Citrus Sinensis ID: 040435


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970------1980------1990-
MEARRRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTLGDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCPLSPMCSSSEPPSPPRKEACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTRERRIPPSSVEPLIKSTSDSGPDSGIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQSSNLTLSFSSESSLEEELKRESTADVVTIVVSL
cccccccccHHHHHHHHHHHHHHEEEEEccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccEEEcEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccccccccccEEEEEEcccEEEEEEEEEccccccccccccEEEEEcccccccHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccccccEEEEcccEEEEcccccccEEcccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccHHHHHHHHcHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccEEEEEEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccEEEHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEEcccEEEEcEEEEEcccccHHHHHcccccccccccHHHHHHHccccccHHHHHHHHcccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcEEEccccHHHHHHHHHHHHHHHHHEEEEEEEccccccccccccccHHHHHcccccccccHHHHHHHEEccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHHcccccccccccccccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccHHHHHcccccccEEEEEEEc
cHHHHHHHHHHHHHHHHHHHHHHEEEEHHEccccccHHHHHHHHHHHcccccccccccHHEcccccccccEEEEEEEcccccEEEEEEEcccccccEEEEccccccccccccccEcccccccccccHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHccccccEEEEEEcccEEEEEEEEEcEEEccccccccEEEEEEcHHHHHHHHHEEEEccccccEEEEEEcccHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcHHHcccHHHHHHHcccEEEEHHHHcHHEEcccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccHEHHEEEcccccccHEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHccccccccccccEEEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccEEEEEEcccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHEcHHHcccccccccEHHHHHEEHHHHHccHHHHHcHHHHHHHHHHHHHHHHHcEEEEEEEccccEEEEcccccccccHHHcccccccHHHHHHHHHHccccccccccccEEEccHHHHHHHHHHcccccEcccccEEEEEEHccccccccccccHHHHHHEcccccccccccHHHHHHHHHHHccccccHHHHcccccccccEEcccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHccHHcccccEEEEccHccHHHHHHHcccccEEEEEEEc
MEARRRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKahrplydkgdgaarfnndpdikdidiiatysdvsgAVRISRVKMSHLSASwilenpadgdnglpnssqtlgDSFQAgmnleenveypmgdhqseevgffnrqkpplspvkLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEqskrleprvtgkysiwrrdfespntdsTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRaigdansdaelpsSALNQAQAMGHVLSIAKdqlydcptvQRKFRAMIQSTEGTVTALKRKSSFLIQLAAkivprplhclplQLAADYYLQghhkkeeqinekfedpslyhyaifsDNVLATSVVVNSTvahakepekhvFHIVTDKLNFVAMKMWFLvnappkatiqienidsfkwlNSSYCSVLRQLESARLKEYyfkanhpsslsagsdnlkyrnpkyLSMLNHLRFYLPEVYPKLEKilfldddivvqkdltplwsvdlhgmvNGAVETCKESFHRFDkylnfsnplisenfspnacgwafgmnmFDLKEWRKRNITGIYHYWqdanedrtlwklgtlppglitfynltypldrswhvlglgydpalnltqidngavvhyngnnkpwLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKvvvdlndpsvyPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYmkwrfpdsavavfddcicrdsVSWNIMIQGhldhgtlgEGLWWFYKARvagfepnnSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSgfknepdgQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFsempqknkvswNSALSGLVVNEKYSEALSLLYSMgkgvnevdEITLVNILQICKcfvhpmecksvhCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLfndvkkpdVVLWSTMIAGFTLCGRPREAIAVFQEMnqaqekpnAITIINLLEACSVAtelssskwaHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMklgglqpnavTTLSVLSacshgglveEGLSFFNSMVqdhgvepaleHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSygntelgagaTSRILELEAQNSAGYLLASSMYAAgglwvessgtrllakergvkvvagnslvhvdNKACKFiagekaqshprgsEVILLACLVTAektdtllikdvtsserhskEYCAMydicgersdgkvlncpygspsvkpdelFSAKIEslcpsisgnvccteTQFETLRAQVQQAIPFLVGCPACLRNFLNLFcelscspnqsqfiNVTSVSevngnltvdGIDYYVTSTFGeelynsckdvkfgtmntrAIDFIGAGAKSFKEWFAFigqkappgfpgspyainfklsipessglelmnvstyscgdtslgcscgdcplspmcssseppspprkeactirigslKVKCVELSLVIAYVVLISTFFGWALFqrtrerrippssveplikstsdsgpdsgimeevnardllpteggglSVVQGYMLSFYRTYgrwvaanpAFVLCMSLAIGFVLCLGVIRfkvetrpeklwvgpgsraagekqffdshlapfyRIEQLILatlpdpkngkqpsiiteDNFQLLFEMQKKvdgvrandsaslVSITDIclkplgedcasqSVLQYFkmdpenydsyggiehaEYCFQhyassdtclsafkapldpstvlggfsgnnysEASAFIITYpvnnaidetSKENRKAVAWEKAFIQLAKEEllpmvqssnltlsfsseSSLEEELKRESTADVVTIVVSL
mearrrfftlssfDRLLVVALSLVIVHittvnaevpdvrRLQRELKahrplydkgdgaarfnndpdikDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTLGDSFQAGMNLEENVEYPMGDHQSEEVGffnrqkpplspvklkrQMLRQKRMELRTAelirqdnendnIMQETafeqskrleprvtgkysiwrrdfespntdstLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVahakepekhvFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKAnhpsslsagsdnlKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKvvagnslvhvDNKACKFIAgekaqshprgsEVILLACLVTAektdtllikdvtsserhskeYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCPLSPMCSSSEPPSPPRKEACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTrerrippssveplikstsdsgpdsgIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKlwvgpgsraageKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQSSNLTLSFSSESSLeeelkrestadvVTIVVSL
MEARRRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNdpdikdidiiATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTLGDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCplspmcssseppsppRKEACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTRERRIPPSSVEPLIKSTSDSGPDSGIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQssnltlsfssessleeelkresTADVVTIVVSL
*****RFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWIL******************************************************************************************************GKYSIWRRDF*******TLKLMRDQIILAKAYAHVA******************************************MGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKAN***********LKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQ**PRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCP*****************ACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQR***********************************LLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILATLP********SIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPM***********************************
***RRRFFTLSSFDRLLVVALSLVIVHITT**************************************DIDIIATYSDVSG****************************************************************************************************************************************STLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCK****************************VLSIAKDQLYDCPTVQRKFRAMI**********KR*SSFLIQLAAKIVPRPLHCLPLQLAADYYLQG***************SLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKAN*************YRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFK*************VSTYSCGDTSLGCSCGDCP**********************IGSLKVKCVELSLVIAYVVLISTFFGWALFQ********************************************LSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILAT************ITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAID******RKAVAWEKAFIQLAKEELLPMVQSSNLTL****************TADVVTIVVSL
MEARRRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTLGDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAG********GSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCPLSP**************ACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTRERRIPPSSVEPLIKSTSDSGPDSGIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQSSNLTLS***************TADVVTIVVSL
****RRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGD****************GM******************GFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKANHP*SLSA*SDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCPLSPMCS*SEPPSPPRKEACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTRERRIPPSSV**********GPDSGIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSR***EKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQSSNLTLSFSS*SSL****K*ESTADVVTIVVSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEARRRFFTLSSFDRLLVVALSLVIVHITTVNAEVPDVRRLQRELKAHRPLYDKGDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTLGDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVHACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCICRDSVSWNIMIQGHLDHGTLGEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSVLSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDGQSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSEMPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMECKSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLCGRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVGTAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQPNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAIDLINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAGGLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLACLVTAEKTDTLLIKDVTSSERHSKEYCAMYDICGERSDGKVLNCPYGSPSVKPDELFSAKIESLCPSISGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFIGAGAKSFKEWFAFIGQKAPPGFPGSPYAINFKLSIPESSGLELMNVSTYSCGDTSLGCSCGDCPLSPMCSSSEPPSPPRKEACTIRIGSLKVKCVELSLVIAYVVLISTFFGWALFQRTRERRIPPSSVEPLIKSTSDSGPDSGIMEEVNARDLLPTEGGGLSVVQGYMLSFYRTYGRWVAANPAFVLCMSLAIGFVLCLGVIRFKVETRPEKLWVGPGSRAAGEKQFFDSHLAPFYRIEQLILATLPDPKNGKQPSIITEDNFQLLFEMQKKVDGVRANDSASLVSITDICLKPLGEDCASQSVLQYFKMDPENYDSYGGIEHAEYCFQHYASSDTCLSAFKAPLDPSTVLGGFSGNNYSEASAFIITYPVNNAIDETSKENRKAVAWEKAFIQLAKEELLPMVQSSNLTLSFSSESSLEEELKRESTADVVTIVVSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1991 2.2.26 [Sep-21-2011]
Q0WQD2680 Probable galacturonosyltr yes no 0.310 0.910 0.699 0.0
Q9SII7736 Pentatricopeptide repeat- no no 0.353 0.956 0.527 0.0
Q9LE59673 Polygalacturonate 4-alpha no no 0.290 0.860 0.579 0.0
Q93ZX7616 Probable galacturonosyltr no no 0.247 0.798 0.542 1e-165
Q9ZPZ1528 Putative galacturonosyltr no no 0.242 0.914 0.483 1e-140
Q949Q1537 Probable galacturonosyltr no no 0.225 0.834 0.497 1e-127
Q9LSG3559 Galacturonosyltransferase no no 0.209 0.745 0.502 1e-124
Q9SKT6536 Probable galacturonosyltr no no 0.221 0.822 0.491 1e-121
Q9FWA4561 Probable galacturonosyltr no no 0.192 0.682 0.555 1e-118
Q8RXE1610 Probable galacturonosyltr no no 0.212 0.693 0.431 1e-110
>sp|Q0WQD2|GAUT3_ARATH Probable galacturonosyltransferase 3 OS=Arabidopsis thaliana GN=GAUT3 PE=2 SV=2 Back     alignment and function desciption
 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/638 (69%), Positives = 509/638 (79%), Gaps = 19/638 (2%)

Query: 42  QRELKAHRPLYDK------GDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSA 95
            RELKA+RPL D          AA  + DPD+KD++I+ATYSD  G +R+ RVKM  LS 
Sbjct: 33  HRELKAYRPLQDNNLQEVYASSAAAVHYDPDLKDVNIVATYSDHYGNIRLGRVKMGDLSP 92

Query: 96  SWILENPADGDNGLPNSSQTL--GDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPL- 152
           SW+LENPA   +     SQ +   DSFQ    +E+N  +   +   E    F    P + 
Sbjct: 93  SWVLENPAYQVSRKTKGSQLVIPRDSFQNDTGMEDNASHSTTNQTDESENQF----PNVD 148

Query: 153 --SPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRD 210
             SP KLKRQ+LRQ+R   RT ELIRQ+ E D  MQE A ++S   E  V GKYSIWRRD
Sbjct: 149 FASPAKLKRQILRQERRGQRTLELIRQEKETDEQMQEAAIQKSMSFENSVIGKYSIWRRD 208

Query: 211 FESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELP 270
           +ESPN D+ LKLMRDQII+AKAYA++AKSKN ++LY  LM+ C E++R IG A SDA+LP
Sbjct: 209 YESPNADAILKLMRDQIIMAKAYANIAKSKNVTNLYVFLMQQCGENKRVIGKATSDADLP 268

Query: 271 SSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIV 330
           SSAL+QA+AMGH LS+AKD+LYDC  + +KFRA++QSTE  V  LK+K +FLIQLAAK  
Sbjct: 269 SSALDQAKAMGHALSLAKDELYDCHELAKKFRAILQSTERKVDGLKKKGTFLIQLAAKTF 328

Query: 331 PRPLHCLPLQLAADYYLQGHHK----KEEQINEKFEDPSLYHYAIFSDNVLATSVVVNST 386
           P+PLHCL LQLAADY++ G ++    KE+   +K EDPSLYHYAIFSDNVLATSVVVNST
Sbjct: 329 PKPLHCLSLQLAADYFILGFNEEDAVKEDVSQKKLEDPSLYHYAIFSDNVLATSVVVNST 388

Query: 387 VAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQL 446
           V +AKEP++HVFHIVTDKLNF AMKMWF +NAP  ATIQ+ENI+ FKWLNSSYCSVLRQL
Sbjct: 389 VLNAKEPQRHVFHIVTDKLNFGAMKMWFRINAPADATIQVENINDFKWLNSSYCSVLRQL 448

Query: 447 ESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDI 506
           ESARLKEYYFKANHPSS+SAG+DNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDI
Sbjct: 449 ESARLKEYYFKANHPSSISAGADNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDI 508

Query: 507 VVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNM 566
           VVQKDL PLW +D+ G VNGAVETCKESFHRFDKYLNFSNP ISENF   ACGWAFGMNM
Sbjct: 509 VVQKDLAPLWEIDMQGKVNGAVETCKESFHRFDKYLNFSNPKISENFDAGACGWAFGMNM 568

Query: 567 FDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDP 626
           FDLKEWRKRNITGIYHYWQD NEDRTLWKLG+LPPGLITFYNLTY +DRSWHVLGLGYDP
Sbjct: 569 FDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYAMDRSWHVLGLGYDP 628

Query: 627 ALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYV 664
           ALN T I+N AVVHYNGN KPWL LA +KYKPYWSKYV
Sbjct: 629 ALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYV 666




May be involved in pectin and/or xylans biosynthesis in cell walls.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protein At2g17210 OS=Arabidopsis thaliana GN=PCMP-E77 PE=2 SV=2 Back     alignment and function description
>sp|Q9LE59|GAUT1_ARATH Polygalacturonate 4-alpha-galacturonosyltransferase OS=Arabidopsis thaliana GN=GAUT1 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZX7|GAUT4_ARATH Probable galacturonosyltransferase 4 OS=Arabidopsis thaliana GN=GAUT4 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPZ1|GAUT2_ARATH Putative galacturonosyltransferase 2 OS=Arabidopsis thaliana GN=GAUT2 PE=5 SV=1 Back     alignment and function description
>sp|Q949Q1|GAUTB_ARATH Probable galacturonosyltransferase 11 OS=Arabidopsis thaliana GN=GAUT11 PE=2 SV=1 Back     alignment and function description
>sp|Q9LSG3|GAUT8_ARATH Galacturonosyltransferase 8 OS=Arabidopsis thaliana GN=GAUT8 PE=1 SV=1 Back     alignment and function description
>sp|Q9SKT6|GAUTA_ARATH Probable galacturonosyltransferase 10 OS=Arabidopsis thaliana GN=GAUT10 PE=2 SV=2 Back     alignment and function description
>sp|Q9FWA4|GAUT9_ARATH Probable galacturonosyltransferase 9 OS=Arabidopsis thaliana GN=GAUT9 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXE1|GAUT5_ARATH Probable galacturonosyltransferase 5 OS=Arabidopsis thaliana GN=GAUT5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1991
118488304749 unknown [Populus trichocarpa] 0.362 0.962 0.661 0.0
224132434749 predicted protein [Populus trichocarpa] 0.362 0.962 0.659 0.0
224132436655 glycosyltransferase, family GT8 [Populus 0.300 0.914 0.75 0.0
2977444842090 unnamed protein product [Vitis vinifera] 0.304 0.289 0.740 0.0
255586514642 Glycosyltransferase QUASIMODO1, putative 0.295 0.915 0.732 0.0
225428280742 PREDICTED: pentatricopeptide repeat-cont 0.362 0.971 0.636 0.0
449476532680 PREDICTED: probable galacturonosyltransf 0.323 0.948 0.686 0.0
449454412659 PREDICTED: probable galacturonosyltransf 0.306 0.927 0.724 0.0
3565534251328 PREDICTED: niemann-Pick C1 protein-like 0.294 0.441 0.732 0.0
297797812680 hypothetical protein ARALYDRAFT_912279 [ 0.311 0.913 0.701 0.0
>gi|118488304|gb|ABK95971.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/729 (66%), Positives = 580/729 (79%), Gaps = 8/729 (1%)

Query: 670  RLRTWNLRVKELSKNGKWQELFSHYHETKKVVVDLNDPSVYPLVVKACSNLSYIHGRLVH 729
            +L  W LR+KE S NGKWQE+ SHYHE KK  +   D SV+P ++KA S LS+ HG+ +H
Sbjct: 11   KLPNWILRIKESSANGKWQEVVSHYHEIKKAGIQTVDVSVFPPILKAWSFLSHRHGKSLH 70

Query: 730  ACLVKQGYESFTSIGNALMDFYMKWRFPDSAVAVFDDCI-CRDSVSWNIMIQGHLDHGTL 788
            ACL+KQG++SFTSIGN++M FY++    D AV VF+     RDSVSWNI+I GHLD+G L
Sbjct: 71   ACLIKQGFDSFTSIGNSIMGFYIRCGDFDIAVDVFNSMRRSRDSVSWNILIHGHLDNGAL 130

Query: 789  GEGLWWFYKARVAGFEPNNSILVLVIQACRCLGAYYEGLQVHGYIIRSGLWAVHSVQNSV 848
              GLWWF  ARVAGFEPN S +VLVIQACR LG  ++GL +HGY+I+SG WA+ SVQNS+
Sbjct: 131  VAGLWWFTNARVAGFEPNISTMVLVIQACRILGTKHDGLILHGYLIKSGFWAISSVQNSL 190

Query: 849  LSMYVDADMECARKLFDEMCERDVISWSVMIGGYVQSAEAFSGLRLFRQMVSGFKNEPDG 908
            LSMYVDADMECAR+LFDEM E+DVI+WSVMIGGY+Q  E   GL++FR+MV     EPDG
Sbjct: 191  LSMYVDADMECARELFDEMHEKDVIAWSVMIGGYLQWEEPQVGLQMFRKMVLVPGIEPDG 250

Query: 909  QSLVSVLKACTNLRDLTMGRMVHGLVIYRGLGCDLFVGNSLIDMYAKCKDTDSAFKVFSE 968
              +VSVLKAC + RD+  GR+VHGLVI+RG  CDLFV NSLIDMY+KCKD  SAFKVF+E
Sbjct: 251  VVMVSVLKACASSRDVCTGRLVHGLVIHRGFDCDLFVENSLIDMYSKCKDAGSAFKVFNE 310

Query: 969  MPQKNKVSWNSALSGLVVNEKYSEALSLLYSMGKGVNEVDEITLVNILQICKCFVHPMEC 1028
            + Q+N VSWNS LSG V+NE YSEA SL+ SM K   E DE+TLVNILQICK FVHP  C
Sbjct: 311  ISQRNNVSWNSMLSGFVLNENYSEAQSLISSMRKERVETDEVTLVNILQICKYFVHPFHC 370

Query: 1029 KSVHCVILRRAFESNELVLNSLIDGYSKCHLVELAWKLFNDVKKPDVVLWSTMIAGFTLC 1088
            KS+HCV++RR  E+NELVL++LID Y+KC+L+E+AW++F  +++ DVV WSTMI+GF  C
Sbjct: 371  KSIHCVMIRRGSEANELVLSALIDAYAKCYLIEIAWEVFARMRRRDVVSWSTMISGFAHC 430

Query: 1089 GRPREAIAVFQEMNQAQEKPNAITIINLLEACSVATELSSSKWAHGIAIRRCLAEEVAVG 1148
            G+P EAIAV+QEM++   KPN ITIINLLEACSV  EL  SKWAHG+AIR+  A EV VG
Sbjct: 431  GKPDEAIAVYQEMDRDLVKPNVITIINLLEACSVTAELKRSKWAHGVAIRQGFASEVTVG 490

Query: 1149 TAVVDMYAKCGAIEASRKAFDQISRKNIVSWSAMVAAYGMNGLAHEALALVAEMKLGGLQ 1208
            TAVVDMY+KCG I ASR+AFDQ++ KNIV+WSAM+AAYGMNGLAHEALAL AEMK  GL+
Sbjct: 491  TAVVDMYSKCGEILASRRAFDQLALKNIVTWSAMIAAYGMNGLAHEALALFAEMKRHGLK 550

Query: 1209 PNAVTTLSVLSACSHGGLVEEGLSFFNSMVQDHGVEPALEHYSCMVDMLARAGELDIAID 1268
            PN VTTLSVL+ACSHGGLVEEGLS F SMVQ+ G+EP  EHYSCMVDML RAG+LD AI+
Sbjct: 551  PNPVTTLSVLAACSHGGLVEEGLSLFKSMVQELGLEPGFEHYSCMVDMLGRAGKLDTAIE 610

Query: 1269 LINQMPDNLKATASAWGALLSACRSYGNTELGAGATSRILELEAQNSAGYLLASSMYAAG 1328
            +I  MPDNLK  AS WG+LLSACRSYG TELG  A SR+LELE  NSAGYL+ASSMYAA 
Sbjct: 611  VIKAMPDNLKNGASIWGSLLSACRSYGLTELGKEAISRVLELEPSNSAGYLVASSMYAAD 670

Query: 1329 GLWVESSGTRLLAKERGVKVVAGNSLVHVDNKACKFIAGEKAQSHPRGSEVILLA----- 1383
            GLW +++  R+LAKE+GVKVVAG SLVH+DNKAC+F+AG+   SHPR  E+  +A     
Sbjct: 671  GLWDDAARIRVLAKEKGVKVVAGYSLVHIDNKACRFVAGDG--SHPRSDEIFSMAQQLHD 728

Query: 1384 CLVTAEKTD 1392
            C+   EK +
Sbjct: 729  CIKIDEKKE 737




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224132434|ref|XP_002328268.1| predicted protein [Populus trichocarpa] gi|222837783|gb|EEE76148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132436|ref|XP_002328269.1| glycosyltransferase, family GT8 [Populus trichocarpa] gi|222837784|gb|EEE76149.1| glycosyltransferase, family GT8 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297744484|emb|CBI37746.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255586514|ref|XP_002533896.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis] gi|223526147|gb|EEF28486.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225428280|ref|XP_002279627.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17210-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449476532|ref|XP_004154763.1| PREDICTED: probable galacturonosyltransferase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449454412|ref|XP_004144949.1| PREDICTED: probable galacturonosyltransferase 3-like [Cucumis sativus] gi|449472530|ref|XP_004153622.1| PREDICTED: probable galacturonosyltransferase 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553425|ref|XP_003545057.1| PREDICTED: niemann-Pick C1 protein-like [Glycine max] Back     alignment and taxonomy information
>gi|297797812|ref|XP_002866790.1| hypothetical protein ARALYDRAFT_912279 [Arabidopsis lyrata subsp. lyrata] gi|297312626|gb|EFH43049.1| hypothetical protein ARALYDRAFT_912279 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1991
TAIR|locus:2121753680 GAUT3 "galacturonosyltransfera 0.322 0.945 0.678 2.3e-236
TAIR|locus:2035878 1272 AT1G42470 [Arabidopsis thalian 0.294 0.460 0.597 4.8e-197
TAIR|locus:2059687736 AT2G17210 [Arabidopsis thalian 0.353 0.956 0.527 5.7e-194
TAIR|locus:2098836673 GAUT1 "galacturonosyltransfera 0.293 0.869 0.585 2e-191
TAIR|locus:2160957616 GAUT4 "galacturonosyltransfera 0.248 0.801 0.544 2e-152
TAIR|locus:2039934528 GAUT2 "galacturonosyltransfera 0.184 0.696 0.466 3.2e-135
TAIR|locus:2074572561 GAUT9 "galacturonosyltransfera 0.191 0.679 0.558 5e-121
TAIR|locus:2051426536 GAUT10 "galacturonosyltransfer 0.220 0.820 0.498 9.5e-120
TAIR|locus:2027453537 GAUT11 "galacturonosyltransfer 0.225 0.834 0.502 1.5e-118
TAIR|locus:2090210559 QUA1 "QUASIMODO 1" [Arabidopsi 0.217 0.774 0.491 4e-115
TAIR|locus:2121753 GAUT3 "galacturonosyltransferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2279 (807.3 bits), Expect = 2.3e-236, P = 2.3e-236
 Identities = 446/657 (67%), Positives = 508/657 (77%)

Query:    21 LSLVIV-HITTVNAEVPDVRRLQRELKAHRPLYDKG------DGAARFNNXXXXXXXXXX 73
             LSLV+V H   V   + + +   RELKA+RPL D          AA  +           
Sbjct:    11 LSLVVVLHAVHVGGAILESQAPHRELKAYRPLQDNNLQEVYASSAAAVHYDPDLKDVNIV 70

Query:    74 ATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTL--GDSFQAGMNLEENVE 131
             ATYSD  G +R+ RVKM  LS SW+LENPA   +     SQ +   DSFQ    +E+N  
Sbjct:    71 ATYSDHYGNIRLGRVKMGDLSPSWVLENPAYQVSRKTKGSQLVIPRDSFQNDTGMEDNAS 130

Query:   132 YPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFE 191
             +   +   E    F       SP KLKRQ+LRQ+R   RT ELIRQ+ E D  MQE A +
Sbjct:   131 HSTTNQTDESENQFPNVDFA-SPAKLKRQILRQERRGQRTLELIRQEKETDEQMQEAAIQ 189

Query:   192 QSKRLEPRVTGKYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMK 251
             +S   E  V GKYSIWRRD+ESPN D+ LKLMRDQII+AKAYA++AKSKN ++LY  LM+
Sbjct:   190 KSMSFENSVIGKYSIWRRDYESPNADAILKLMRDQIIMAKAYANIAKSKNVTNLYVFLMQ 249

Query:   252 HCKESQRAIGDANSDAELPSSALNQAQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGT 311
              C E++R IG A SDA+LPSSAL+QA+AMGH LS+AKD+LYDC  + +KFRA++QSTE  
Sbjct:   250 QCGENKRVIGKATSDADLPSSALDQAKAMGHALSLAKDELYDCHELAKKFRAILQSTERK 309

Query:   312 VTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHK----KEEQINEKFEDPSLY 367
             V  LK+K +FLIQLAAK  P+PLHCL LQLAADY++ G ++    KE+   +K EDPSLY
Sbjct:   310 VDGLKKKGTFLIQLAAKTFPKPLHCLSLQLAADYFILGFNEEDAVKEDVSQKKLEDPSLY 369

Query:   368 HYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIE 427
             HYAIFSDNVLATSVVVNSTV +AKEP++HVFHIVTDKLNF AMKMWF +NAP  ATIQ+E
Sbjct:   370 HYAIFSDNVLATSVVVNSTVLNAKEPQRHVFHIVTDKLNFGAMKMWFRINAPADATIQVE 429

Query:   428 NIDSFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRF 487
             NI+ FKWLNSSYCSVLRQLESARLKEYYFKANHPSS+SAG+DNLKYRNPKYLSMLNHLRF
Sbjct:   430 NINDFKWLNSSYCSVLRQLESARLKEYYFKANHPSSISAGADNLKYRNPKYLSMLNHLRF 489

Query:   488 YLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAVETCKESFHRFDKYLNFSNP 547
             YLPEVYPKLEKILFLDDDIVVQKDL PLW +D+ G VNGAVETCKESFHRFDKYLNFSNP
Sbjct:   490 YLPEVYPKLEKILFLDDDIVVQKDLAPLWEIDMQGKVNGAVETCKESFHRFDKYLNFSNP 549

Query:   548 LISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFY 607
              ISENF   ACGWAFGMNMFDLKEWRKRNITGIYHYWQD NEDRTLWKLG+LPPGLITFY
Sbjct:   550 KISENFDAGACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPGLITFY 609

Query:   608 NLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYV 664
             NLTY +DRSWHVLGLGYDPALN T I+N AVVHYNGN KPWL LA +KYKPYWSKYV
Sbjct:   610 NLTYAMDRSWHVLGLGYDPALNQTAIENAAVVHYNGNYKPWLGLAFAKYKPYWSKYV 666




GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0016051 "carbohydrate biosynthetic process" evidence=ISS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=IEA;ISS
GO:0047262 "polygalacturonate 4-alpha-galacturonosyltransferase activity" evidence=ISS
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006259 "DNA metabolic process" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0008284 "positive regulation of cell proliferation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009933 "meristem structural organization" evidence=RCA
GO:0010162 "seed dormancy process" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0031048 "chromatin silencing by small RNA" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
GO:0051276 "chromosome organization" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2035878 AT1G42470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059687 AT2G17210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098836 GAUT1 "galacturonosyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160957 GAUT4 "galacturonosyltransferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039934 GAUT2 "galacturonosyltransferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074572 GAUT9 "galacturonosyltransferase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051426 GAUT10 "galacturonosyltransferase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027453 GAUT11 "galacturonosyltransferase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090210 QUA1 "QUASIMODO 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00660197
SubName- Full=Putative uncharacterized protein; (749 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1991
PLN02910657 PLN02910, PLN02910, polygalacturonate 4-alpha-gala 0.0
PLN02829639 PLN02829, PLN02829, Probable galacturonosyltransfe 0.0
PLN02742534 PLN02742, PLN02742, Probable galacturonosyltransfe 0.0
TIGR00917 1204 TIGR00917, 2A060601, Niemann-Pick C type protein f 0.0
PLN02523559 PLN02523, PLN02523, galacturonosyltransferase 1e-175
PLN02718603 PLN02718, PLN02718, Probable galacturonosyltransfe 1e-165
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-125
cd06429257 cd06429, GT8_like_1, GT8_like_1 represents a subfa 1e-118
PLN02870533 PLN02870, PLN02870, Probable galacturonosyltransfe 1e-116
PLN02769629 PLN02769, PLN02769, Probable galacturonosyltransfe 1e-116
PLN02659534 PLN02659, PLN02659, Probable galacturonosyltransfe 1e-104
PLN02867535 PLN02867, PLN02867, Probable galacturonosyltransfe 1e-92
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-87
pfam01501248 pfam01501, Glyco_transf_8, Glycosyl transferase fa 5e-68
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-26
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-20
cd04194248 cd04194, GT8_A4GalT_like, A4GalT_like proteins cat 1e-18
cd00505246 cd00505, Glyco_transf_8, Members of glycosyltransf 7e-15
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-13
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-11
COG1442325 COG1442, RfaJ, Lipopolysaccharide biosynthesis pro 1e-10
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.003
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.004
>gnl|CDD|215493 PLN02910, PLN02910, polygalacturonate 4-alpha-galacturonosyltransferase Back     alignment and domain information
 Score = 1138 bits (2945), Expect = 0.0
 Identities = 476/628 (75%), Positives = 531/628 (84%), Gaps = 9/628 (1%)

Query: 45  LKAHRPLYDKG------DGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWI 98
           L A+RPL D          AA   NDPD KDI+I+ATYSD SG +R+ RVKM  LSASW+
Sbjct: 17  LHAYRPLQDNNLDEVYASSAAGVGNDPDEKDINIVATYSDTSGNIRLGRVKMKDLSASWV 76

Query: 99  LENPADGDNGLPNSSQTL--GDSFQAGMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVK 156
           LENPAD  +  P  SQ L    SFQ G   E+NV +    +Q++E G     K P SPVK
Sbjct: 77  LENPADKVHDQPKGSQRLEDSSSFQNGTGEEDNVSH-STTNQTDESGIQFPNKLPASPVK 135

Query: 157 LKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTGKYSIWRRDFESPNT 216
           L+RQ+LRQ+R +LRTAELI+QD E D+  Q  A E+SK L+  V GKYSIWRRD+ESPN+
Sbjct: 136 LQRQILRQERRDLRTAELIQQDKEADSQTQAAAIERSKSLDTSVKGKYSIWRRDYESPNS 195

Query: 217 DSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQ 276
           DS LKLMRDQII+AKAYA++AKS N ++LY SLMK  +E++RAIG+A SDAEL SSAL+Q
Sbjct: 196 DSILKLMRDQIIMAKAYANIAKSNNVTNLYVSLMKQFRENKRAIGEATSDAELHSSALDQ 255

Query: 277 AQAMGHVLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHC 336
           A+AMGHVLSIAKDQLYDC T+ RK RAM+QSTE  V ALK+KS+FLIQLAAK VP+PLHC
Sbjct: 256 AKAMGHVLSIAKDQLYDCHTMARKLRAMLQSTERKVDALKKKSAFLIQLAAKTVPKPLHC 315

Query: 337 LPLQLAADYYLQGHHKKEEQINEKFEDPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKH 396
           LPLQLAADY+L G   K+    +K EDPSLYHYAIFSDNVLATSVVVNSTV HAKEP+KH
Sbjct: 316 LPLQLAADYFLLGFQNKDYVNKKKLEDPSLYHYAIFSDNVLATSVVVNSTVLHAKEPQKH 375

Query: 397 VFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLRQLESARLKEYYF 456
           VFHIVTDKLNF AMKMWF++N P KATIQ+ENID FKWLNSSYCSVLRQLESAR+KEYYF
Sbjct: 376 VFHIVTDKLNFAAMKMWFIINPPAKATIQVENIDDFKWLNSSYCSVLRQLESARIKEYYF 435

Query: 457 KANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLW 516
           KANHPSSLSAG+DNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLW
Sbjct: 436 KANHPSSLSAGADNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLW 495

Query: 517 SVDLHGMVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRN 576
           S+D+ GMVNGAVETCKESFHRFDKYLNFSNP ISENF PNACGWAFGMNMFDLKEWRKRN
Sbjct: 496 SIDMQGMVNGAVETCKESFHRFDKYLNFSNPKISENFDPNACGWAFGMNMFDLKEWRKRN 555

Query: 577 ITGIYHYWQDANEDRTLWKLGTLPPGLITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNG 636
           ITGIYHYWQD NEDRTLWKLG+LPPGLITFYNLTYPLDRSWHVLGLGYDPALN T+I+N 
Sbjct: 556 ITGIYHYWQDLNEDRTLWKLGSLPPGLITFYNLTYPLDRSWHVLGLGYDPALNQTEIENA 615

Query: 637 AVVHYNGNNKPWLDLAVSKYKPYWSKYV 664
           AVVHYNGN KPWLDLA++KYKPYWS+YV
Sbjct: 616 AVVHYNGNYKPWLDLAIAKYKPYWSRYV 643


Length = 657

>gnl|CDD|215443 PLN02829, PLN02829, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|215395 PLN02742, PLN02742, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|233184 TIGR00917, 2A060601, Niemann-Pick C type protein family Back     alignment and domain information
>gnl|CDD|215286 PLN02523, PLN02523, galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|178320 PLN02718, PLN02718, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|133051 cd06429, GT8_like_1, GT8_like_1 represents a subfamily of GT8 with unknown function Back     alignment and domain information
>gnl|CDD|215468 PLN02870, PLN02870, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|215412 PLN02769, PLN02769, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|215356 PLN02659, PLN02659, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|178458 PLN02867, PLN02867, Probable galacturonosyltransferase Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|216536 pfam01501, Glyco_transf_8, Glycosyl transferase family 8 Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|133037 cd04194, GT8_A4GalT_like, A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface Back     alignment and domain information
>gnl|CDD|132996 cd00505, Glyco_transf_8, Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|224359 COG1442, RfaJ, Lipopolysaccharide biosynthesis proteins, LPS:glycosyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1991
PLN02910657 polygalacturonate 4-alpha-galacturonosyltransferas 100.0
PLN02829639 Probable galacturonosyltransferase 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN02769629 Probable galacturonosyltransferase 100.0
PLN02742534 Probable galacturonosyltransferase 100.0
TIGR00917 1204 2A060601 Niemann-Pick C type protein family. The m 100.0
PLN02718603 Probable galacturonosyltransferase 100.0
PLN02523559 galacturonosyltransferase 100.0
PLN02870533 Probable galacturonosyltransferase 100.0
PLN02867535 Probable galacturonosyltransferase 100.0
PLN02659534 Probable galacturonosyltransferase 100.0
KOG1933 1201 consensus Cholesterol transport protein (Niemann-P 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
cd06429257 GT8_like_1 GT8_like_1 represents a subfamily of GT 100.0
TIGR00918 1145 2A060602 The Eukaryotic (Putative) Sterol Transpor 100.0
PRK15171334 lipopolysaccharide 1,3-galactosyltransferase; Prov 100.0
cd06431280 GT8_LARGE_C LARGE catalytic domain has closest hom 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
COG1442325 RfaJ Lipopolysaccharide biosynthesis proteins, LPS 100.0
cd00505246 Glyco_transf_8 Members of glycosyltransferase fami 99.98
cd04194248 GT8_A4GalT_like A4GalT_like proteins catalyze the 99.97
cd06430304 GT8_like_2 GT8_like_2 represents a subfamily of GT 99.97
PF01501250 Glyco_transf_8: Glycosyl transferase family 8; Int 99.95
cd06432248 GT8_HUGT1_C_like The C-terminal domain of HUGT1-li 99.95
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.9
PRK114471157 cellulose synthase subunit BcsC; Provisional 99.89
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.86
KOG1934 868 consensus Predicted membrane protein (patched supe 99.85
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.83
cd02537240 GT8_Glycogenin Glycogenin belongs the GT 8 family 99.83
PLN00176333 galactinol synthase 99.8
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.72
PRK11788389 tetratricopeptide repeat protein; Provisional 99.66
PRK11788389 tetratricopeptide repeat protein; Provisional 99.65
PF02460 798 Patched: Patched family; InterPro: IPR003392 The t 99.65
KOG4626966 consensus O-linked N-acetylglucosamine transferase 99.62
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.61
cd06914278 GT8_GNT1 GNT1 is a fungal enzyme that belongs to t 99.61
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.59
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.58
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.57
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.56
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.55
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.53
PRK14574822 hmsH outer membrane protein; Provisional 99.53
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.52
PRK14574822 hmsH outer membrane protein; Provisional 99.5
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.46
KOG18791470 consensus UDP-glucose:glycoprotein glucosyltransfe 99.45
KOG43181088 consensus Bicoid mRNA stability factor [RNA proces 99.44
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.41
KOG2076895 consensus RNA polymerase III transcription factor 99.39
KOG1935 1143 consensus Membrane protein Patched/PTCH [Signal tr 99.38
KOG2076895 consensus RNA polymerase III transcription factor 99.35
KOG43181088 consensus Bicoid mRNA stability factor [RNA proces 99.32
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.28
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.19
KOG2003840 consensus TPR repeat-containing protein [General f 99.08
KOG1915677 consensus Cell cycle control protein (crooked neck 99.06
KOG1126638 consensus DNA-binding cell division cycle control 99.02
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.02
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.01
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.99
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.99
KOG2003840 consensus TPR repeat-containing protein [General f 98.99
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.98
KOG1126638 consensus DNA-binding cell division cycle control 98.95
KOG1915677 consensus Cell cycle control protein (crooked neck 98.92
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.91
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.9
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.81
PF1304150 PPR_2: PPR repeat family 98.81
KOG0547606 consensus Translocase of outer mitochondrial membr 98.79
PF1304150 PPR_2: PPR repeat family 98.77
KOG2047835 consensus mRNA splicing factor [RNA processing and 98.74
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.74
KOG36161636 consensus Selective LIM binding factor [Transcript 98.74
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.69
KOG2376652 consensus Signal recognition particle, subunit Srp 98.66
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.64
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.63
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.62
PRK12370553 invasion protein regulator; Provisional 98.62
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.62
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.61
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.58
KOG0547606 consensus Translocase of outer mitochondrial membr 98.55
KOG36161636 consensus Selective LIM binding factor [Transcript 98.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.55
PRK12370553 invasion protein regulator; Provisional 98.55
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.54
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.54
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.53
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.46
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.44
PRK11189296 lipoprotein NlpI; Provisional 98.42
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.42
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.42
KOG2376652 consensus Signal recognition particle, subunit Srp 98.39
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.31
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.3
PRK11189296 lipoprotein NlpI; Provisional 98.3
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.26
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.25
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.24
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.24
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.22
KOG1129478 consensus TPR repeat-containing protein [General f 98.22
KOG1129478 consensus TPR repeat-containing protein [General f 98.16
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.16
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.11
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.04
PRK04841903 transcriptional regulator MalT; Provisional 98.04
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.02
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.02
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.97
PRK15359144 type III secretion system chaperone protein SscB; 97.96
KOG1125579 consensus TPR repeat-containing protein [General f 97.9
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.88
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.84
PRK10370198 formate-dependent nitrite reductase complex subuni 97.78
PLN02789320 farnesyltranstransferase 97.77
PRK10370198 formate-dependent nitrite reductase complex subuni 97.77
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.75
PF1285434 PPR_1: PPR repeat 97.7
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 97.7
KOG1128777 consensus Uncharacterized conserved protein, conta 97.7
PF1285434 PPR_1: PPR repeat 97.69
PRK15359144 type III secretion system chaperone protein SscB; 97.63
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.63
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.59
PLN02789320 farnesyltranstransferase 97.55
PRK04841903 transcriptional regulator MalT; Provisional 97.53
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.53
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.5
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.48
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.43
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.42
KOG2053932 consensus Mitochondrial inheritance and actin cyto 97.39
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.36
KOG1128777 consensus Uncharacterized conserved protein, conta 97.34
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.3
PRK14720906 transcript cleavage factor/unknown domain fusion p 97.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.28
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.26
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.25
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.25
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.24
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.23
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.21
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.17
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.17
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.06
KOG1125579 consensus TPR repeat-containing protein [General f 97.02
KOG0553304 consensus TPR repeat-containing protein [General f 97.0
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.0
PF1381234 PPR_3: Pentatricopeptide repeat domain 96.97
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.93
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.84
KOG3060289 consensus Uncharacterized conserved protein [Funct 96.84
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.84
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.78
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.75
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.63
TIGR00921719 2A067 The (Largely Archaeal Putative) Hydrophobe/A 96.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.55
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 96.54
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 96.53
KOG1914656 consensus mRNA cleavage and polyadenylation factor 96.52
KOG20411189 consensus WD40 repeat protein [General function pr 96.48
KOG2053932 consensus Mitochondrial inheritance and actin cyto 96.48
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.47
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.43
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.41
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.37
COG5597368 Alpha-N-acetylglucosamine transferase [Cell envelo 96.36
PRK14720906 transcript cleavage factor/unknown domain fusion p 96.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.36
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.34
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.3
COG1033 727 Predicted exporters of the RND superfamily [Genera 96.21
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.09
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.96
COG1033727 Predicted exporters of the RND superfamily [Genera 95.95
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.95
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.8
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.74
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.71
KOG0553304 consensus TPR repeat-containing protein [General f 95.61
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.55
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.53
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.47
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 95.37
TIGR00833 910 actII Transport protein. Characterized members of 95.29
TIGR00921 719 2A067 The (Largely Archaeal Putative) Hydrophobe/A 95.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 95.13
PF1337173 TPR_9: Tetratricopeptide repeat 95.04
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.0
PF1343134 TPR_17: Tetratricopeptide repeat 94.87
KOG20411189 consensus WD40 repeat protein [General function pr 94.84
COG4700251 Uncharacterized protein conserved in bacteria cont 94.84
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.81
COG3898531 Uncharacterized membrane-bound protein [Function u 94.77
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.67
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 94.52
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.47
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.46
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 94.44
PF06239228 ECSIT: Evolutionarily conserved signalling interme 94.37
PF03024167 Folate_rec: Folate receptor family; InterPro: IPR0 94.36
PLN03182429 xyloglucan 6-xylosyltransferase; Provisional 94.32
PRK15331165 chaperone protein SicA; Provisional 94.31
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.21
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 94.12
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 94.06
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.06
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 94.05
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 93.92
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.88
PF06239228 ECSIT: Evolutionarily conserved signalling interme 93.88
PF1337173 TPR_9: Tetratricopeptide repeat 93.81
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 93.78
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.66
PF12688120 TPR_5: Tetratrico peptide repeat 93.62
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 93.58
PF12688120 TPR_5: Tetratrico peptide repeat 93.57
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 93.38
PF1342844 TPR_14: Tetratricopeptide repeat 93.27
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.21
PRK10803263 tol-pal system protein YbgF; Provisional 93.13
KOG15381081 consensus Uncharacterized conserved protein WDR10, 92.92
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 92.91
PRK10803263 tol-pal system protein YbgF; Provisional 92.88
COG0457291 NrfG FOG: TPR repeat [General function prediction 92.58
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.11
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.01
PRK11906458 transcriptional regulator; Provisional 91.91
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 91.89
KOG4555175 consensus TPR repeat-containing protein [Function 91.12
PRK11906458 transcriptional regulator; Provisional 90.71
COG4700251 Uncharacterized protein conserved in bacteria cont 90.63
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 90.26
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 90.11
COG3898531 Uncharacterized membrane-bound protein [Function u 89.88
KOG3941406 consensus Intermediate in Toll signal transduction 89.71
PF02460 798 Patched: Patched family; InterPro: IPR003392 The t 89.68
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.56
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 89.24
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 89.18
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 89.12
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 88.96
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.87
COG4235287 Cytochrome c biogenesis factor [Posttranslational 88.47
smart00299140 CLH Clathrin heavy chain repeat homology. 88.09
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 87.68
KOG1258577 consensus mRNA processing protein [RNA processing 87.49
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 87.47
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 87.27
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 87.22
PF03407212 Nucleotid_trans: Nucleotide-diphospho-sugar transf 86.81
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 86.63
PF03704146 BTAD: Bacterial transcriptional activator domain; 86.56
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 86.02
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 85.24
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.18
PF05637239 Glyco_transf_34: galactosyl transferase GMA12/MNN1 85.12
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.7
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 83.98
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 83.92
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 83.54
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 83.3
COG4105254 ComL DNA uptake lipoprotein [General function pred 82.62
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 82.08
smart00299140 CLH Clathrin heavy chain repeat homology. 81.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 81.69
KOG3941406 consensus Intermediate in Toll signal transduction 81.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 81.41
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 81.34
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 80.71
PRK09687280 putative lyase; Provisional 80.36
KOG4555175 consensus TPR repeat-containing protein [Function 80.32
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 80.06
>PLN02910 polygalacturonate 4-alpha-galacturonosyltransferase Back     alignment and domain information
Probab=100.00  E-value=1.2e-149  Score=1347.34  Aligned_cols=631  Identities=75%  Similarity=1.181  Sum_probs=608.0

Q ss_pred             hhcCCCCcC-CCCCCCCCCCCCccchhhheeeccccccEEEeeeeccCCcccceecCCCCCCCCCCCCcccc--chhhhc
Q 040435           46 KAHRPLYDK-GDGAARFNNDPDIKDIDIIATYSDVSGAVRISRVKMSHLSASWILENPADGDNGLPNSSQTL--GDSFQA  122 (1991)
Q Consensus        46 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~  122 (1991)
                      ++|++++++ +++++++|+++|+++|||++||||++|+||+++|++++|++||+||||+++++++|+++|++  ++.++.
T Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  102 (657)
T PLN02910         23 LQDNNLDEVYASSAAGVGNDPDEKDINIVATYSDTSGNIRLGRVKMKDLSASWVLENPADKVHDQPKGSQRLEDSSSFQN  102 (657)
T ss_pred             cccccccccccccCcccCCCccccchhhheeeecccccEEEEeeeeccccchhhhcCccccccCcccccccccchhhhcc
Confidence            678888888 69999999999999999999999999999999999999999999999999999999999999  344555


Q ss_pred             ccCcccccCCCCCCCCCccccccCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHhhccchhhhhhHHHHHhhhccCccccc
Q 040435          123 GMNLEENVEYPMGDHQSEEVGFFNRQKPPLSPVKLKRQMLRQKRMELRTAELIRQDNENDNIMQETAFEQSKRLEPRVTG  202 (1991)
Q Consensus       123 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  202 (1991)
                      +.+.++.++++ +++|++|+|++++++.+++|+||+||++||+|++.|++||+|||+|++.++|++||||||++|++++|
T Consensus       103 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~sk~~d~~~~g  181 (657)
T PLN02910        103 GTGEEDNVSHS-TTNQTDESGIQFPNKLPASPVKLQRQILRQERRDLRTAELIQQDKEADSQTQAAAIERSKSLDTSVKG  181 (657)
T ss_pred             Ccccccchhhh-hhhccccccccCcccCCCCHHHHHHHHHHHHHHHHHHHHHHhccHHHHHhhhHHHhhhhhccCccccc
Confidence            55555555555 58899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhccccccCCCChhHHHHHHHHHHHHHHHHHHHHHhcCccchHHHHHHHHHHhhhhhcccCCCCCCCchHHHHHHHHHH
Q 040435          203 KYSIWRRDFESPNTDSTLKLMRDQIILAKAYAHVAKSKNESSLYNSLMKHCKESQRAIGDANSDAELPSSALNQAQAMGH  282 (1991)
Q Consensus       203 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  282 (1991)
                      ||||||+||+++++|+++|+|||||||||||++|||.+|+.+|++||+++|||+||+||+|+.|++||+++++++|+|++
T Consensus       182 ~y~~w~~e~~~~~~d~~vk~lkDQl~~AkaY~~iak~~~~~~l~~eL~~~i~e~~r~ls~a~~d~dlp~~~~~k~~~M~~  261 (657)
T PLN02910        182 KYSIWRRDYESPNSDSILKLMRDQIIMAKAYANIAKSNNVTNLYVSLMKQFRENKRAIGEATSDAELHSSALDQAKAMGH  261 (657)
T ss_pred             ceeeecccccccCcHHHHHHHHHHHHHHHHHHHHhccCCcHHHHHHHHHHHHHHHHHHhhcccccccCchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhccCChhHHHHHHHHHHHHhHHHHHHHHhhhHHHHHHhhccCCCccccchhhhhHHHhhcCCCCcccccCCCCC
Q 040435          283 VLSIAKDQLYDCPTVQRKFRAMIQSTEGTVTALKRKSSFLIQLAAKIVPRPLHCLPLQLAADYYLQGHHKKEEQINEKFE  362 (1991)
Q Consensus       283 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~cl~~~l~~~~~~~~~~~~~~~~~~~~~  362 (1991)
                      +|++||+.+|||+++++|||+||+++||+++++|+|++|++||||+|||||||||+||||.|||.++.+.++.|++++++
T Consensus       262 ~l~~ak~~~~d~~~~~~KLraml~~~Ee~~~~~k~qs~~l~qlaa~t~PK~lHCL~mRLt~Ey~~~~~~~~~~p~~~~l~  341 (657)
T PLN02910        262 VLSIAKDQLYDCHTMARKLRAMLQSTERKVDALKKKSAFLIQLAAKTVPKPLHCLPLQLAADYFLLGFQNKDYVNKKKLE  341 (657)
T ss_pred             HHHHHHhcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCCccccchhhHHHHHhCchhhccCCChhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999888888999999


Q ss_pred             CCCcceEEEEcccchhhHHHHHHHhhhcCCCCcEEEEEEcCcchHHHHHHHHHhcCCCCcceeeeccchhhhhhhhhhhH
Q 040435          363 DPSLYHYAIFSDNVLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSV  442 (1991)
Q Consensus       363 ~~~~~hi~~~~Dn~~~~~v~i~Sil~~~~~~~~~~Fhivtd~~~~~~~~~~f~~~~~~~~~~~~~~~~~f~~l~~~~~~~  442 (1991)
                      ||+++|||++||||+|+||||+|++.|+++|+++|||||||++|+.+|++||..||+++++|+|+++|+|+|++.+|+++
T Consensus       342 dp~l~Hy~ifSDNVLAaSVVVnSTv~na~~P~k~VFHiVTD~~ny~aM~~WF~~n~~~~A~V~V~nie~f~wln~~~~pv  421 (657)
T PLN02910        342 DPSLYHYAIFSDNVLATSVVVNSTVLHAKEPQKHVFHIVTDKLNFAAMKMWFIINPPAKATIQVENIDDFKWLNSSYCSV  421 (657)
T ss_pred             CCcceeEEEEecceeeEEeehhhhhhcccCccceEEEEecCccccHHHHHHHhhCCCccceEEEeehhhcccccccccHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhccceEEEecCCCCCCCcCCcCCcccCCCCcchhhhHHHHhhcccccCCCeEEEeeCCEeEecCCchhhccCCCC
Q 040435          443 LRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHG  522 (1991)
Q Consensus       443 l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~y~Rl~ip~llp~~dkvLyLD~Divv~~dl~~L~~~dl~~  522 (1991)
                      ++|+++.....|||..+..........+.++++|+|+|+++|+|||||++||+++||||||+|+||++||++||++||+|
T Consensus       422 l~qles~~~~~~yf~~~~~~~~~~~~~~~k~r~p~ylS~lnY~Rf~LPelLp~l~KVLYLD~DVVV~gDLseLw~iDL~g  501 (657)
T PLN02910        422 LRQLESARIKEYYFKANHPSSLSAGADNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSIDMQG  501 (657)
T ss_pred             HHHHhhhhhhhhhhhccccccccccccccccCCcchhhHHHHHHHHHHHHhhhcCeEEEEeCCEEecCchHHHHhCCcCC
Confidence            99999999999999987776666667799999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEeeccchhhhccccccccCCCccccCCCCCCCcccccceeEeehHHHHHhhHHHHHHHHHHhchhccccccCCCCch
Q 040435          523 MVNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPG  602 (1991)
Q Consensus       523 ~~~aaV~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~yfNsGVll~nl~~wR~~~~~~~~~~~~~~~~~~~~~~~~dqd~~  602 (1991)
                      +++|||++|...++++..+++|++|.+..+|++..||||+|||+|||++||++++|+.++.|++.+.+..+|+++.++++
T Consensus       502 ~v~AAVedc~~~f~r~~~ylnfs~P~i~~yFNs~aCyfNsGVmVIDL~~WRe~nITe~ye~w~eln~~~~L~dqgsLPpg  581 (657)
T PLN02910        502 MVNGAVETCKESFHRFDKYLNFSNPKISENFDPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDLNEDRTLWKLGSLPPG  581 (657)
T ss_pred             ceEEEecccchhhhhhhhhhccCChhhhhccCCCCceeecccEEEeHHHHHHhhHHHHHHHHHHhcccccccccCCCChH
Confidence            99999999999888999999999999988999999999999999999999999999999999999888888999999999


Q ss_pred             hhhhccccccccccccccccCCCccccccccCCceEeecccCCCccccccccccccccchhhhhhhhhccccccc
Q 040435          603 LITFYNLTYPLDRSWHVLGLGYDPALNLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILWSLRLRTWNLR  677 (1991)
Q Consensus       603 n~~f~~~~~~L~~~wN~~~~~~~~~~~~~~~~n~~IiHY~g~~KPW~~~a~~~~~~~W~~yv~~d~p~l~~cn~l  677 (1991)
                      .++|++++++||.+||++|+||++......+++++||||+|+.|||.+.+..+|+++|.||++.|+||++.||+.
T Consensus       582 LLvF~g~i~pLD~rWNv~GLGyd~~v~~~~i~~AAVLHynG~~KPWl~l~i~~Yr~~W~kYl~~d~~fl~~Cni~  656 (657)
T PLN02910        582 LITFYNLTYPLDRSWHVLGLGYDPALNQTEIENAAVVHYNGNYKPWLDLAIAKYKPYWSRYVQYDNPYLQLCNIS  656 (657)
T ss_pred             HHHHhCceeecCchheecCCCCCcccccccccCcEEEEeCCCCCcccccCcccchHHHHHHccCCChHHHhCCCC
Confidence            999999999999999999999999988888999999999999999999999999999999999999999999974



>PLN02829 Probable galacturonosyltransferase Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN02769 Probable galacturonosyltransferase Back     alignment and domain information
>PLN02742 Probable galacturonosyltransferase Back     alignment and domain information
>TIGR00917 2A060601 Niemann-Pick C type protein family Back     alignment and domain information
>PLN02718 Probable galacturonosyltransferase Back     alignment and domain information
>PLN02523 galacturonosyltransferase Back     alignment and domain information
>PLN02870 Probable galacturonosyltransferase Back     alignment and domain information
>PLN02867 Probable galacturonosyltransferase Back     alignment and domain information
>PLN02659 Probable galacturonosyltransferase Back     alignment and domain information
>KOG1933 consensus Cholesterol transport protein (Niemann-Pick C disease protein) [Lipid transport and metabolism] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>cd06429 GT8_like_1 GT8_like_1 represents a subfamily of GT8 with unknown function Back     alignment and domain information
>TIGR00918 2A060602 The Eukaryotic (Putative) Sterol Transporter (EST) Family Back     alignment and domain information
>PRK15171 lipopolysaccharide 1,3-galactosyltransferase; Provisional Back     alignment and domain information
>cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG1442 RfaJ Lipopolysaccharide biosynthesis proteins, LPS:glycosyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis Back     alignment and domain information
>cd04194 GT8_A4GalT_like A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface Back     alignment and domain information
>cd06430 GT8_like_2 GT8_like_2 represents a subfamily of GT8 with unknown function Back     alignment and domain information
>PF01501 Glyco_transf_8: Glycosyl transferase family 8; InterPro: IPR002495 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd06432 GT8_HUGT1_C_like The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1934 consensus Predicted membrane protein (patched superfamily) [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>cd02537 GT8_Glycogenin Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen Back     alignment and domain information
>PLN00176 galactinol synthase Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF02460 Patched: Patched family; InterPro: IPR003392 The transmembrane protein, patched, is a receptor for the morphogene Sonic Hedgehog Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd06914 GT8_GNT1 GNT1 is a fungal enzyme that belongs to the GT 8 family Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1879 consensus UDP-glucose:glycoprotein glucosyltransferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1935 consensus Membrane protein Patched/PTCH [Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR00921 2A067 The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG5597 Alpha-N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG1033 Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG1033 Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR00833 actII Transport protein Back     alignment and domain information
>TIGR00921 2A067 The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF03024 Folate_rec: Folate receptor family; InterPro: IPR018143 This entry represents a domain found in folate receptors and at the N terminus of hedgehog-interacting proteins Back     alignment and domain information
>PLN03182 xyloglucan 6-xylosyltransferase; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF02460 Patched: Patched family; InterPro: IPR003392 The transmembrane protein, patched, is a receptor for the morphogene Sonic Hedgehog Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF03407 Nucleotid_trans: Nucleotide-diphospho-sugar transferase; InterPro: IPR005069 Proteins in this family have been been predicted to be nucleotide-diphospho-sugar transferases [] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05637 Glyco_transf_34: galactosyl transferase GMA12/MNN10 family; InterPro: IPR008630 This family contains a number of glycosyltransferase enzymes that contain a DXD motif Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1991
3gkh_A232 Npc1(ntd) Length = 232 7e-23
3qnt_A265 Npc1l1 (Ntd) Structure Length = 265 5e-19
1g9r_A311 Crystal Structure Of Galactosyltransferase Lgtc In 5e-05
1ss9_A311 Crystal Structural Analysis Of Active Site Mutant Q 8e-05
>pdb|3GKH|A Chain A, Npc1(ntd) Length = 232 Back     alignment and structure

Iteration: 1

Score = 107 bits (267), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 73/223 (32%), Positives = 108/223 (48%), Gaps = 21/223 (9%) Query: 1410 CAMYDICGERSDGKVLNCPY-GSPSVKPDELFSAKIESLCPSI---SGNVCCTETQFETL 1465 C Y CG K NC Y G P P + + ++ LCP ++CC Q +TL Sbjct: 5 CVWYGECGIAYGDKRYNCEYSGPPKPLPKDGYDL-VQELCPGFFFGQVSLCCDVRQLQTL 63 Query: 1466 RAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVNGNLT------VDG 1519 + +Q + FL CP+C N LNLFCEL+CSP QSQF+ VT+ + +T V Sbjct: 64 KDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLQVTATEDYVDPVTNQTKTNVKE 123 Query: 1520 IDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFI---GAGAKSFKEWFAFIGQKAPPGFPG 1576 + YYV +F +YN+C+DV+ + N +A+ + A A W ++ K Sbjct: 124 LQYYVGQSFANAMYNACRDVEAPSSNDKALGLLCGKDADACQATNWIEYMFNK---DNGQ 180 Query: 1577 SPYAINFKLSIPESSGLELMNVSTYSCGDT----SLGCSCGDC 1615 +P+ I S G+E MN +T C ++ + CSC DC Sbjct: 181 APFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDC 223
>pdb|3QNT|A Chain A, Npc1l1 (Ntd) Structure Length = 265 Back     alignment and structure
>pdb|1G9R|A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose Length = 311 Back     alignment and structure
>pdb|1SS9|A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1991
3qnt_A265 Niemann-PICK C1-like protein 1; cholesterol transp 2e-78
3gkj_A232 Niemann-PICK C1 protein; oxysterol, cholesterol, c 1e-76
1g9r_A311 Glycosyl transferase; alpha-beta structure; HET: U 7e-62
3tzt_A276 Glycosyl transferase family 8; structural genomics 4e-24
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-16
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3spa_A1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-06
3spa_A1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-05
1ll2_A333 Glycogenin-1; protein-substrate complex, beta-alph 8e-04
>3qnt_A Niemann-PICK C1-like protein 1; cholesterol transport protein, transport protein; HET: NAG; 2.83A {Homo sapiens} Length = 265 Back     alignment and structure
 Score =  259 bits (662), Expect = 2e-78
 Identities = 72/260 (27%), Positives = 109/260 (41%), Gaps = 30/260 (11%)

Query: 1402 SERHSKEYCAMYDICGERSD-------GKVLNCPYGSPSVKPDELFSAKIESLCPSI--- 1451
            +  H   YCA YD CG+  +          ++C   +P+ K        ++ +CP +   
Sbjct: 6    TTIHQPGYCAFYDECGKNPELSGSLMTLSNVSCLSNTPARKITGDHLILLQKICPRLYTG 65

Query: 1452 -SGNVCCTETQFETLRAQVQQAIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSE 1510
             +   CC+  Q  +L A +      L  CPAC  NF+NL C  +CSPNQS FINVT V++
Sbjct: 66   PNTQACCSAKQLVSLEASLSITKALLTRCPACSDNFVNLHCHNTCSPNQSLFINVTRVAQ 125

Query: 1511 VNGN--LTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAIDFI----GAGAKSFKEWFA 1564
            +       V   + +   +F E+ Y+SC  V+     T A+  +    G+   + + W  
Sbjct: 126  LGAGQLPAVVAYEAFYQHSFAEQSYDSCSRVRVPAAATLAVGTMCGVYGSALCNAQRWLN 185

Query: 1565 FIGQKAPPGFPGSPYAINFKLSIP---ESSGLELMNVSTYSC----GDTSLGCSCGDCPL 1617
            F G         +P  I F L  P     SG++ +N     C    GD    CSC DC  
Sbjct: 186  FQGDTGN---GLAPLDITFHLLEPGQAVGSGIQPLNEGVARCNESQGDDVATCSCQDCAA 242

Query: 1618 SPMCSSSEPPSPPRKEACTI 1637
            S  C +   P         +
Sbjct: 243  S--CPAIARP-QALDSTFYL 259


>3gkj_A Niemann-PICK C1 protein; oxysterol, cholesterol, cholesterol transfer, disease mutati endosome, glycoprotein, lysosome, membrane, transmembrane; HET: NAG HC3; 1.60A {Homo sapiens} PDB: 3gkh_A* 3gki_A* Length = 232 Back     alignment and structure
>1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* Length = 311 Back     alignment and structure
>3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* Length = 333 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1991
3qnt_A265 Niemann-PICK C1-like protein 1; cholesterol transp 100.0
3gkj_A232 Niemann-PICK C1 protein; oxysterol, cholesterol, c 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3tzt_A276 Glycosyl transferase family 8; structural genomics 100.0
1g9r_A311 Glycosyl transferase; alpha-beta structure; HET: U 99.98
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.89
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.88
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.85
1ll2_A333 Glycogenin-1; protein-substrate complex, beta-alph 99.83
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.82
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.8
3u2u_A263 Glycogenin-1, GN-1, GN1; structural genomics, stru 99.8
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.77
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.73
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.72
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.71
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.67
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.63
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.6
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.6
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.54
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.53
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.51
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.51
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.5
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.49
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.49
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.47
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.45
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.44
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.41
3spa_A1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.41
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.4
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.39
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.38
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.34
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.33
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.32
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.3
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.27
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.18
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.18
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.17
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.16
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.14
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.12
3u4t_A272 TPR repeat-containing protein; structural genomics 99.12
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.06
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.05
3u4t_A272 TPR repeat-containing protein; structural genomics 99.03
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.02
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.02
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.01
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.01
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.99
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.98
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.98
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.97
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.96
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.92
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.91
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.9
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.89
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.87
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.86
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.86
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.86
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.83
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.79
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.74
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.73
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.68
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.67
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.67
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.63
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.62
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.52
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.51
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.5
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.41
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.41
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.4
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.39
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.39
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.38
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.37
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.31
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.28
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.25
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.2
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.19
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.17
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.17
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.16
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.15
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.13
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.11
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.1
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.0
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.99
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 97.98
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.98
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.97
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.97
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.96
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.96
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 97.93
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.93
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.92
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.92
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.92
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.9
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.89
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.8
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.8
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.8
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.79
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.78
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.76
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.74
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.74
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.72
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 97.71
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.69
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.69
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.66
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.65
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.65
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 97.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.61
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.61
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.6
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.56
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.54
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.53
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.52
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.52
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.51
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.47
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.43
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.42
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.4
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.37
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.37
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.33
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.31
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.31
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.31
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.31
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.28
3k9i_A117 BH0479 protein; putative protein binding protein, 97.28
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.25
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.24
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.24
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.2
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.16
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.15
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.15
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.12
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.1
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.02
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.02
3k9i_A117 BH0479 protein; putative protein binding protein, 97.0
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.9
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.87
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 96.83
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.59
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.45
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.37
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.28
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.19
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.13
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.1
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.85
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.7
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.55
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.0
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.0
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.95
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.94
3qww_A433 SET and MYND domain-containing protein 2; methyltr 94.65
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.51
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.27
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.63
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.43
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.35
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 93.25
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 93.16
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 92.78
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 91.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 89.98
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 88.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 87.81
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 85.77
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 83.99
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 83.22
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 82.62
>3qnt_A Niemann-PICK C1-like protein 1; cholesterol transport protein, transport protein; HET: NAG; 2.83A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.5e-64  Score=572.13  Aligned_cols=234  Identities=31%  Similarity=0.629  Sum_probs=197.8

Q ss_pred             ccccccccccccccCCCCC-------CCccccCCCCCCCCCChhHHHHHHhhCcCCC---CC-CCCCHHHHHHHHHHHHh
Q 040435         1403 ERHSKEYCAMYDICGERSD-------GKVLNCPYGSPSVKPDELFSAKIESLCPSIS---GN-VCCTETQFETLRAQVQQ 1471 (1991)
Q Consensus      1403 ~~~~~~~c~~~~~Cg~~~~-------~~~l~c~~~~~~~~~~~~~~~~l~~~Cp~~~---~~-~CC~~~q~~~l~~~~~~ 1471 (1991)
                      .+|++++|+|||+||++++       ++.|||+|+++|++++++++++|+++||++.   +. +|||.+|+++|++||++
T Consensus         7 ~~~~~g~C~~yg~Cg~~~~~~~~~~~~~~l~C~~n~~a~~~~~~~~~~L~~~Cp~~~~~~~~~~CC~~~Ql~~L~~nl~~   86 (265)
T 3qnt_A            7 TIHQPGYCAFYDECGKNPELSGSLMTLSNVSCLSNTPARKITGDHLILLQKICPRLYTGPNTQACCSAKQLVSLEASLSI   86 (265)
T ss_dssp             CCCCTTBCSEEEEEECCTTSCTTSCCCCCEEEECCCBCEECCHHHHHHHHHHSGGGCCSSSCEESCCHHHHHHHHHHHHH
T ss_pred             CccCCCcceEecccCCCccccccccCCceecCCCCCcCCCCCHHHHHHHHHhChHhhcCCCCCCCCCHHHHHHHHHHHHH
Confidence            5688999999999999875       8999999999999999999999999999974   23 89999999999999999


Q ss_pred             hcccccCChhHHhhHhhhccccccCcCCCcceEEEeecccC--CcceEEEEEEEEchhhhHHHhhcCcCCCCCCCChhHH
Q 040435         1472 AIPFLVGCPACLRNFLNLFCELSCSPNQSQFINVTSVSEVN--GNLTVDGIDYYVTSTFGEELYNSCKDVKFGTMNTRAI 1549 (1991)
Q Consensus      1472 ~~~~~~~CpaC~~N~~~~~C~~tCsP~Qs~F~~v~~~~~~~--~~~~v~~~~~~~~~~~~~~~~~SCk~v~f~~tn~~am 1549 (1991)
                      |+++|+|||||++||++|||+|||||+||+||+||++.+.+  ++++|++|+|||+++||+++|||||||+||+||++||
T Consensus        87 a~~il~rCPaC~~Nf~~lfC~~TCSP~QS~Fl~vt~t~~~~~~~~~~V~eldy~i~~~fa~~~YdSCKdV~~p~tn~~Am  166 (265)
T 3qnt_A           87 TKALLTRCPACSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQLPAVVAYEAFYQHSFAEQSYDSCSRVRVPAAATLAV  166 (265)
T ss_dssp             HHHHTTTCHHHHHHHHHHHHHHHHCTTGGGTEEEEEEECCSSSSCCEEEEEEEEEEHHHHHHHHHHHTTCBCTTSSCBTT
T ss_pred             HHHHhCcChHHHHHHHHHhcCCCCCCCcccceeeEeecccCCCCcceEEEEEEEECHHHhhhHhhhhcCcccccccchhh
Confidence            99999999999999999999999999999999999987643  6778999999999999999999999999999999999


Q ss_pred             hhcCC--CcC--CHHHHHHhhcCCCCCCCCCCCeEEEeecCCCC---CCccccCCCCccCCCCC----CCCcccCCCCCC
Q 040435         1550 DFIGA--GAK--SFKEWFAFIGQKAPPGFPGSPYAINFKLSIPE---SSGLELMNVSTYSCGDT----SLGCSCGDCPLS 1618 (1991)
Q Consensus      1550 ~~~g~--~a~--~~~~~l~flG~~~~~~~~~sPfqInf~~~~~~---~~~~~~~~~~~~~C~~~----~~~CsC~dC~~s 1618 (1991)
                      |+|||  ||+  ||++||+|||++++   ++|||||||+++...   ..+|+|||..+++|||+    +++|||+||++|
T Consensus       167 ~l~cG~~gA~~Cn~~~wl~flG~~~n---~~sPFqInf~~~~~~~~~~~g~~p~n~~~~~C~e~~~~~~~~CSC~DC~~s  243 (265)
T 3qnt_A          167 GTMCGVYGSALCNAQRWLNFQGDTGN---GLAPLDITFHLLEPGQAVGSGIQPLNEGVARCNESQGDDVATCSCQDCAAS  243 (265)
T ss_dssp             GGGSTTSCSSSCCHHHHHHHHTCTTT---TCCSSEEEEEEECHHHHTTSSCCCBCCCCCCTTSCCTTTCCCCCTTTCGGG
T ss_pred             hhhcCCcCcCCCCHHHHHHHhccccC---CCCCeEEEeeccCCCccCCCCceECCCCCcCCCCCCCCCCCCEecccchhh
Confidence            99987  665  99999999999873   689999999986421   25899999999999986    579999999986


Q ss_pred             CCCCCCCCCCCCCCCCceeEecCccc
Q 040435         1619 PMCSSSEPPSPPRKEACTIRIGSLKV 1644 (1991)
Q Consensus      1619 ~~C~~~~~~~~~~~~~~~~~i~~~~~ 1644 (1991)
                        ||++|+| ||  .+.+|+|||+++
T Consensus       244 --Cp~~p~~-p~--~~~p~~I~gldg  264 (265)
T 3qnt_A          244 --CPAIARP-QA--LDSTFYLGQMPG  264 (265)
T ss_dssp             --CCC---------------------
T ss_pred             --cCCCCCC-CC--CCCCcEEEeeeC
Confidence              9887554 33  344678888864



>3gkj_A Niemann-PICK C1 protein; oxysterol, cholesterol, cholesterol transfer, disease mutati endosome, glycoprotein, lysosome, membrane, transmembrane; HET: NAG HC3; 1.60A {Homo sapiens} PDB: 3gkh_A* 3gki_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} SCOP: c.68.1.0 Back     alignment and structure
>1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ll2_A Glycogenin-1; protein-substrate complex, beta-alpha-beta rossman-like NUCL binding fold, DXD motif, non-proline CIS peptide bond, TRAN; HET: UPG; 1.90A {Oryctolagus cuniculus} SCOP: c.68.1.14 PDB: 1ll3_A 1ll0_A 1zcv_A 1zcu_A 1zdf_A* 1zcy_A 1zdg_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u2u_A Glycogenin-1, GN-1, GN1; structural genomics, structural genomics consortium, SGC, transferase, glycosyltransferase, glycogen biosynthesis; HET: GLC UDP; 1.45A {Homo sapiens} SCOP: c.68.1.14 PDB: 3t7n_A* 3t7o_A* 3t7m_A* 3u2v_A* 3u2x_A* 3u2t_A 3rmv_A* 3rmw_A* 3u2w_A* 3qvb_A* 3q4s_A* 1zct_A* 3v8y_A 3v8z_A* 3usr_A 3v90_A 3v91_A* 3usq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1991
d1ga8a_282 c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseri 2e-33
d1ll2a_263 c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cun 2e-08
>d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} Length = 282 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Galactosyltransferase LgtC
domain: Galactosyltransferase LgtC
species: Neisseria meningitidis [TaxId: 487]
 Score =  129 bits (324), Expect = 2e-33
 Identities = 50/308 (16%), Positives = 100/308 (32%), Gaps = 63/308 (20%)

Query: 372 FSDN-VLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENID 430
             DN      V   S  A   +  +  FH++   ++                 I+  +++
Sbjct: 7   ADDNYAAYLCVAAKSVEAAHPD-TEIRFHVLDAGISEANRAAVAANLRGGGGNIRFIDVN 65

Query: 431 SFKWLNSSYCSVLRQLESARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLP 490
              +                                        N +++S+  + R  L 
Sbjct: 66  PEDFAG-----------------------------------FPLNIRHISITTYARLKLG 90

Query: 491 EVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGMVNGAV-ETCKESFHRFDKYLNFSNPLI 549
           E     +K+L+LD D++V+  LTPLW  DL     GA  +   E    + + +  ++   
Sbjct: 91  EYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDNWLGASIDLFVERQEGYKQKIGMADGE- 149

Query: 550 SENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGLITFYNL 609
                     +  G+ + +LK+WR+ +I  +   W +  +D   ++   +  GL  F   
Sbjct: 150 --------YYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDVMQYQDQDILNGL--FKGG 199

Query: 610 TYPLDRSWHVLGLGYDPALNLTQ--------------IDNGAVVHYNGNNKPWLDLAVSK 655
               +  ++ +   Y    N                 +   AV HY G  KPW     + 
Sbjct: 200 VCYANSRFNFMPTNYAFMANWFASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAW 259

Query: 656 YKPYWSKY 663
               +++ 
Sbjct: 260 GAERFTEL 267


>d1ll2a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1991
d1ga8a_282 Galactosyltransferase LgtC {Neisseria meningitidis 100.0
d1ll2a_263 Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 99.79
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.75
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.68
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.14
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.13
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.5
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.5
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.49
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.47
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.32
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.3
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.28
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.24
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.08
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.99
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.85
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.77
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.74
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.71
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.63
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.63
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.61
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.61
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.6
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.54
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.5
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.27
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.23
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.89
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 96.72
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.71
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 96.53
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 96.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 96.22
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.19
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.16
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.15
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 96.09
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 95.83
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.8
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.73
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.58
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 95.52
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.16
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 94.96
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 94.83
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.72
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.35
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 87.63
d1o7qa_287 alpha-1,3-galactosyltransferase catalytic domain { 86.1
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 85.16
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 82.72
d1lzia_283 Glycosyltransferase A catalytic domain {Human (Hom 82.15
>d1ga8a_ c.68.1.4 (A:) Galactosyltransferase LgtC {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Galactosyltransferase LgtC
domain: Galactosyltransferase LgtC
species: Neisseria meningitidis [TaxId: 487]
Probab=100.00  E-value=2.1e-33  Score=334.41  Aligned_cols=254  Identities=18%  Similarity=0.213  Sum_probs=191.7

Q ss_pred             ceEEEEccc--chhhHHHHHHHhhhcCCCCcEEEEEEcCcchHHHHHHHHHhcCCCCcceeeeccchhhhhhhhhhhHHH
Q 040435          367 YHYAIFSDN--VLATSVVVNSTVAHAKEPEKHVFHIVTDKLNFVAMKMWFLVNAPPKATIQIENIDSFKWLNSSYCSVLR  444 (1991)
Q Consensus       367 ~hi~~~~Dn--~~~~~v~i~Sil~~~~~~~~~~Fhivtd~~~~~~~~~~f~~~~~~~~~~~~~~~~~f~~l~~~~~~~l~  444 (1991)
                      +||++++|+  +.+++|+|.|+++|+++ .+++|||++++++....+.                              ++
T Consensus         1 mnIv~~~D~nY~~~~~~~i~SL~~~~~~-~~~~~~il~~~~~~~~~~~------------------------------l~   49 (282)
T d1ga8a_           1 MDIVFAADDNYAAYLCVAAKSVEAAHPD-TEIRFHVLDAGISEANRAA------------------------------VA   49 (282)
T ss_dssp             CEEEEEECGGGHHHHHHHHHHHHHHCTT-SCCEEEEEESSCCHHHHHH------------------------------HH
T ss_pred             CEEEEECCHHHHHHHHHHHHHHHHHCcC-CCEEEEEEcCCCCHHHHHH------------------------------HH
Confidence            699999995  66999999999998765 5799999999877665542                              33


Q ss_pred             HHhh-ccceEEEecCCCCCCCcCCcCCcccCCCCcchhhhHHHHhhcccccCCCeEEEeeCCEeEecCCchhhccCCCCC
Q 040435          445 QLES-ARLKEYYFKANHPSSLSAGSDNLKYRNPKYLSMLNHLRFYLPEVYPKLEKILFLDDDIVVQKDLTPLWSVDLHGM  523 (1991)
Q Consensus       445 ~l~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~y~Rl~ip~llp~~dkvLyLD~Divv~~dl~~L~~~dl~~~  523 (1991)
                      ++.. .......++... .....    . ....+++|.++|+||++|++||+++||||||+|+||++||++||+++++++
T Consensus        50 ~~~~~~~~~i~~~~~~~-~~~~~----~-~~~~~~~s~~~y~Rl~l~~~lp~~~kiiyLD~D~iv~~dl~~L~~~~~~~~  123 (282)
T d1ga8a_          50 ANLRGGGGNIRFIDVNP-EDFAG----F-PLNIRHISITTYARLKLGEYIADCDKVLYLDIDVLVRDSLTPLWDTDLGDN  123 (282)
T ss_dssp             HTSGGGTTTEEEEECCG-GGGTT----S-CCCCTTCCGGGGGGGGHHHHCCSCSCEEEECSSEEECSCCHHHHTCCCTTC
T ss_pred             HHHHHcCCeEEEEECCc-hHhcc----c-cccccccCHHHHHHHHHhhhCCccceEEEecCCEEEecchHHHHhcccccc
Confidence            3211 112222222111 11110    0 112357889999999999999999999999999999999999999999999


Q ss_pred             eeEeeccchhhhccccccccCCCccccCCCCCCCcccccceeEeehHHHHHhhHHHHHHHHHHhchhccccccCCCCchh
Q 040435          524 VNGAVETCKESFHRFDKYLNFSNPLISENFSPNACGWAFGMNMFDLKEWRKRNITGIYHYWQDANEDRTLWKLGTLPPGL  603 (1991)
Q Consensus       524 ~~aaV~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~yfNsGVll~nl~~wR~~~~~~~~~~~~~~~~~~~~~~~~dqd~~n  603 (1991)
                      .+|||.|+......        ......++...++||||||||+|+++||+.++++++.+|++.+...  ..++|||++|
T Consensus       124 ~~aa~~d~~~~~~~--------~~~~~~~~~~~~~yfNsGVml~n~~~~r~~~~~~~~~~~~~~~~~~--~~~~DQd~LN  193 (282)
T d1ga8a_         124 WLGASIDLFVERQE--------GYKQKIGMADGEYYFNAGVLLINLKKWRRHDIFKMSSEWVEQYKDV--MQYQDQDILN  193 (282)
T ss_dssp             SEEEEECHHHHTST--------THHHHTTCCTTSCCEEEEEEEECHHHHTTSCHHHHHHHHHHHHTTT--CSSTHHHHHH
T ss_pred             eeeeehhhhhhhhh--------hhHHHhCCCCCCceeecceeeechhhhhhhhHHHHHHHHHHhcccC--cccCchhHHH
Confidence            99999886443211        1111223555678999999999999999999999999998876544  5679999999


Q ss_pred             hhhccccccccccccccccCCCccc--------------cccccCCceEeecccCCCccccccccccccccchhhhhh
Q 040435          604 ITFYNLTYPLDRSWHVLGLGYDPAL--------------NLTQIDNGAVVHYNGNNKPWLDLAVSKYKPYWSKYVILW  667 (1991)
Q Consensus       604 ~~f~~~~~~L~~~wN~~~~~~~~~~--------------~~~~~~n~~IiHY~g~~KPW~~~a~~~~~~~W~~yv~~d  667 (1991)
                      ++|.+++..||.+||++..++....              ......+++||||+|+.|||.......+...|++|.+--
T Consensus       194 ~~f~~~~~~L~~~~N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iiHf~G~~KPW~~~~~~~~~~~~~~~~~~~  271 (282)
T d1ga8a_         194 GLFKGGVCYANSRFNFMPTNYAFMANWFASRHTDPLYRDRTNTVMPVAVSHYCGPAKPWHRDCTAWGAERFTELAGSL  271 (282)
T ss_dssp             HHHTTSEEEECGGGSBCHHHHHTCC----CSCCCHHHHHHHSCCSSCSEEECCSSCCTTSTTCCSTTTHHHHHHHTTC
T ss_pred             HHhcCCEEeCCHHHeeccccccccccccccccchhhhhhhhhccCCCEEEeeCCCCCCCCCCCCChhHHHHHHHHHhh
Confidence            9999999999999998742221110              113356789999999999999888888888899887653



>d1ll2a_ c.68.1.14 (A:) Glycogenin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o7qa_ c.68.1.9 (A:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lzia_ c.68.1.9 (A:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure