Citrus Sinensis ID: 040408


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MSVESSSPKLELAAATKEKFGREIRVFETSGQFSSSPRIDETDDDNDDDDDDEFYEFTAEDYYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIADHQQQPHDDPKPAAEKKSVKLRPKWLKI
ccccccccHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccEEEEEEcccccEEEEEccccccHHHHHHHHHHHccccccccEEEEccccccccccccccHHHccccccEEEEEEEcccHHHHHHHHcccccccHHHHHHcccccccccccccccccccccccccccccccccccc
ccHHHcHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccccccccccHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHccccccEEEEEcccccEcccccHHHHHccccccEEEEEEccccccccHHHcccccccHHHHHccccccHHccccccccccccccccccccccccccEEcc
msvessspkLELAAATKEKFGREIRvfetsgqfssspridetdddnddddddefyeFTAEDYYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRvrfpdnhtlevnfhpsetMQSLVDFLRMRVlsrtdvpfylytappkrIIKDMSqdfysagfipgaivyfSYDDAYATVAAAAnsgpflreDVMSLKGCLQVIAdhqqqphddpkpaaekksvklrpkwlki
msvessspkleLAAAtkekfgreirvfetsgqfssspridetdddndddDDDEFYEFTAEDYYRIlaankkkednkflktrrireaeeaagtgrskfrkaVIIRVRFpdnhtlevnfhpsetMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIADHqqqphddpkpaaekksvklrpkwlki
MSVESSSPKLELAAATKEKFGREIRVFETSGQFSSSPRIdetdddnddddddefyeftaedyYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSyddayatvaaaaNSGPFLREDVMSLKGCLQVIADHQQQPHDDPKPAAEKKSVKLRPKWLKI
*****************************************************FYEFTAEDYYRILAAN**************************KFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIA****************************
***************************************************DEFYEFTAED*************************************KAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDA**************************************************RPKWLKI
*************AATKEKFGREIRVFETS******************DDDDEFYEFTAEDYYRILAANKKKEDNKFLKTRRIREA********SKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIADH******************LRPKWLKI
*****SSPKLELAAATKEKFGREIRVFETS*******************DDDEFYEFTAEDYYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCL**I*****************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVESSSPKLELAAATKEKFGREIRVFETSGQFSSSPRIDETDDDNDDDDDDEFYEFTAEDYYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIADHQQQPHDDPKPAAEKKSVKLRPKWLKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
Q9BZE9553 Tether containing UBX dom yes no 0.736 0.312 0.288 2e-14
Q8VBT9550 Tether containing UBX dom no no 0.510 0.218 0.351 1e-13
Q9BZV1441 UBX domain-containing pro no no 0.770 0.410 0.26 1e-08
Q99PL6442 UBX domain-containing pro no no 0.595 0.316 0.263 6e-06
Q2KIJ6441 UBX domain-containing pro no no 0.412 0.219 0.287 2e-05
P54730416 UBX domain-containing pro yes no 0.753 0.425 0.220 0.0004
>sp|Q9BZE9|ASPC1_HUMAN Tether containing UBX domain for GLUT4 OS=Homo sapiens GN=ASPSCR1 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 98/218 (44%), Gaps = 45/218 (20%)

Query: 52  DEFYEFTAEDYYRILA---ANKKKEDNKFLKTRRIREAEEAAGTGRSKFRK--AVIIRVR 106
           DEF+E T +D  R LA   + +K+ +   L T+  REA+      + K  +   V +RV 
Sbjct: 342 DEFFELTVDDVRRRLAQLKSERKRLEEAPLVTKAFREAQI-----KEKLERYPKVALRVL 396

Query: 107 FPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFI 166
           FPD + L+  F PSET+  L DF+R   L   ++ FYL+  PPK ++ D +Q  + A   
Sbjct: 397 FPDRYVLQGFFRPSETVGDLRDFVRSH-LGNPELSFYLFITPPKTVLDDHTQTLFQANLF 455

Query: 167 PGAIVYFSYDDAYATVAAAANSGPFLREDVMSLKGCLQVIADHQQQ--------PHDDPK 218
           P A+V+   ++      A     P L E  +S      ++A +  +        P  DP 
Sbjct: 456 PAALVHLGAEE-----PAGVYLEPGLLEHAISPSAADVLVARYMSRAAGSPSPLPAPDPA 510

Query: 219 PAAE---------------------KKSVKLRPKWLKI 235
           P +E                     K+S+   PKWLK+
Sbjct: 511 PKSEPAAEEGALVPPEPIPGTAQPVKRSLGKVPKWLKL 548




Tethering protein that sequesters GLUT4-containing vesicles in the cytoplasm in the absence of insulin. Modulates the amount of GLUT4 that is available at the cell surface.
Homo sapiens (taxid: 9606)
>sp|Q8VBT9|ASPC1_MOUSE Tether containing UBX domain for GLUT4 OS=Mus musculus GN=Aspscr1 PE=1 SV=1 Back     alignment and function description
>sp|Q9BZV1|UBXN6_HUMAN UBX domain-containing protein 6 OS=Homo sapiens GN=UBXN6 PE=1 SV=1 Back     alignment and function description
>sp|Q99PL6|UBXN6_MOUSE UBX domain-containing protein 6 OS=Mus musculus GN=Ubxn6 PE=1 SV=1 Back     alignment and function description
>sp|Q2KIJ6|UBXN6_BOVIN UBX domain-containing protein 6 OS=Bos taurus GN=UBXN6 PE=2 SV=1 Back     alignment and function description
>sp|P54730|UBX4_YEAST UBX domain-containing protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBX4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
296090270231 unnamed protein product [Vitis vinifera] 0.868 0.883 0.582 4e-60
225452198250 PREDICTED: tether containing UBX domain 0.868 0.816 0.582 7e-60
255571964304 conserved hypothetical protein [Ricinus 0.868 0.671 0.559 1e-58
118482737229 unknown [Populus trichocarpa] 0.851 0.873 0.589 9e-56
224055139250 predicted protein [Populus trichocarpa] 0.851 0.8 0.589 1e-55
356571465257 PREDICTED: tether containing UBX domain 0.927 0.848 0.533 1e-55
363807130258 uncharacterized protein LOC100792947 [Gl 0.931 0.848 0.525 3e-54
118483261250 unknown [Populus trichocarpa] 0.851 0.8 0.554 6e-53
224106105250 predicted protein [Populus trichocarpa] 0.851 0.8 0.550 4e-52
449441426231 PREDICTED: tether containing UBX domain 0.919 0.935 0.492 1e-51
>gi|296090270|emb|CBI40089.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 168/237 (70%), Gaps = 33/237 (13%)

Query: 15  ATKEKFGREIRVFETSGQFSSSPRIDETDDDNDDDDDDEFYEFTAEDYYRILAANKKKED 74
           A K+KFG EI VFETS   S +P     D+ +  ++ D+FYEFTAEDYYRILA   KKED
Sbjct: 12  AVKQKFGHEIHVFETSTT-SQTP-----DEASHSEETDDFYEFTAEDYYRILAT--KKED 63

Query: 75  NKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRV 134
            KFLKTR+IREAEEAA   +S+  KAVI RVRFPDNHTLE  FHPSET+QSLVD L M+V
Sbjct: 64  -KFLKTRKIREAEEAAR--KSRITKAVI-RVRFPDNHTLEATFHPSETLQSLVDLL-MKV 118

Query: 135 LSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSYDDAYATVAAAANSGPFLRE 194
           +++ ++PFY+YTAPPK+ IKDMSQDFYSAGF+PGAI+YFSYD       AA NSG  LRE
Sbjct: 119 IAQPELPFYIYTAPPKKQIKDMSQDFYSAGFVPGAIIYFSYDQPKGNDGAAGNSGACLRE 178

Query: 195 DVMSLKGCLQVIADHQQ--QP--------------HDDPKPAAEKKSVKLRPKWLKI 235
           ++MSLKG L ++ +  +  QP                +PKP A+KK VK  PKWLK+
Sbjct: 179 EIMSLKG-LHLVTELVEPVQPAIEPEAEKVAPPPVAQEPKP-AQKKPVK--PKWLKM 231




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452198|ref|XP_002266652.1| PREDICTED: tether containing UBX domain for GLUT4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255571964|ref|XP_002526923.1| conserved hypothetical protein [Ricinus communis] gi|223533675|gb|EEF35410.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|118482737|gb|ABK93287.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224055139|ref|XP_002298423.1| predicted protein [Populus trichocarpa] gi|222845681|gb|EEE83228.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356571465|ref|XP_003553897.1| PREDICTED: tether containing UBX domain for GLUT4-like [Glycine max] Back     alignment and taxonomy information
>gi|363807130|ref|NP_001242340.1| uncharacterized protein LOC100792947 [Glycine max] gi|255641492|gb|ACU21021.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|118483261|gb|ABK93533.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106105|ref|XP_002314044.1| predicted protein [Populus trichocarpa] gi|222850452|gb|EEE87999.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449441426|ref|XP_004138483.1| PREDICTED: tether containing UBX domain for GLUT4-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
TAIR|locus:2086493251 PUX1 "plant UBX domain-contain 0.927 0.868 0.465 3.2e-42
ZFIN|ZDB-GENE-050417-31584 aspscr1 "alveolar soft part sa 0.514 0.207 0.343 2.2e-15
MGI|MGI:1916188550 Aspscr1 "alveolar soft part sa 0.442 0.189 0.361 5e-13
UNIPROTKB|Q9BZE9553 ASPSCR1 "Tether containing UBX 0.438 0.186 0.355 1.1e-12
UNIPROTKB|E1C2F5496 ASPSCR1 "Uncharacterized prote 0.442 0.209 0.361 6.8e-11
RGD|1588666448 Aspscr1 "alveolar soft part sa 0.365 0.191 0.377 3.4e-07
DICTYBASE|DDB_G0279285573 DDB_G0279285 "UBX domain-conta 0.446 0.183 0.321 6.3e-06
UNIPROTKB|F1S7L6441 UBXN6 "Uncharacterized protein 0.395 0.210 0.298 0.0001
UNIPROTKB|F1MES6441 UBXN6 "UBX domain-containing p 0.395 0.210 0.288 0.00054
UNIPROTKB|Q2KIJ6441 UBXN6 "UBX domain-containing p 0.395 0.210 0.288 0.00054
TAIR|locus:2086493 PUX1 "plant UBX domain-containing protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 447 (162.4 bits), Expect = 3.2e-42, P = 3.2e-42
 Identities = 115/247 (46%), Positives = 142/247 (57%)

Query:     2 SVESSSPKLELAAATKEKFGREIRVFETSGQFSSSPRIXXXXXXXXXXXXXXXXXXXXXX 61
             S+E+SS      A  +EK GRE+RVFETS   S  P                        
Sbjct:    21 SMEASSSAQAKIADMREKLGREVRVFETSS-ISQRP----SQVSSADDESDDFYEFTPAD 75

Query:    62 XYRILAANKKKEDNKFLKTRRIREAEEAAGTGRSKFRKAVIIRVRFPDNHTLEVNFHPSE 121
              YR+LA   KKED K LKTR+IREAEEAA   RSK  KAVI RVRFPDNHTLE  FHPSE
Sbjct:    76 FYRLLAT--KKED-KSLKTRKIREAEEAAR--RSKLTKAVI-RVRFPDNHTLEATFHPSE 129

Query:   122 TMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSXXXXXXX 181
              +Q L+D ++ RV++  DVPFYLYT PPK+ IKD SQDFYSAGF+PGAIVYFS       
Sbjct:   130 KIQGLIDLVK-RVVAHPDVPFYLYTTPPKKQIKDFSQDFYSAGFVPGAIVYFSNDQPKDD 188

Query:   182 XXXXXNSGPFLREDVMSLKGCLQVIADHQQQPHDDPKPAA----------EKKSVK---L 228
                  +S P+L E+++SLK  L+ +    +      +PA           E+KS +    
Sbjct:   189 GG---SSTPYLNEEILSLKD-LEAMTKAVEPVESSSEPATVDSSAVPVEHERKSTEKKTT 244

Query:   229 RPKWLKI 235
             +PKW K+
Sbjct:   245 KPKWFKM 251




GO:0005634 "nucleus" evidence=ISM
GO:0035265 "organ growth" evidence=IMP
GO:0043241 "protein complex disassembly" evidence=IDA
ZFIN|ZDB-GENE-050417-31 aspscr1 "alveolar soft part sarcoma chromosome region, candidate 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1916188 Aspscr1 "alveolar soft part sarcoma chromosome region, candidate 1 (human)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZE9 ASPSCR1 "Tether containing UBX domain for GLUT4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2F5 ASPSCR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1588666 Aspscr1 "alveolar soft part sarcoma chromosome region, candidate 1 (human)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279285 DDB_G0279285 "UBX domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7L6 UBXN6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MES6 UBXN6 "UBX domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIJ6 UBXN6 "UBX domain-containing protein 6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020575001
SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (231 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
pfam0078978 pfam00789, UBX, UBX domain 0.002
cd0176777 cd01767, UBX, UBX (ubiquitin regulatory X) domain 0.003
>gnl|CDD|216120 pfam00789, UBX, UBX domain Back     alignment and domain information
 Score = 35.7 bits (83), Expect = 0.002
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 103 IRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKD 155
           +++R PD   L   F+ S+ +Q + DF+        D PF L T  P+R + D
Sbjct: 6   LQIRLPDGSRLVRRFNSSDPLQDVYDFVD-SNRYDDDEPFSLNTNFPRRPLTD 57


This domain is present in ubiquitin-regulatory proteins and is a general Cdc48-interacting module. Length = 78

>gnl|CDD|176362 cd01767, UBX, UBX (ubiquitin regulatory X) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
smart0016680 UBX Domain present in ubiquitin-regulatory protein 99.79
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 99.77
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 99.76
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 99.72
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 99.72
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 99.67
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 99.67
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 99.64
KOG2689290 consensus Predicted ubiquitin regulatory protein [ 99.49
KOG2507506 consensus Ubiquitin regulatory protein UBXD2, cont 99.02
KOG2086380 consensus Protein tyrosine phosphatase SHP1/Cofact 99.02
KOG2699407 consensus Predicted ubiquitin regulatory protein [ 98.46
KOG1364356 consensus Predicted ubiquitin regulatory protein, 98.39
KOG1363460 consensus Predicted regulator of the ubiquitin pat 98.25
KOG2699407 consensus Predicted ubiquitin regulatory protein [ 97.96
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 97.64
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 96.95
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 96.8
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 96.71
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 96.64
PTZ0004476 ubiquitin; Provisional 96.59
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 96.58
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 96.43
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 96.33
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 96.16
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 96.03
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 95.93
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 95.84
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 95.8
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 95.57
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 95.41
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 95.41
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 95.2
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 95.16
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 95.04
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 95.02
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 94.71
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 94.66
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 94.6
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 94.13
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 93.14
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 92.94
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 92.89
smart00295207 B41 Band 4.1 homologues. Also known as ezrin/radix 92.83
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 91.36
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 91.02
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 90.57
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 90.54
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 89.53
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 88.51
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 88.41
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 87.13
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 84.02
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 81.5
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 80.72
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
Probab=99.79  E-value=4.8e-19  Score=130.88  Aligned_cols=77  Identities=21%  Similarity=0.452  Sum_probs=69.9

Q ss_pred             CCceeEEEEECCCCceEEEEeCCCCchHHHHHHHHHhhcCCCCCCeEEEeCCCceeecC--CCcCccccCCCCceEEEEE
Q 040408           97 FRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKD--MSQDFYSAGFIPGAIVYFS  174 (235)
Q Consensus        97 ~~~~~~IRIRFPDg~~lq~~F~~~etl~~l~~fV~~~~L~~~~~~F~L~~t~P~k~l~d--~~~tL~elgL~Psall~~~  174 (235)
                      ++.|. |+||||||..++.+|++++||++||+|| ..+......+|.|++++|++.|.+  +++||.|+||+|+++|++.
T Consensus         2 ~~~~~-I~iRlPdG~ri~~~F~~~~tl~~v~~~v-~~~~~~~~~~f~L~t~~Prk~l~~~d~~~tL~e~gL~p~~~l~v~   79 (80)
T smart00166        2 SDQCR-LQIRLPDGSRLVRRFPSSDTLRTVYEFV-SAALTDGNDPFTLNSPFPRRTFTKDDYSKTLLELALLPSSTLVLE   79 (80)
T ss_pred             CCeEE-EEEEcCCCCEEEEEeCCCCcHHHHHHHH-HHcccCCCCCEEEEeCCCCcCCccccccCCHHHCCCCCceEEEEe
Confidence            35688 9999999999999999999999999999 677766678999999999999964  4789999999999999998


Q ss_pred             e
Q 040408          175 Y  175 (235)
Q Consensus       175 ~  175 (235)
                      |
T Consensus        80 ~   80 (80)
T smart00166       80 P   80 (80)
T ss_pred             C
Confidence            7



Present in FAF1 and Shp1p.

>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>KOG2689 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>KOG2086 consensus Protein tyrosine phosphatase SHP1/Cofactor for p97 ATPase-mediated vesicle membrane fusion [Nuclear structure] Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1364 consensus Predicted ubiquitin regulatory protein, contains UAS and UBX domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1363 consensus Predicted regulator of the ubiquitin pathway (contains UAS and UBX domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 3e-12
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 3e-09
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 3e-07
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 8e-07
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Length = 109 Back     alignment and structure
 Score = 60.3 bits (146), Expect = 3e-12
 Identities = 22/95 (23%), Positives = 31/95 (32%), Gaps = 3/95 (3%)

Query: 103 IRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIK--DMSQDF 160
           I+ R PD  +    F     ++    F    V +     F L T  P+R     D  +  
Sbjct: 16  IQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYG-NFSLATMFPRREFTREDYKRRL 74

Query: 161 YSAGFIPGAIVYFSYDDAYATVAAAANSGPFLRED 195
                 P A V        AT    ++SG  L  D
Sbjct: 75  LDLELAPSASVVLLPAGRPATSIVHSSSGDILMID 109


>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Length = 127 Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Length = 84 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Length = 109 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 99.79
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 99.73
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 99.71
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 99.68
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 99.64
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.41
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.27
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 97.12
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 97.09
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 96.97
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 96.85
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 96.76
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 96.74
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 96.72
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 96.66
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 96.58
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 96.56
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 96.53
3v6c_B91 Ubiquitin; structural genomics, structural genomic 96.51
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 96.48
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 96.45
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 96.44
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 96.31
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 96.29
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 96.28
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 96.26
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 96.18
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 96.17
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 96.16
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 96.14
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 96.13
3m62_B106 UV excision repair protein RAD23; armadillo-like r 96.12
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 96.1
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 96.01
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 95.89
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 95.89
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 95.87
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 95.84
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 95.83
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 95.79
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 95.79
1we6_A111 Splicing factor, putative; structural genomics, ub 95.77
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 95.67
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 95.58
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 95.49
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 95.4
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 95.39
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 95.37
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 95.27
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 95.27
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 95.22
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 95.18
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 95.16
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 95.05
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 94.92
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 94.76
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 93.76
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 94.69
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 94.68
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 94.66
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 94.61
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 94.54
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 94.51
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 94.45
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 94.44
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 94.39
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 94.37
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 94.18
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 93.81
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 93.71
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 93.66
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 93.41
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 93.35
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 93.01
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 92.69
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 92.46
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 92.38
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 91.76
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 91.45
4ajy_B118 Transcription elongation factor B polypeptide 2; E 91.45
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 91.4
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 90.51
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 90.44
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 90.1
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 89.73
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 89.57
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 89.17
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 88.98
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 88.86
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 88.85
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 88.55
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 88.38
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 88.1
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 88.05
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 88.01
2fnj_B118 Transcription elongation factor B polypeptide 2; b 86.96
2kj6_A97 Tubulin folding cofactor B; methods development, N 86.42
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 85.45
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 85.04
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 84.2
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 82.42
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 81.14
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 80.87
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 80.71
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
Probab=99.79  E-value=4.7e-19  Score=137.48  Aligned_cols=82  Identities=21%  Similarity=0.293  Sum_probs=74.1

Q ss_pred             cCCCceeEEEEECCCCceEEEEeCCCCchHHHHHHHHHhhcCCCCCCeEEEeCCCceeec--CCCcCccccCCCCceEEE
Q 040408           95 SKFRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIK--DMSQDFYSAGFIPGAIVY  172 (235)
Q Consensus        95 ~~~~~~~~IRIRFPDg~~lq~~F~~~etl~~l~~fV~~~~L~~~~~~F~L~~t~P~k~l~--d~~~tL~elgL~Psall~  172 (235)
                      ..+..|. ||||||||..++.+|+.++||++||+|| ...+..+..+|.|++++|+++|.  |+++||.|+||+|+++|+
T Consensus         9 ~~~~~t~-IqIRlpdG~rl~~rF~~~~tl~~v~~fV-~~~~~~~~~~f~L~t~fPrk~l~~~d~~~TL~elgL~psa~L~   86 (109)
T 2dzk_A            9 DRSTIAR-IQFRLPDGSSFTNQFPSDAPLEEARQFA-AQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVV   86 (109)
T ss_dssp             CCSCCEE-EEEECSSSCEEEEEECTTSBHHHHHHHH-HHHHTTSSCSCEEECSSSCCBCCTTTTTSBTGGGTCSSEEEEE
T ss_pred             CCCCcEE-EEEECCCCCEEEEEeCCCCCHHHHHHHH-HhccCCCCCceEEEcCCCCcCCcccccCCCHHHCCCCCceEEE
Confidence            4566788 9999999999999999999999999999 67766667899999999999996  678999999999999999


Q ss_pred             EEeCch
Q 040408          173 FSYDDA  178 (235)
Q Consensus       173 ~~~~~~  178 (235)
                      +.|...
T Consensus        87 v~~~~~   92 (109)
T 2dzk_A           87 LLPAGR   92 (109)
T ss_dssp             EECCSS
T ss_pred             EEECcC
Confidence            999653



>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1i42a_89 d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 2e-13
d2cr5a196 d.15.1.2 (A:8-103) UBX domain-containing protein 6 1e-10
d1h8ca_82 d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human 4e-08
d1wj4a_124 d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human 3e-06
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 89 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: UBX domain
domain: p47
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 61.8 bits (150), Expect = 2e-13
 Identities = 16/71 (22%), Positives = 27/71 (38%)

Query: 101 VIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVLSRTDVPFYLYTAPPKRIIKDMSQDF 160
             I++R  D   L   F+ S  +  +  F+     +     F L T  P + + D +Q  
Sbjct: 15  TNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTL 74

Query: 161 YSAGFIPGAIV 171
             A  +   IV
Sbjct: 75  KEANLLNAVIV 85


>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.73
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 99.71
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 99.67
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 99.63
d1s3si_50 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.21
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 96.92
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 96.89
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 96.85
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 96.82
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 96.69
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 96.62
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 96.61
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 96.43
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 96.38
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.36
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 96.29
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 96.24
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 96.1
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 96.04
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 95.96
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 95.8
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 95.59
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 95.56
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 95.1
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 95.04
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 94.95
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 94.84
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 94.76
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 94.65
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 94.63
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 94.34
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 94.34
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 94.18
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 94.02
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 93.67
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 93.2
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 90.94
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 89.7
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 89.39
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 87.78
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 87.09
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 84.1
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 81.36
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: UBX domain
domain: p47
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.73  E-value=5.5e-18  Score=125.08  Aligned_cols=76  Identities=20%  Similarity=0.293  Sum_probs=66.9

Q ss_pred             CCceeEEEEECCCCceEEEEeCCCCchHHHHHHHHHhhc-CCCCCCeEEEeCCCceeecCCCcCccccCCCCceEEEEEe
Q 040408           97 FRKAVIIRVRFPDNHTLEVNFHPSETMQSLVDFLRMRVL-SRTDVPFYLYTAPPKRIIKDMSQDFYSAGFIPGAIVYFSY  175 (235)
Q Consensus        97 ~~~~~~IRIRFPDg~~lq~~F~~~etl~~l~~fV~~~~L-~~~~~~F~L~~t~P~k~l~d~~~tL~elgL~Psall~~~~  175 (235)
                      .+.|. ||||||||..++..|++++++++||+|| ..+. .....+|.|++++|++.|.|.++||.|+||+|+++ .+.|
T Consensus        12 ~p~t~-I~iRlPdG~~~~~~F~~~~tl~dv~~~v-~~~~~~~~~~~f~L~t~~Prr~l~d~~~TL~e~gL~~s~v-l~k~   88 (89)
T d1i42a_          12 EPTTN-IQIRLADGGRLVQKFNHSHRISDIRLFI-VDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVI-VQRL   88 (89)
T ss_dssp             SCCEE-EEEEETTTCCEEEEECSSSCGGGHHHHH-HHHCTTTSSCCEEEEETTTTEECCCCSSCSGGGTTCCSEE-EEEE
T ss_pred             CCcEE-EEEEcCCCCEEEEEECCchhHHHHHHHH-HHhCccCCCCCEEEecCCCCcccCCCcCcHHHCCCcCceE-EEEe
Confidence            35677 9999999999999999999999999999 6664 45577899999999999998899999999998765 6666



>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3si_ d.15.1.2 (I:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure