g~~-~~l~~~~~~~P~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~--~~~~p~i~G~E~~G~V~~   99 (353)
T 4dup_A           23 MSLPQEMRFVDLKSFGGP-DVMVIGKRPLPVAGEGEVLVRAEAIGVNRPDIAQRQGSYPP--PKDASPILGLELSGEIVG   99 (353)
T ss_dssp             CCCCSSEEEEEESSSSSG-GGEEEEEECCCCCCTTEEEEEEEEEEECHHHHHHHTTSSCC--CTTSCSSSCCEEEEEEEE
T ss_pred             CCCChheeEEEEccCCCc-cceEEEeccCCCCCCCEEEEEEEEEecCHHHHHHhCCCCCC--CCCCCCccccccEEEEEE
Confidence            778889999999998887 88999999999999999999999999999999999987652  345789999999999999


Q ss_pred             ecCCCCccCCCCEEEeec
Q 040376           81 ELESFNNFCPSRTYFDVY   98 (100)
Q Consensus        81 vG~~v~~~~~Gd~V~~~~   98 (100)
                      +|+++++|++||||+++.
T Consensus       100 vG~~v~~~~vGdrV~~~~  117 (353)
T 4dup_A          100 VGPGVSGYAVGDKVCGLA  117 (353)
T ss_dssp             ECTTCCSCCTTCEEEEEC
T ss_pred             ECCCCCCCCCCCEEEEec
Confidence            999999999999999864



>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} SCOP: b.35.1.0 Back     alignment and structure
>1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Back     alignment and structure
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 1e-09
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 6e-09
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 3e-08
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 6e-08
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 8e-08
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 3e-07
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 5e-07
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 7e-07
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 8e-07
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 1e-06
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 2e-06
d1qora1147 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas 4e-06
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 6e-06
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 8e-06
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 1e-05
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 1e-05
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 1e-05
d1e3ia1 202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 2e-05
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 3e-05
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 7e-05
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 9e-05
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 2e-04
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Ketose reductase (sorbitol dehydrogenase)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 50.3 bits (119), Expect = 1e-09
 Identities = 16/69 (23%), Positives = 28/69 (40%), Gaps = 4/69 (5%)

Query: 2  AGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPF 61
          A KP   ++  +    G  DL+    P+P P  +EVLL++ +  +   D    +      
Sbjct: 3  AAKPNNLSLVVH----GPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGN 58

Query: 62 LPRKFPCIP 70
             K P + 
Sbjct: 59 FIVKKPMVL 67


>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.95
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.94
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.93
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.93
d1f8fa1 194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.93
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.93
d1e3ia1 202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.93
d1p0fa1 198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.93
d2jhfa1 198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.93
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.93
d2fzwa1 197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.92
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.92
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.92
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.92
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.91
d1cdoa1 199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.91
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.91
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.9
d1kola1 201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.88
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.88
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.87
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.87
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.84
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.81
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.64
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.58
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis 91.99
d1aono_97 Chaperonin-10 (GroES) {Escherichia coli [TaxId: 56 89.27
d1g31a_107 GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665 81.69
d1we3o_96 Chaperonin-10 (GroES) {Thermus thermophilus [TaxId 81.61
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Alcohol dehydrogenase
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.95  E-value=1.1e-27  Score=146.85  Aligned_cols=90  Identities=22%  Similarity=0.280  Sum_probs=82.7

Q ss_pred             CcccceeeEEEcccCCCCcceEEeeccCCCCCCCcEEEEEeEeeeChhhHHHHhCCCCCCCCCCCCccccccceEEEEee
Q 040376            2 AGKPLMHAVQYNSYGGGAADLKHVELPVPTPSKDEVLLKLEATALNPVDWKIQKGQLRPFLPRKFPCIPGILVLPLIFCE   81 (100)
Q Consensus         2 ~~~~~~ka~~~~~~~~~~~~~~~~~~~~p~~~~~ev~v~v~~~~l~~~d~~~~~g~~~~~~~~~~p~~~G~e~~G~V~~v   81 (100)
                      +++.+|||+++++++++   +++++.+.|.|++||||||+++++||++|++.++|.++  ....+|.++|||++|+|+++
T Consensus         1 ~~P~tMkA~v~~~~g~p---l~l~evp~P~~~~~evlVkv~a~gic~~D~~~~~G~~~--~~~~~P~i~GhE~~G~V~~~   75 (175)
T d1llua1           1 TLPQTMKAAVVHAYGAP---LRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWP--VKPPLPFIPGHEGVGYVAAV   75 (175)
T ss_dssp             CCCSEEEEEEBCSTTSC---CEEEEEECCCCCTTCEEEEEEEEECCHHHHHHHHTCSS--SCCCSSBCCCSCEEEEEEEE
T ss_pred             CcchhcEEEEEEeCCCC---CEEEEeECCCCCCCEEEEEEEEecCcccchhhhccCcc--ccccCCcCCCCcceEEEEEe
Confidence            46789999999998877   89999999999999999999999999999999999765  24578999999999999999


Q ss_pred             cCCCCccCCCCEEEe
Q 040376           82 LESFNNFCPSRTYFD   96 (100)
Q Consensus        82 G~~v~~~~~Gd~V~~   96 (100)
                      |++++.|++||||+.
T Consensus        76 G~~v~~~~~GdrV~~   90 (175)
T d1llua1          76 GSGVTRVKEGDRVGI   90 (175)
T ss_dssp             CTTCCSCCTTCEEEE
T ss_pred             CCCccccccCCEEEe
Confidence            999999999999975



>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure