Citrus Sinensis ID: 040442

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520--
MKLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESETQSVNKACTSRDNDEIPDGKLDKQEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHMSKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAPNCNLGGT
cEEEEEEcccccEEEEcccccccHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccHHHHcccEEEEEEEcccccccccccccEEEEEEEEEccEEEEEEEEcccccccEEEEccccccccccHHHHccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHccccHHHHHHHHHcHHHHHHHccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccEEEEEccccEEEEEEccccccHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHcccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccEcccccccccccccccccccccccEEEEEEcHHHcccccccEEEEEEEEEEEcccEEEEEEEEccccccEEEEEHHcccccHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccc
mklrlrslenketlrlevpssctlHELGETLSQLIssspsslrfslnrkdelhassppeslhslgvtagdlifysrdpyafVSQTLESETQSVNKactsrdndeipdgkldkqeipvlesVEIGVnlqeskseeavisqdcgipdamldkqhypvqesekievssvdskehmskketleflntdtmeidegsvvmpepyFLRRVLGEKlgdrlgphGLVIVAVHEILLEsgfvgfdsesgmridqfdlpdhlllkgvsmsytlpeilndsskdvTESVALKYQILGHFVNIygslakgdsgmhKLCLnaynfgpiLSLVWAnsdqncslleyksfdcgKEVFEFWKNVKDGLALPLLIDLcdkaglclpacwthlpteLKLKLleclpgvdvakmecVSRDMRYLASNNELWRQKFVeefggpadaqgktnwkERFVFNWeynrkrkrvitpapwfpytrpyfpiirdppapfggnsliqggdydrypnihfppfplgqrrqvfppcigrrnfapncnlggt
mklrlrslenketlrlevpsscTLHELGETLSQLISSSPSSLRFSLNRKDELhassppeslhsLGVTAGDLIFYSRDPYAFVSQTLESetqsvnkactsrdndeipdgkldkqeipVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIevssvdskehmskketleflntdtmeidegsvvmpEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFggpadaqgktnwkerfvfnweynrkrkrvitpapwfpYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRrnfapncnlggt
MKLRLRSLENKETLRLEVPSSCTLHELGETlsqlissspsslrfslNRKDELHASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESETQSVNKACTSRDNDEIPDGKLDKQEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHMSKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAPNCNLGGT
***************************************************************LGVTAGDLIFYSRDPYAFVS*************************************************************************************************LNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAP*******
MKLRLR*LENKETLRLEVPSSCTLHELGETLSQLIS*SPS*LRFSLN*************LHSLGVTAGDLIFYSR***************************************************************************************************************************FLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFD*******************GVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQN*****YKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNW*********************YFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPP************************LG**
MKLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESETQSVNKACTSRDNDEIPDGKLDKQEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPV*****************SKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAPNCNLGGT
*KLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPESLHSLGVTAGDLIFYSRDPY*********************************************************************************************SKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSES*MRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAPNCN****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPESLHSLGVTAGDLIFYSRDPYAFVSQTLESETQSVNKACTSRDNDEIPDGKLDKQEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHMSKKETLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRNFAPNCNLGGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query522 2.2.26 [Sep-21-2011]
Q9ZUB8475 F-box protein SKIP22 OS=A yes no 0.844 0.928 0.345 2e-54
Q9ZUB9350 Putative F-box protein At no no 0.547 0.817 0.383 2e-37
O64600174 F-box protein At1g70360 O no no 0.308 0.925 0.385 6e-22
Q2T9S7522 F-box only protein 7 OS=B yes no 0.885 0.885 0.260 2e-15
Q68FS3522 F-box only protein 7 OS=R yes no 0.789 0.789 0.255 6e-14
Q3U7U3523 F-box only protein 7 OS=M yes no 0.816 0.814 0.256 4e-13
Q9Y3I1522 F-box only protein 7 OS=H yes no 0.848 0.848 0.258 1e-12
>sp|Q9ZUB8|SKI22_ARATH F-box protein SKIP22 OS=Arabidopsis thaliana GN=SKIP22 PE=1 SV=1 Back     alignment and function desciption
 Score =  214 bits (544), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 191/553 (34%), Positives = 268/553 (48%), Gaps = 112/553 (20%)

Query: 1   MKLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPES 60
           MKLRLR  E +ETL+LE+  + TLH+L   ++  +   PSS+  SLNRKDEL   SP ++
Sbjct: 1   MKLRLRHHETRETLKLELADADTLHDLRRRINPTV---PSSVHLSLNRKDELITPSPEDT 57

Query: 61  LHSLGVTAGDLIFYS-----------RDPYAFVSQTLESETQSVNKACTSRDNDEIPDGK 109
           L SLG+ +GDLI++S           RD     SQ+ ES   SV+ +    + D +PD  
Sbjct: 58  LRSLGLISGDLIYFSLEAGESSNWKLRDSETVASQS-ESNQTSVHDSIGFAEVDVVPD-- 114

Query: 110 LDKQEIPVLESVEIGVNLQESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSK 169
                              ++KS      +D   P+  +     P    E ++V  +D  
Sbjct: 115 -------------------QAKSNPNTSVED---PEGDISGMEGP----EPMDVEQLD-- 146

Query: 170 EHMSKKETLEFLNTDTMEIDE-GSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILL 228
                           ME+   GS  + EP+FL+ +L EK GD      L + +VH ++L
Sbjct: 147 ----------------MELAAAGSKRLSEPFFLKNILLEKSGDTSELTTLAL-SVHAVML 189

Query: 229 ESGFVGFDSESGMRIDQFDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHF 288
           ESGFV  +  S    D+F+    LL   VS+ YTLPE++     +  ESV++K+Q LG  
Sbjct: 190 ESGFVLLNHGS----DKFNFSKELLT--VSLRYTLPELIKSKDTNTIESVSVKFQNLGPV 243

Query: 289 VNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNV 348
           V +YG++      +H + L+   F P++ LV   S  +    E  S    +EVF FW+ V
Sbjct: 244 VVVYGTVGGSSGRVH-MNLDKRRFVPVIDLVMDTSTSD----EEGSSSIYREVFMFWRMV 298

Query: 349 KDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASN 408
           KD L +PLLI +CDKAGL  P C   LPTELKLK+LE LPGV +  M CV  +MRYLAS+
Sbjct: 299 KDRLVIPLLIGICDKAGLEPPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASD 358

Query: 409 NELWRQKFVEEFGG--PADAQGKTNWKERFVFNWEYNR--------------KRKRVITP 452
           N+LW+QK +EE       +A    NWK RF   W   +               R+ + T 
Sbjct: 359 NDLWKQKCLEEVNNFVVTEAGDSVNWKARFATFWRQKQLAAASDTFWRQNQLGRRNISTG 418

Query: 453 APWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPCIGRRN 512
                + R    II DPP  +     + G       +I   P   GQ  +     +GRR 
Sbjct: 419 RSGIRFPR----IIGDPPFTWFNGDRMHG-------SIGIHP---GQSAR----GLGRRT 460

Query: 513 ----FAPNCNLGG 521
               F P CNLGG
Sbjct: 461 WGQLFTPRCNLGG 473
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZUB9|FB17_ARATH Putative F-box protein At1g23770 OS=Arabidopsis thaliana GN=At1g23770 PE=4 SV=1 Back     alignment and function description
>sp|O64600|FB81_ARATH F-box protein At1g70360 OS=Arabidopsis thaliana GN=At1g70360 PE=2 SV=1 Back     alignment and function description
>sp|Q2T9S7|FBX7_BOVIN F-box only protein 7 OS=Bos taurus GN=FBXO7 PE=2 SV=1 Back     alignment and function description
>sp|Q68FS3|FBX7_RAT F-box only protein 7 OS=Rattus norvegicus GN=Fbxo7 PE=2 SV=1 Back     alignment and function description
>sp|Q3U7U3|FBX7_MOUSE F-box only protein 7 OS=Mus musculus GN=Fbxo7 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y3I1|FBX7_HUMAN F-box only protein 7 OS=Homo sapiens GN=FBXO7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query522
224134020545 predicted protein [Populus trichocarpa] 0.967 0.926 0.451 1e-110
225429193563 PREDICTED: F-box protein SKIP22 [Vitis v 0.982 0.911 0.424 5e-94
255562196523 conserved hypothetical protein [Ricinus 0.955 0.954 0.413 7e-92
297736405508 unnamed protein product [Vitis vinifera] 0.904 0.929 0.432 1e-89
307135956502 F-box family protein [Cucumis melo subsp 0.940 0.978 0.393 5e-80
356574335460 PREDICTED: F-box protein SKIP22-like [Gl 0.839 0.952 0.401 9e-79
356534264464 PREDICTED: F-box protein SKIP22-like [Gl 0.848 0.954 0.406 7e-77
449484404499 PREDICTED: F-box protein SKIP22-like [Cu 0.917 0.959 0.387 7e-77
449465099499 PREDICTED: F-box protein SKIP22-like [Cu 0.917 0.959 0.387 1e-76
388517009462 unknown [Medicago truncatula] 0.835 0.943 0.385 6e-73
>gi|224134020|ref|XP_002327736.1| predicted protein [Populus trichocarpa] gi|222836821|gb|EEE75214.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 252/558 (45%), Positives = 340/558 (60%), Gaps = 53/558 (9%)

Query: 1   MKLRLRSLENKETLRLEVPSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPES 60
           MKLRLRS+++KET++++VP SCTL +L ETLS+ ISSS SSL  SLNRKDEL+ S P +S
Sbjct: 1   MKLRLRSVQSKETVKIQVPDSCTLQQLKETLSRAISSSGSSLYLSLNRKDELNTSLPEDS 60

Query: 61  LHSLGVTAGDLIFYSRDPYAFVSQ----TLESETQSVNKACTSRDN--DEIPDGKLDKQE 114
           L SLG+T+GDLI++S +P  F S      L S +    +    R N  + +PD  +  QE
Sbjct: 61  LQSLGITSGDLIYFSVNPKDFSSSGQPLCLGSSSSIQEQVQGHRGNVQEPMPDQSMSFQE 120

Query: 115 -----IPVLESVE------IGVNLQESKSEEAV---------ISQDCGIPDAMLDKQHYP 154
                + +LE+ +      +GV   ++ S E +         + Q  GI ++ ++     
Sbjct: 121 SKCSDLNMLENQDLFVQGHVGVQANDTNSRETISEISPQMHLLGQKHGIAESDMNG---A 177

Query: 155 VQESEKIEVSSVDSKEHMSKKE--TLEFLNTDTMEIDEGSVVMPEPYFLRRVLGEKLGDR 212
           V E      S   S+E +  +E  ++E ++ D   +D G+    EPYFLRR+L ++LGD 
Sbjct: 178 VTEGHGALGSKTRSRETLETQELTSVEAMDVDPGSVDVGNKRFSEPYFLRRLLRKELGDD 237

Query: 213 LGPHGLVIVAVHEILLESGFVGFDSESGMRIDQFDLPDHLLLK--GVSMSYTLPEILNDS 270
              + L+++AVH + +ESGFVGF+S SGMR+D F LP+    +   VS+ YTLPE+L+  
Sbjct: 238 GSNYKLLVIAVHAVFIESGFVGFNSISGMRVDGFHLPEEQSSRNLAVSLCYTLPELLD-- 295

Query: 271 SKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLL 330
           SK + E++ LK Q LGHFVN+YGSL+KG SG++   L+   F P +  VW N D+N  + 
Sbjct: 296 SKVIAETIVLKLQSLGHFVNVYGSLSKGGSGLYHARLDINKFVPAIDFVWEN-DKNDGMN 354

Query: 331 EYKSFDC---GKEVFEFWKNVKDGLALPLLIDLCDKAGLCLPACWTHLPTELKLKLLECL 387
                       E+FEFWK VKDGLALPLLID+C+KAGL LP+C   LPTELKLK+ E L
Sbjct: 355 GSDRSSILYPENEIFEFWKIVKDGLALPLLIDICEKAGLVLPSCLMRLPTELKLKIFELL 414

Query: 388 PGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKTNWKERFVFNWEYNRKRK 447
           P +D+AKMECV  +MRYL+SNN+LW+QKFVEEFG    A G  NWK RF   WE N+KRK
Sbjct: 415 PAIDIAKMECVCSEMRYLSSNNDLWKQKFVEEFGDGTAAHGTLNWKARFASYWE-NKKRK 473

Query: 448 RVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGDYDRYPNIHFPPFPLGQRRQVFPPC 507
           R       +    P+   IR  P P    S+I GGDYDR P +  PP+    RR    P 
Sbjct: 474 RDFNAWQEYRQFLPFHVPIRRDPNPLWCPSII-GGDYDRLPGLGIPPY----RR----PG 524

Query: 508 IG----RRNFAPNCNLGG 521
           IG    R NF+PNCNLGG
Sbjct: 525 IGWPQPRHNFSPNCNLGG 542

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429193|ref|XP_002276156.1| PREDICTED: F-box protein SKIP22 [Vitis vinifera] gi|147804806|emb|CAN73524.1| hypothetical protein VITISV_010705 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255562196|ref|XP_002522106.1| conserved hypothetical protein [Ricinus communis] gi|223538705|gb|EEF40306.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297736405|emb|CBI25128.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135956|gb|ADN33816.1| F-box family protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|356574335|ref|XP_003555304.1| PREDICTED: F-box protein SKIP22-like [Glycine max] Back     alignment and taxonomy information
>gi|356534264|ref|XP_003535677.1| PREDICTED: F-box protein SKIP22-like [Glycine max] Back     alignment and taxonomy information
>gi|449484404|ref|XP_004156873.1| PREDICTED: F-box protein SKIP22-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449465099|ref|XP_004150266.1| PREDICTED: F-box protein SKIP22-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388517009|gb|AFK46566.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query522
TAIR|locus:2034845475 AT1G23780 [Arabidopsis thalian 0.693 0.762 0.355 4.2e-61
TAIR|locus:2034835350 AT1G23770 "AT1G23770" [Arabido 0.509 0.76 0.398 1.9e-42
UNIPROTKB|Q8GZV6 776 OJ1017C11.10 "Putative unchara 0.358 0.240 0.347 5.7e-31
TAIR|locus:2016169174 AT1G70360 "AT1G70360" [Arabido 0.137 0.413 0.527 7.5e-24
UNIPROTKB|D2WL17527 FBXO7 "Uncharacterized protein 0.655 0.648 0.264 1.2e-12
UNIPROTKB|Q9Y3I1522 FBXO7 "F-box only protein 7" [ 0.321 0.321 0.297 2.8e-11
ZFIN|ZDB-GENE-050913-68521 fbxo7 "F-box protein 7" [Danio 0.314 0.314 0.318 3.6e-11
UNIPROTKB|F1MDA7522 FBXO7 "F-box only protein 7" [ 0.681 0.681 0.25 4.1e-09
UNIPROTKB|Q2T9S7522 FBXO7 "F-box only protein 7" [ 0.681 0.681 0.252 4.1e-09
RGD|1305648522 Fbxo7 "F-box protein 7" [Rattu 0.268 0.268 0.304 8.1e-08
TAIR|locus:2034845 AT1G23780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 496 (179.7 bits), Expect = 4.2e-61, Sum P(2) = 4.2e-61
 Identities = 147/413 (35%), Positives = 207/413 (50%)

Query:   129 ESKSEEAVISQDCGIPDAMLDKQHYPVQESEKIEVSSVDSKEHMSKKETLEFLNTDTMEI 188
             +S+S +  +    G   A +D    P Q       S  D +  +S  E  E ++ + +++
Sbjct:    92 QSESNQTSVHDSIGF--AEVDV--VPDQAKSNPNTSVEDPEGDISGMEGPEPMDVEQLDM 147

Query:   189 D---EGSVVMPEPYFLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESGMRIDQ 245
             +    GS  + EP+FL+ +L EK GD      L + +VH ++LESGFV  +  S    D+
Sbjct:   148 ELAAAGSKRLSEPFFLKNILLEKSGDTSELTTLAL-SVHAVMLESGFVLLNHGS----DK 202

Query:   246 FDLPDHLLLKGVSMSYTLPEILNDSSKDVTESVALKYQILGHFVNIYGSLAKGDSGMHKL 305
             F+    LL   VS+ YTLPE++     +  ESV++K+Q LG  V +YG++  G SG   +
Sbjct:   203 FNFSKELLT--VSLRYTLPELIKSKDTNTIESVSVKFQNLGPVVVVYGTVG-GSSGRVHM 259

Query:   306 CLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLALPLLIDLCDKAG 365
              L+   F P++ LV   S  +    E  S    +EVF FW+ VKD L +PLLI +CDKAG
Sbjct:   260 NLDKRRFVPVIDLVMDTSTSD----EEGSSSIYREVFMFWRMVKDRLVIPLLIGICDKAG 315

Query:   366 LCLPACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGG--P 423
             L  P C   LPTELKLK+LE LPGV +  M CV  +MRYLAS+N+LW+QK +EE      
Sbjct:   316 LEPPPCLMRLPTELKLKILELLPGVSIGNMACVCTEMRYLASDNDLWKQKCLEEVNNFVV 375

Query:   424 ADAQGKTNWKERFVFNWEYNRKRKRVITPAPWFPYTRPYFPIIRDPPAPFGGNSLIQGGD 483
              +A    NWK RF   W   +K+    +   W           R      G  ++  G  
Sbjct:   376 TEAGDSVNWKARFATFWR--QKQLAAASDTFW-----------RQNQ--LGRRNISTGRS 420

Query:   484 YDRYPNI-HFPPFPL--GQRRQ----VFPPC----IGRRN----FAPNCNLGG 521
               R+P I   PPF    G R      + P      +GRR     F P CNLGG
Sbjct:   421 GIRFPRIIGDPPFTWFNGDRMHGSIGIHPGQSARGLGRRTWGQLFTPRCNLGG 473
GO:0005739 "mitochondrion" evidence=ISM
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
TAIR|locus:2034835 AT1G23770 "AT1G23770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GZV6 OJ1017C11.10 "Putative uncharacterized protein OJ1017C11.10" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2016169 AT1G70360 "AT1G70360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|D2WL17 FBXO7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y3I1 FBXO7 "F-box only protein 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050913-68 fbxo7 "F-box protein 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDA7 FBXO7 "F-box only protein 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9S7 FBXO7 "F-box only protein 7" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1305648 Fbxo7 "F-box protein 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZUB8SKI22_ARATHNo assigned EC number0.34530.84480.9284yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00570053
hypothetical protein (545 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query522
pfam1293747 pfam12937, F-box-like, F-box-like 7e-06
pfam0064648 pfam00646, F-box, F-box domain 0.002
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 0.002
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information 
 Score = 42.9 bits (102), Expect = 7e-06
 Identities = 15/45 (33%), Positives = 25/45 (55%)

Query: 372 WTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKF 416
            + LP E+ L++   L   D+ ++  V R  R LAS++ LWR+  
Sbjct: 1   LSDLPDEILLQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLC 45

This is an F-box-like family. Length = 47
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 522
PF11566155 PI31_Prot_N: PI31 proteasome regulator N-terminal; 99.34
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.17
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.83
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.61
KOG2997366 consensus F-box protein FBX9 [General function pre 98.48
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.47
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 98.11
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 98.11
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 98.11
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 98.04
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 98.04
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.04
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 97.89
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 97.81
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 97.81
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 97.77
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 97.74
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 97.73
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 97.67
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 97.61
PTZ0004476 ubiquitin; Provisional 97.55
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 97.54
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 97.5
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 97.47
KOG3926332 consensus F-box proteins [Amino acid transport and 97.46
KOG4761266 consensus Proteasome formation inhibitor PI31 [Pos 97.45
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 97.39
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 97.39
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 97.38
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.37
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 97.36
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 97.31
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 97.29
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 97.28
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 97.27
PF06881109 Elongin_A: RNA polymerase II transcription factor 97.26
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 97.23
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 97.04
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 96.91
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 96.87
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 96.71
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 96.61
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 96.56
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 96.47
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 96.27
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 96.1
PLN02560308 enoyl-CoA reductase 95.62
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 95.49
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 95.32
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 94.69
smart0016680 UBX Domain present in ubiquitin-regulatory protein 94.21
KOG4341 483 consensus F-box protein containing LRR [General fu 94.08
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 93.69
KOG4408 386 consensus Putative Mg2+ and Co2+ transporter CorD 92.89
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 92.74
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 91.28
COG5100571 NPL4 Nuclear pore protein [Nuclear structure] 90.11
PLN03215 373 ascorbic acid mannose pathway regulator 1; Provisi 89.56
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 88.2
KOG4495110 consensus RNA polymerase II transcription elongati 87.65
KOG1639297 consensus Steroid reductase required for elongatio 84.48
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 84.16
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 83.02
>PF11566 PI31_Prot_N: PI31 proteasome regulator N-terminal; InterPro: IPR021625 PI31 is a regulatory subunit of the immuno-proteasome which is an inhibitor of the 20 S proteasome in vitro Back     alignment and domain information 
Probab=99.34  E-value=1.6e-12  Score=121.17  Aligned_cols=137  Identities=23%  Similarity=0.264  Sum_probs=90.7

Q ss_pred             cCCCCccchHHHHHHHHHHhcCCcccCCCCCcccc---cCCCcccccCC-ce-eEEeccCccccCCCCCccceEEEEEEE
Q 040442          210 GDRLGPHGLVIVAVHEILLESGFVGFDSESGMRID---QFDLPDHLLLK-GV-SMSYTLPEILNDSSKDVTESVALKYQI  284 (522)
Q Consensus       210 ~~~~~~~~~LvvavHalmLESGFv~~~~~sg~~~~---~~~lp~~w~s~-g~-sl~YtlP~l~~~~~~~~~~~v~L~~~~  284 (522)
                      .+..+++|+|++++|++|+++||...+....-...   .-.||++|.+. +. +++|++|+.  ..      .+.|+|..
T Consensus         9 ~~i~~~~D~l~~~~H~~~~~~gF~~vg~~~~~~~~~~~~~~LP~~WN~~~~~Y~~~Y~~~~~--~~------~~~lk~~~   80 (155)
T PF11566_consen    9 PDIKSPHDALALFVHALMLESGFRLVGLGEDAKISSSESELLPEGWNSSSDSYAFRYKHPQS--SM------QFLLKALK   80 (155)
T ss_dssp             GG--SHHHHHHHHHHHHHHCTTEEEEEESSS--TT---BSS--TTTTS-SSEEEEEEEETTS----------EEEEEEEE
T ss_pred             cccCCHHHHHHHHHHHHHHHcCCEEeccCCCcCccccccccCCHHHcCCCCeeEEEEecCCC--CC------eEEEEEEE
Confidence            46788999999999999999999877433211122   34599999864 55 999999994  22      89999999


Q ss_pred             cCCEEEEEEeecCCCCceEEEEecccCccccchhhhcccccccccccccccccchh--HHHHHHHhhhcchhHHHHHHhh
Q 040442          285 LGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKE--VFEFWKNVKDGLALPLLIDLCD  362 (522)
Q Consensus       285 lG~~vvV~g~l~~~~s~v~~l~Ld~~~yv~~l~~~~~~s~~~~~~~~~~~~~~~~~--l~~Lw~~~Kd~La~plL~~lc~  362 (522)
                      ||+.++||+ +..+.+.+++++|+...||..=.  +......+.+     ...+++  +.+|.+.||+.+..||+..+..
T Consensus        81 ~g~~lvIn~-l~~~~~~v~~l~i~~~~~v~~~~--~~~~~~~~~~-----~~~~~~~~l~~L~~~~~~~ii~~l~~~~~k  152 (155)
T PF11566_consen   81 MGNKLVINA-LNVGDDKVASLEINVDDYVSESF--LPASEDPSDL-----SSVFKNKRLEDLISLFKTDIIQPLVPGLRK  152 (155)
T ss_dssp             ETTEEEEEE-EETTTTEEEEEEEEHHHHB-T--------TSTT-H-----HHHBSS--HHHHHHHHHHHTTS--------
T ss_pred             eCCeEEEEe-eecCCCcEEEEEEcHHHhhhhhh--cccccCCccH-----HHHHHhhhHHHHHHHHHHHhhcccCCcccc
Confidence            999999999 44357899999999999996300  0000011111     245788  9999999999999999887754

PI31 is also an F-box protein Fbxo7.Skp1 binding partner which requires an N-terminal FP domain in both proteins for the interaction to occur via the FP beta sheets. The structure of PI31 FP domain contains a novel alpha/beta-fold and two intermolecular contact surfaces []. ; PDB: 2VT8_B.
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>KOG3926 consensus F-box proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4761 consensus Proteasome formation inhibitor PI31 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>PF06881 Elongin_A: RNA polymerase II transcription factor SIII (Elongin) subunit A; InterPro: IPR010684 This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG4408 consensus Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query522
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 6e-06
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 1e-05
2pjh_A80 Protein NPL4, nuclear protein localization protein 1e-04
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 55.6 bits (133), Expect = 3e-08
 Identities = 69/459 (15%), Positives = 128/459 (27%), Gaps = 138/459 (30%)

Query: 8   LENKETLRLEV-PSSCTLHELGETLSQLISSSPSSLRFSLNRKDELHASSPPESLHSLGV 66
           LE  + L  ++ P+  +  +    +   I S  + LR  L  K           L     
Sbjct: 199 LEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPY------ENCL----- 247

Query: 67  TAGDLIFYSRDPYAFV--SQTLESETQSVNKAC----TSRDNDEIPDGKLDKQEIPVLES 120
               L+    +    V  ++   +     N +C    T+R                 L+ 
Sbjct: 248 ----LVL--LN----VQNAKAWNA----FNLSCKILLTTRFKQVTDFLSAATTTHISLDH 293

Query: 121 VEIGVNLQESKSEEAVISQDCGIPDAML---DKQHYPVQES---EKIEVSSVDSKEHMSK 174
             + +   E KS   ++ +        L        P + S   E I       ++ ++ 
Sbjct: 294 HSMTLTPDEVKS---LLLKYLDCRPQDLPREVLTTNPRRLSIIAESI-------RDGLAT 343

Query: 175 KETLEFLNTDTM-EIDEGSVVMPEPYFLRRVLGEKLGDRLGPHGLVI----VAVHEILLE 229
            +  + +N D +  I E S+ + EP   R++             L +      +  ILL 
Sbjct: 344 WDNWKHVNCDKLTTIIESSLNVLEPAEYRKMF----------DRLSVFPPSAHIPTILLS 393

Query: 230 SGFVGFDSESGMRIDQFDLPDHLLLK--GVSMSYTLPEILNDSSKDVTESVALKYQILGH 287
             +        M +    L  + L++      + ++P I  +    +    AL       
Sbjct: 394 LIWFDVIKSDVMVVVN-KLHKYSLVEKQPKESTISIPSIYLELKVKLENEYAL------- 445

Query: 288 FVNIYGSLAKGDSGMHKLCLNAYN---------FGP------ILS-----LVWANSDQNC 327
                          H+  ++ YN           P        S     L      +  
Sbjct: 446 ---------------HRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERM 490

Query: 328 SLLEYKSFDCGKEVFEFWKN--VKDGLA-------LPLLIDL-------CDKAGLCLPAC 371
           +L      D     F F +     D  A       L  L  L       CD         
Sbjct: 491 TLFRMVFLD-----FRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDP------ 539

Query: 372 WTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNE 410
                  L   +L+ LP ++   +     D+  +A   E
Sbjct: 540 ---KYERLVNAILDFLPKIEENLICSKYTDLLRIALMAE 575
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query522
2vt8_A153 HPI31, PI31, proteasome inhibitor PI31 subunit; po 99.45
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.0
3l2o_B 312 F-box only protein 4; small G protein fold, UBL co 98.99
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.98
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.91
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.85
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.76
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.68
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.53
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 98.51
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 98.5
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 98.47
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.47
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.47
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 98.38
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 98.38
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 98.38
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 98.37
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 98.35
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 98.32
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 98.31
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 98.3
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 98.27
3m62_B106 UV excision repair protein RAD23; armadillo-like r 98.26
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.26
3v6c_B91 Ubiquitin; structural genomics, structural genomic 98.25
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 98.25
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 98.22
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 98.21
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 98.2
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 98.2
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 98.19
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 98.18
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 98.17
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 98.17
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 98.16
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 98.14
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 98.14
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.13
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 98.12
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 97.4
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 98.11
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 98.1
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.09
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 98.08
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 98.08
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.08
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 98.03
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 98.02
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 98.02
1we6_A111 Splicing factor, putative; structural genomics, ub 98.02
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 97.99
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 97.99
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 97.98
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 97.95
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 97.92
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 97.86
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 97.85
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 97.85
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 97.76
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 97.72
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 97.67
2fnj_B118 Transcription elongation factor B polypeptide 2; b 97.66
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 97.66
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 97.64
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 97.63
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 97.58
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 97.56
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 97.55
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 97.53
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 97.5
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 97.48
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 97.47
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 97.43
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 97.43
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 97.42
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 97.42
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 97.41
2kj6_A97 Tubulin folding cofactor B; methods development, N 97.4
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 97.4
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 97.39
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 97.38
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 97.36
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 97.32
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 97.32
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 97.3
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 97.26
4hfx_A97 Transcription elongation factor B polypeptide 3; s 97.24
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 97.23
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 97.16
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 97.02
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 97.01
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 96.97
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 96.86
4ajy_B118 Transcription elongation factor B polypeptide 2; E 96.86
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 96.55
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 96.55
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 96.48
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 96.18
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 96.14
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 96.13
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 96.06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.95
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 95.75
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 95.67
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 95.5
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 95.21
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 94.92
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 94.72
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 94.48
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 93.87
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 93.13
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 93.1
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 88.45
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 87.94
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 87.79
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 87.79
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 86.27
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 85.35
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 84.91
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 84.66
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 82.75
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 82.1
>2vt8_A HPI31, PI31, proteasome inhibitor PI31 subunit; polymorphism, hydrolase inhibitor; 2.6A {Homo sapiens} Back     alignment and structure
Probab=99.45  E-value=1.5e-13  Score=127.05  Aligned_cols=139  Identities=12%  Similarity=0.077  Sum_probs=107.9

Q ss_pred             HHHHHHhHHhcCCCCccchHHHHHHHHHHhcCCcccCCCCC---cccccCCCcccccCC-ce-eEEeccCccccCCCCCc
Q 040442          200 FLRRVLGEKLGDRLGPHGLVIVAVHEILLESGFVGFDSESG---MRIDQFDLPDHLLLK-GV-SMSYTLPEILNDSSKDV  274 (522)
Q Consensus       200 ~L~~vl~~~~~~~~~~~~~LvvavHalmLESGFv~~~~~sg---~~~~~~~lp~~w~s~-g~-sl~YtlP~l~~~~~~~~  274 (522)
                      -+.-+++....+..++.|+|++++|+.|++.||.+.+.+..   .....-.||++|.+. +. +++|+||+. . .    
T Consensus         5 ~~e~l~~s~~~~i~~~~Dal~~~vH~~m~~~gfr~~g~g~~~~~~~~~se~LP~~WN~~~~~Y~f~Y~h~~~-~-~----   78 (153)
T 2vt8_A            5 GLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDG-S-R----   78 (153)
T ss_dssp             CHHHHHHHHGGGCCSHHHHHHHHHHHHHHTTTEEEEEESSSCCTTCCCBSSCCTTTTSCSSEEEEEEEESCC---C----
T ss_pred             HHHHHHHhhhcccCCHHHHHHHHHHHHHHhcCCEeccCCCccCcccccccCCCHHHcCCCCeEEEEeccCCC-C-C----
Confidence            34566677667899999999999999999999999876421   012335699999985 66 999999994 3 3    


Q ss_pred             cceEEEEEEEcCCEEEEEEeecCCCCceEEEEecccCccccchhhhcccccccccccccccccchhHHHHHHHhhhcchh
Q 040442          275 TESVALKYQILGHFVNIYGSLAKGDSGMHKLCLNAYNFGPILSLVWANSDQNCSLLEYKSFDCGKEVFEFWKNVKDGLAL  354 (522)
Q Consensus       275 ~~~v~L~~~~lG~~vvV~g~l~~~~s~v~~l~Ld~~~yv~~l~~~~~~s~~~~~~~~~~~~~~~~~l~~Lw~~~Kd~La~  354 (522)
                        .+.|+|..||+.++||+... +...|++++|+...||.--     .   .+.++     ..|+++.+|-+.||++|..
T Consensus        79 --~~lLk~~~lg~~lvin~l~~-~~~~v~~l~i~~~~~V~~~-----~---~~~~~-----~~~~~l~~L~~~~k~~li~  142 (153)
T 2vt8_A           79 --KLLVKAITVESSMILNVLEY-GSQQVADLTLNLDDYIDAE-----H---LGDFH-----RTYKNSEELRSRIVSGIIT  142 (153)
T ss_dssp             --EEEEEEEEETTEEEEEEEET-TTTEEEEEEEEHHHHBCTT-----S---TTCHH-----HHBSCHHHHHHHHHHHTTS
T ss_pred             --eEEEEEEEeCCEEEEEEEec-CCCCEEEEEEcHHHhhccc-----c---cCCHH-----HHhhhHHHHHHHHHHHhhh
Confidence              89999999999999999885 4567999999999999721     1   11111     5689999999999999999


Q ss_pred             HHHHHH
Q 040442          355 PLLIDL  360 (522)
Q Consensus       355 plL~~l  360 (522)
                      |+....
T Consensus       143 ~l~~~~  148 (153)
T 2vt8_A          143 PIHEQW  148 (153)
T ss_dssp             CC----
T ss_pred             hhcCCC
Confidence            987644
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>4hfx_A Transcription elongation factor B polypeptide 3; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.54A {Homo sapiens} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 522
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 9e-07
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 1e-06
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 2e-06
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 45.1 bits (106), Expect = 9e-07
 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 10/75 (13%)

Query: 372 WTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPADAQGKT- 430
            + LP EL L +L  L   D+ +     R  R LA +N LWR+K  EE         +  
Sbjct: 19  ISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRK 78

Query: 431 ---------NWKERF 436
                     WK  +
Sbjct: 79  VIKPGFIHSPWKSAY 93
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query522
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.55
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.26
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 99.13
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 98.44
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.34
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 98.32
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 98.3
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 98.29
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 98.29
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 98.28
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.23
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 98.14
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 98.09
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 98.09
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 98.08
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 98.05
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 98.01
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 97.99
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 97.98
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 97.96
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 97.93
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 97.86
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 97.84
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 97.82
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 97.81
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 97.72
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 97.69
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 97.66
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 97.65
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 97.61
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 97.61
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 97.6
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 97.58
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 97.51
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 97.24
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 97.22
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 97.13
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 96.92
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 96.89
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 96.78
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 94.43
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 93.58
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 93.02
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 92.33
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 91.85
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 89.53
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 88.38
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.55  E-value=2e-15  Score=126.42  Aligned_cols=75  Identities=28%  Similarity=0.349  Sum_probs=64.9

Q ss_pred             ccccCCcHHHHHHHhccCCccchhhHHHhhHHHHHHhcCcHHHHHHHHhhcCCCCC----------CCCCCChHHHHHHH
Q 040442          370 ACWTHLPTELKLKLLECLPGVDVAKMECVSRDMRYLASNNELWRQKFVEEFGGPAD----------AQGKTNWKERFVFN  439 (522)
Q Consensus       370 p~l~~LP~ELll~ILs~Ld~~dL~~ls~vCr~lr~LasDd~LWr~lc~~df~~~~~----------~~~~~~WK~lY~~~  439 (522)
                      +.|..||.||+.+||++||++||+++++|||.|+.++.|+.|||.+|.++|.....          .....+||+.|.++
T Consensus        17 D~i~~LP~Eil~~Ils~Ld~~dL~~~~~vcr~w~~l~~~~~lW~~~~~r~~~~~~~~~~~~~~~~~~~~~~~WK~~Y~~~   96 (102)
T d2ovrb1          17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQ   96 (102)
T ss_dssp             STTTSSCHHHHHHHHTTSCHHHHHHHTTSCHHHHHHHTCSHHHHHHHTTTTCCSCCCCCC--CCSSCCCCCHHHHHHHHH
T ss_pred             CChhhCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHcCCCCchHHHhhhcccCCCCCcCHHHHHHHH
Confidence            56899999999999999999999999999999999999999999999998754321          12356799999999


Q ss_pred             HHhhc
Q 040442          440 WEYNR  444 (522)
Q Consensus       440 ~~~~k  444 (522)
                      |++++
T Consensus        97 ~~l~~  101 (102)
T d2ovrb1          97 HRIDT  101 (102)
T ss_dssp             HHHHH
T ss_pred             HHHhc
Confidence            98653
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure