Citrus Sinensis ID: 040452

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MNPVSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKLAQHEDEELES
ccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccHHcccHHHHHHHcHHHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccc
ccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHcccccccHHHHHHHcccHHHHHHHHHccccHHHHccHHHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHcccccHHHHHHHcccHHHHHHHHHcccccccEccccccHHHHHHHcccHHHHHHHHccccHHHHHHHHHccccccccHHHcccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHccccHHHHHHHHccccccHHHHHHcc
mnpvsthpnlfkaaaeghadepfkkdtrsNEIRGLLTAQAKNRIRHiniisqksktgstKFMEEILEICPsvlhksmpkaILRSTLLRNLAILIycpaddenntALHEAVCHGNVQVVKILtgqdpdypysannygkTQLYLAAKGRYSEMVIELLENstsvsyegpngktALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKrgsncfkyccQRSKMTALRLAAGQRHARTVKTIlslnpefngegdtplpvaakfghfnIANVLIKREKLAQhedeeles
mnpvsthpnlfkaaaeghadepfkkdtrsnEIRGLLTaqaknrirhiniisqksktgstkFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKlaqhedeeles
MNPVSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKLAQHEDEELES
**********************************LLTAQAKNRIRHINIISQ***TGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKR*************
MNPVSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKLAQH*******
MNPVSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKL**********
***VSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKL**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPVSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFNGEGDTPLPVAAKFGHFNIANVLIKREKLAQHEDEELES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
P16157 1881 Ankyrin-1 OS=Homo sapiens yes no 0.661 0.111 0.314 7e-12
G5E8K5 1961 Ankyrin-3 OS=Mus musculus yes no 0.787 0.126 0.281 1e-10
Q02357 1862 Ankyrin-1 OS=Mus musculus no no 0.601 0.102 0.278 4e-10
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no no 0.636 0.051 0.277 4e-10
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.639 0.046 0.288 6e-10
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.629 0.050 0.289 3e-09
Q502K3 1071 Serine/threonine-protein no no 0.572 0.169 0.292 7e-09
Q9ULJ7 1429 Ankyrin repeat domain-con no no 0.642 0.142 0.279 2e-08
Q8N8A2 993 Serine/threonine-protein no no 0.515 0.164 0.316 4e-08
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.639 0.204 0.274 5e-08
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 113/242 (46%), Gaps = 33/242 (13%)

Query: 86  LLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAK 145
           LL+N A +     DD+  T LH A   G+  +VK+L   + + P  A   G T L++AA+
Sbjct: 456 LLQNKAKVNAKAKDDQ--TPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAR 512

Query: 146 GRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLV------------CSSENW 193
             + E V+ LLE   S +     G T LH AA    YGK  V             + +N 
Sbjct: 513 EGHVETVLALLEKEASQACMTKKGFTPLHVAA---KYGKVRVAELLLERDAHPNAAGKNG 569

Query: 194 VI-IAASLLNNKVIILKPLF---------VVIGWTPIHYAAYYDQYQLIHMLLKRGSNCF 243
           +  +  ++ +N + I+K L             G+TP+H AA  +Q ++   LL+ G +  
Sbjct: 570 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN 629

Query: 244 KYCCQRSKMTALRLAAGQRHARTVKTILSLNPE---FNGEGDTPLPVAAKFGHFNIANVL 300
               Q   +T L LAA + HA  V  +LS        N  G TPL + A+ GH  +A+VL
Sbjct: 630 AESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVL 687

Query: 301 IK 302
           IK
Sbjct: 688 IK 689
Isoform Mu17 together with obscurin in skeletal muscle may provide a molecular link between the sarcoplasmic reticulum and myofibrils.
Homo sapiens (taxid: 9606)
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
255585399 575 ankyrin repeat-containing protein, putat 0.787 0.433 0.312 4e-26
224127098399 predicted protein [Populus trichocarpa] 0.781 0.619 0.337 1e-23
224127104405 predicted protein [Populus trichocarpa] 0.781 0.609 0.337 1e-23
224127079394 predicted protein [Populus trichocarpa] 0.794 0.637 0.323 3e-23
224127093281 predicted protein [Populus trichocarpa] 0.768 0.864 0.325 3e-22
356510752 629 PREDICTED: ankyrin-2-like [Glycine max] 0.781 0.392 0.327 4e-22
224127106 575 predicted protein [Populus trichocarpa] 0.784 0.431 0.299 5e-22
255551947 582 ankyrin repeat-containing protein, putat 0.781 0.424 0.311 1e-21
224145572395 predicted protein [Populus trichocarpa] 0.914 0.731 0.286 4e-21
298205152 541 unnamed protein product [Vitis vinifera] 0.75 0.438 0.311 1e-20
>gi|255585399|ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  124 bits (312), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 92/294 (31%), Positives = 152/294 (51%), Gaps = 45/294 (15%)

Query: 9   NLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEI 68
           +L+KAA +G  D PFK      +   LL    K+ I H+N+ S   +  ST F++E L++
Sbjct: 30  DLYKAAEDGKID-PFKNFAGPLD---LLVTPIKDTILHLNLASPSER--STSFVKEALDM 83

Query: 69  CPSVL------------------HKSMPKAILRSTLLRNLAILIYCPA--------DDEN 102
           CP +L                  H  + K ++  T  ++  +     A        +   
Sbjct: 84  CPQILLQINADGDTLLHIAARYGHLDIVKLLIEHTRAQHQDLESAGEAVRQMLRMTNKSK 143

Query: 103 NTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSV 162
            TALHEA  + +  +V++L  QDPD+ +S+N++G+T LYLA++  + E+V+ +L+  TS+
Sbjct: 144 ETALHEAARNDHPDLVELLIEQDPDFVHSSNDFGETPLYLASERGHLEVVVIMLKACTSL 203

Query: 163 SYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHY 222
           +Y GPNGKTALHAAAMH + G            I  ++L+ K  ++      +GWTP+HY
Sbjct: 204 AYGGPNGKTALHAAAMHRHGG------------IVHAILDKKTSLVNKA-DEMGWTPLHY 250

Query: 223 AAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPE 276
           AAY    +++  LL           +  + TAL LAA Q + ++++ I+   P+
Sbjct: 251 AAYIGASRVVKQLLGYDKYVAYAADKARRRTALHLAACQANIKSMREIIFKCPD 304

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127098|ref|XP_002329394.1| predicted protein [Populus trichocarpa] gi|222870444|gb|EEF07575.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127104|ref|XP_002329397.1| predicted protein [Populus trichocarpa] gi|222870447|gb|EEF07578.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127079|ref|XP_002329386.1| predicted protein [Populus trichocarpa] gi|224127100|ref|XP_002329395.1| predicted protein [Populus trichocarpa] gi|222870436|gb|EEF07567.1| predicted protein [Populus trichocarpa] gi|222870445|gb|EEF07576.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127093|ref|XP_002329392.1| predicted protein [Populus trichocarpa] gi|222870442|gb|EEF07573.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356510752|ref|XP_003524098.1| PREDICTED: ankyrin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255551947|ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224145572|ref|XP_002325691.1| predicted protein [Populus trichocarpa] gi|222862566|gb|EEF00073.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|298205152|emb|CBI17211.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
UNIPROTKB|P16157 1881 ANK1 "Ankyrin-1" [Homo sapiens 0.794 0.133 0.265 2.2e-10
ZFIN|ZDB-GENE-091113-6 1923 si:ch211-263m18.3 "si:ch211-26 0.588 0.096 0.305 3.8e-10
MGI|MGI:88026 1961 Ank3 "ankyrin 3, epithelial" [ 0.753 0.121 0.270 1.4e-09
UNIPROTKB|K7GLA8 1847 ANK3 "Uncharacterized protein" 0.753 0.128 0.267 2.3e-09
WB|WBGene00006616 1924 trp-4 [Caenorhabditis elegans 0.680 0.111 0.269 2.4e-09
ZFIN|ZDB-GENE-041014-19744 si:dkey-86e18.2 "si:dkey-86e18 0.613 0.260 0.261 2.4e-09
ZFIN|ZDB-GENE-081104-19 1929 si:ch211-173b16.3 "si:ch211-17 0.575 0.094 0.301 2.4e-09
UNIPROTKB|F1LM13 1783 Ank3 "Protein Ank3" [Rattus no 0.753 0.133 0.267 2.8e-09
UNIPROTKB|F1LPH6 1961 Ank3 "Protein Ank3" [Rattus no 0.753 0.121 0.267 3.1e-09
UNIPROTKB|K7GSS3 2594 ANK3 "Uncharacterized protein" 0.753 0.091 0.267 3.3e-09
UNIPROTKB|P16157 ANK1 "Ankyrin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 180 (68.4 bits), Expect = 2.2e-10, P = 2.2e-10
 Identities = 73/275 (26%), Positives = 120/275 (43%)

Query:    34 GLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRSTLLRNLAIL 93
             GL      + + H+ I+    + G++  +  +    P  +        +   LL+N A +
Sbjct:   404 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKV 463

Query:    94 IYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVI 153
                  DD+  T LH A   G+  +VK+L   + + P  A   G T L++AA+  + E V+
Sbjct:   464 NAKAKDDQ--TPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAREGHVETVL 520

Query:   154 ELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFV 213
              LLE   S +     G T LH AA    YGK         V +A  LL        P   
Sbjct:   521 ALLEKEASQACMTKKGFTPLHVAAK---YGK---------VRVAELLLERDA---HPNAA 565

Query:   214 -VIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILS 272
                G TP+H A +++   ++ +LL RG +   +    +  T L +AA Q      +++L 
Sbjct:   566 GKNGLTPLHVAVHHNNLDIVKLLLPRGGS--PHSPAWNGYTPLHIAAKQNQVEVARSLLQ 623

Query:   273 LNPEFNGE---GDTPLPVAAKFGHFNIANVLIKRE 304
                  N E   G TPL +AA+ GH  +  +L+ ++
Sbjct:   624 YGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQ 658
GO:0007165 "signal transduction" evidence=IEA
GO:0006779 "porphyrin-containing compound biosynthetic process" evidence=IEA
GO:0015672 "monovalent inorganic cation transport" evidence=IEA
GO:0030863 "cortical cytoskeleton" evidence=IEA
GO:0048821 "erythrocyte development" evidence=IEA
GO:0016529 "sarcoplasmic reticulum" evidence=IEA
GO:0031430 "M band" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA;NAS
GO:0005198 "structural molecule activity" evidence=NAS
GO:0007010 "cytoskeleton organization" evidence=NAS
GO:0030507 "spectrin binding" evidence=IDA;NAS;IPI
GO:0016323 "basolateral plasma membrane" evidence=NAS
GO:0008093 "cytoskeletal adaptor activity" evidence=IDA;TAS
GO:0045199 "maintenance of epithelial cell apical/basal polarity" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0019899 "enzyme binding" evidence=TAS;IPI
GO:0005856 "cytoskeleton" evidence=NAS
GO:0006887 "exocytosis" evidence=NAS
GO:0005200 "structural constituent of cytoskeleton" evidence=TAS
GO:0005829 "cytosol" evidence=TAS
GO:0007411 "axon guidance" evidence=TAS
GO:0014731 "spectrin-associated cytoskeleton" evidence=IDA
GO:0051117 "ATPase binding" evidence=IPI
GO:0072661 "protein targeting to plasma membrane" evidence=IMP
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=IDA
ZFIN|ZDB-GENE-091113-6 si:ch211-263m18.3 "si:ch211-263m18.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:88026 Ank3 "ankyrin 3, epithelial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLA8 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00006616 trp-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041014-19 si:dkey-86e18.2 "si:dkey-86e18.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081104-19 si:ch211-173b16.3 "si:ch211-173b16.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM13 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPH6 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|K7GSS3 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01200031
hypothetical protein (405 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-16
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-15
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 7e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 8e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.002
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.003
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 74.7 bits (184), Expect = 1e-16
 Identities = 41/138 (29%), Positives = 66/138 (47%), Gaps = 15/138 (10%)

Query: 99  DDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLEN 158
           D++  T LH A  +G+++VVK+L     D   + +N G+T L+LAAK  + E+V  LLE 
Sbjct: 4   DEDGRTPLHLAASNGHLEVVKLLLENGAD-VNAKDNDGRTPLHLAAKNGHLEIVKLLLEK 62

Query: 159 STSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWT 218
              V+    +G T LH AA +              + +   LL +   +        G T
Sbjct: 63  GADVNARDKDGNTPLHLAARN------------GNLDVVKLLLKHGADVNAR--DKDGRT 108

Query: 219 PIHYAAYYDQYQLIHMLL 236
           P+H AA     +++ +LL
Sbjct: 109 PLHLAAKNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02917 661 ankyrin-like protein; Provisional 99.98
PHA02989 494 ankyrin repeat protein; Provisional 99.97
PHA02798 489 ankyrin-like protein; Provisional 99.97
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.97
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA02792 631 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02792 631 ankyrin-like protein; Provisional 99.95
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.87
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.84
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.84
PHA02884 300 ankyrin repeat protein; Provisional 99.84
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.81
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.77
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.7
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.69
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.67
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.64
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.55
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.53
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.49
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.45
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.41
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.4
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.36
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.35
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.35
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.33
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.29
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.24
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.2
PF1360630 Ank_3: Ankyrin repeat 98.9
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.76
PF1360630 Ank_3: Ankyrin repeat 98.73
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.71
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.7
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.7
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.68
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.66
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.64
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.6
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.58
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.41
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.31
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.3
KOG0522 560 consensus Ankyrin repeat protein [General function 98.23
KOG0522 560 consensus Ankyrin repeat protein [General function 98.23
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.14
KOG2384 223 consensus Major histocompatibility complex protein 97.97
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.96
KOG0511 516 consensus Ankyrin repeat protein [General function 97.86
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.85
KOG0520 975 consensus Uncharacterized conserved protein, conta 97.8
KOG2384223 consensus Major histocompatibility complex protein 97.77
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.74
KOG0511 516 consensus Ankyrin repeat protein [General function 97.74
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.06
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.92
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.68
KOG2505591 consensus Ankyrin repeat protein [General function 96.4
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.35
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.3
KOG2505591 consensus Ankyrin repeat protein [General function 95.08
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.98
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.15
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.57
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.3e-40  Score=287.51  Aligned_cols=275  Identities=18%  Similarity=0.202  Sum_probs=233.0

Q ss_pred             CCCchHHHHHHcCCCCcccccccccccccccccccccCcchhhhhhhcccCcchHHHHHHHHhhchhhhhccChhhhhhH
Q 040452            5 STHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEICPSVLHKSMPKAILRS   84 (316)
Q Consensus         5 ~~~~~l~~A~~~g~~~~~~~~ll~~~~~~~~~~~~~~~t~L~~A~~~~~g~~~i~~~L~~~~~~~~~~~~~~~~~~~~~~   84 (316)
                      .+.|||+.|+..|+.+ ++++|++ .|.+....+..|.||||+|  +..|+.+++++|++.+... ..+...    ....
T Consensus        34 ~~~tpL~~A~~~g~~~-iv~~Ll~-~Ga~~n~~~~~~~t~L~~A--~~~~~~~iv~~Ll~~g~~~-~~~~~~----~~~~  104 (434)
T PHA02874         34 ETTTPLIDAIRSGDAK-IVELFIK-HGADINHINTKIPHPLLTA--IKIGAHDIIKLLIDNGVDT-SILPIP----CIEK  104 (434)
T ss_pred             CCCCHHHHHHHcCCHH-HHHHHHH-CCCCCCCCCCCCCCHHHHH--HHcCCHHHHHHHHHCCCCC-Ccchhc----cCCH
Confidence            4578999999999999 9999988 6666545556688999999  9999999999998863221 111111    3456


Q ss_pred             HHHHHhHhhhhCCC-----CCCCCcHHhHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCchhHHHHhcCCHHHHHHHHhCC
Q 040452           85 TLLRNLAILIYCPA-----DDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENS  159 (316)
Q Consensus        85 ~~~~~~~~l~~~~~-----d~~~~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g  159 (316)
                      ++++   ++++.+.     +..|.||||+|+..|+.+++++|++.|++++ ..+..|.||||+|+..|+.+++++|++.|
T Consensus       105 ~~i~---~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~n-~~d~~g~tpLh~A~~~~~~~iv~~Ll~~g  180 (434)
T PHA02874        105 DMIK---TILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADVN-IEDDNGCYPIHIAIKHNFFDIIKLLLEKG  180 (434)
T ss_pred             HHHH---HHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCCC-CcCCCCCCHHHHHHHCCcHHHHHHHHHCC
Confidence            7788   8888754     4679999999999999999999999999975 67889999999999999999999999999


Q ss_pred             CCCccCCCCCCCHHHHHHHhhccccccccCcccHHHHHHHHhcCccccccccccccCCcHHHHHHhcCCHHHHHHHHhcC
Q 040452          160 TSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRG  239 (316)
Q Consensus       160 ~~~~~~~~~~~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~t~l~~A~~~~~~~~~~~Ll~~~  239 (316)
                      ++++..+..|.||||+|+..|+.+            ++++|++.+.  .....+..|.||||.|+..+. +.+++|+ .+
T Consensus       181 ~~~n~~~~~g~tpL~~A~~~g~~~------------iv~~Ll~~g~--~i~~~~~~g~TpL~~A~~~~~-~~i~~Ll-~~  244 (434)
T PHA02874        181 AYANVKDNNGESPLHNAAEYGDYA------------CIKLLIDHGN--HIMNKCKNGFTPLHNAIIHNR-SAIELLI-NN  244 (434)
T ss_pred             CCCCCCCCCCCCHHHHHHHcCCHH------------HHHHHHhCCC--CCcCCCCCCCCHHHHHHHCCh-HHHHHHH-cC
Confidence            999999999999999999999999            9999999998  567788899999999999765 5667776 46


Q ss_pred             CCCccccccCCCchHHHHHHhcC-CHHHHHHHHhcCCC---CCCCCCChHHHHHHcC-CHHHHHHHHhccccccCc
Q 040452          240 SNCFKYCCQRSKMTALRLAAGQR-HARTVKTILSLNPE---FNGEGDTPLPVAAKFG-HFNIANVLIKREKLAQHE  310 (316)
Q Consensus       240 ~~~~~~~~~~~~~t~l~~A~~~~-~~~~v~~L~~~~~~---~~~~g~t~l~~A~~~~-~~~~~~~Ll~~g~~~~~~  310 (316)
                      ++ . +..+..|.||||+|+..+ +.+++++|++.|++   .+..|.|||++|++.+ ..++++.|++++......
T Consensus       245 ~~-i-n~~d~~G~TpLh~A~~~~~~~~iv~~Ll~~gad~n~~d~~g~TpL~~A~~~~~~~~~ik~ll~~~~~~~~~  318 (434)
T PHA02874        245 AS-I-NDQDIDGSTPLHHAINPPCDIDIIDILLYHKADISIKDNKGENPIDTAFKYINKDPVIKDIIANAVLIKEA  318 (434)
T ss_pred             CC-C-CCcCCCCCCHHHHHHhcCCcHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHhCCccHHHHHHHHhcCchhhc
Confidence            66 3 778999999999999876 89999999999998   6688999999999987 778999999998876543

>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 6e-13
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-04
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 8e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-10
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 9e-09
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 3e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-08
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-08
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 9e-08
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 6e-06
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 8e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 9e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 8e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-04
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 113/242 (46%), Gaps = 33/242 (13%)
Query: 86  LLRNLAILIYCPADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAK 145
           LL+N A +     DD+  T LH A   G+  +VK+L   + + P  A   G T L++AA+
Sbjct: 66  LLQNKAKVNAKAKDDQ--TPLHCAARIGHTNMVKLLLENNAN-PNLATTAGHTPLHIAAR 122
Query: 146 GRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLV------------CSSENW 193
             + E V+ LLE   S +     G T LH AA    YGK  V             + +N 
Sbjct: 123 EGHVETVLALLEKEASQACMTKKGFTPLHVAA---KYGKVRVAELLLERDAHPNAAGKNG 179
Query: 194 VI-IAASLLNNKVIILKPLF---------VVIGWTPIHYAAYYDQYQLIHMLLKRGSNCF 243
           +  +  ++ +N + I+K L             G+TP+H AA  +Q ++   LL+ G +  
Sbjct: 180 LTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSAN 239
Query: 244 KYCCQRSKMTALRLAAGQRHARTVKTILSLNPE---FNGEGDTPLPVAAKFGHFNIANVL 300
               Q   +T L LAA + HA  V  +LS        N  G TPL + A+ GH  +A+VL
Sbjct: 240 AESVQ--GVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVL 297
Query: 301 IK 302
           IK
Sbjct: 298 IK 299
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-23
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-19
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-23
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-13
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-20
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-17
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-11
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-22
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-22
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-22
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-18
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 8e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-09
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-20
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-21
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-14
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-18
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-15
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-09
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-20
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-13
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-12
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-19
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-19
2rfa_A232 Transient receptor potential cation channel subfa 6e-14
2rfa_A232 Transient receptor potential cation channel subfa 3e-13
2rfa_A 232 Transient receptor potential cation channel subfa 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-19
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-12
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-18
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-18
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-10
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 9e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-12
2etb_A256 Transient receptor potential cation channel subfam 4e-17
2etb_A256 Transient receptor potential cation channel subfam 8e-17
2pnn_A273 Transient receptor potential cation channel subfa 1e-16
2pnn_A273 Transient receptor potential cation channel subfa 8e-16
2pnn_A273 Transient receptor potential cation channel subfa 3e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-09
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-08
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-12
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-11
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-09
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-05
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 7e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-14
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-11
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 9e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-11
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-09
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-11
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-11
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-10
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 8e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-05
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  111 bits (280), Expect = 5e-28
 Identities = 56/209 (26%), Positives = 88/209 (42%), Gaps = 20/209 (9%)

Query: 98  ADDENNTALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLE 157
              +  T LH A  +G V+V ++L  +D   P +A   G T L++A      ++V  LL 
Sbjct: 142 MTKKGFTPLHVAAKYGKVRVAELLLERDAH-PNAAGKNGLTPLHVAVHHNNLDIVKLLLP 200

Query: 158 NSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGW 217
              S      NG T LH AA             +N V +A SLL            V G 
Sbjct: 201 RGGSPHSPAWNGYTPLHIAAK------------QNQVEVARSLLQYGGSANAES--VQGV 246

Query: 218 TPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEF 277
           TP+H AA     +++ +LL + +N       +S +T L L A + H      ++      
Sbjct: 247 TPLHLAAQEGHAEMVALLLSKQAN--GNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMV 304

Query: 278 N---GEGDTPLPVAAKFGHFNIANVLIKR 303
           +     G TPL VA+ +G+  +   L++ 
Sbjct: 305 DATTRMGYTPLHVASHYGNIKLVKFLLQH 333
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.82
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.69
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=3.7e-46  Score=328.38  Aligned_cols=288  Identities=26%  Similarity=0.245  Sum_probs=213.3

Q ss_pred             CCCCchHHHHHHcCCCCcccccccccccccccccccccCcchhhhhhhcccCcchHHHHHHHHhh-------chhhhhcc
Q 040452            4 VSTHPNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEI-------CPSVLHKS   76 (316)
Q Consensus         4 ~~~~~~l~~A~~~g~~~~~~~~ll~~~~~~~~~~~~~~~t~L~~A~~~~~g~~~i~~~L~~~~~~-------~~~~~~~~   76 (316)
                      ..+.||||.||..|+.+ ++++|++ .+.+....+..|.||||+|  +..|+.+++++|++....       ..++++.+
T Consensus        45 ~~~~t~L~~A~~~g~~~-~v~~Ll~-~g~~~~~~~~~g~t~L~~A--~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A  120 (437)
T 1n11_A           45 VKVETPLHMAARAGHTE-VAKYLLQ-NKAKVNAKAKDDQTPLHCA--ARIGHTNMVKLLLENNANPNLATTAGHTPLHIA  120 (437)
T ss_dssp             SCCCCHHHHHHHHTCHH-HHHHHHH-HTCCSSCCCTTSCCHHHHH--HHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHH
T ss_pred             CCCCCHHHHHHHcCCHH-HHHHHHh-CCCCCCCCCCCCCCHHHHH--HHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHH
Confidence            34567888888888888 8888887 5555445555677888888  888888888888776321       11222222


Q ss_pred             Chh-------------------------------hhhhHHHHHHhHhhhhCCC-----CCCCCcHHhHHHHcCCHHHHHH
Q 040452           77 MPK-------------------------------AILRSTLLRNLAILIYCPA-----DDENNTALHEAVCHGNVQVVKI  120 (316)
Q Consensus        77 ~~~-------------------------------~~~~~~~~~~~~~l~~~~~-----d~~~~t~l~~A~~~~~~~~~~~  120 (316)
                      ...                               ..++.++++   +|++.+.     +..|.||||+|+..++.+++++
T Consensus       121 ~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~---~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~  197 (437)
T 1n11_A          121 AREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAE---LLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKL  197 (437)
T ss_dssp             HHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHH---HHHHTTCCTTCCCSSCCCHHHHHHHTTCHHHHHH
T ss_pred             HHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHH---HHHhCCCCCCCCCCCCCCHHHHHHHcCCHHHHHH
Confidence            220                               044555555   5555433     3455666666666666666666


Q ss_pred             HHhCCCCCCCCCCCCCCchhHHHHhcCCHHHHHHHHhCCCCCccCCCCCCCHHHHHHHhhccccccccCcccHHHHHHHH
Q 040452          121 LTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASL  200 (316)
Q Consensus       121 Ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~L~~a~~~~~~~~~~~~~~~~~~~~~~~L  200 (316)
                      |++.+.++. ..+..|.||||+|+..|+.+++++|++.|++++..+..|.||||+|+..|+.+            ++++|
T Consensus       198 Ll~~g~~~~-~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~------------~v~~L  264 (437)
T 1n11_A          198 LLPRGGSPH-SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAE------------MVALL  264 (437)
T ss_dssp             HGGGTCCSC-CCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHHHTTCHH------------HHHHH
T ss_pred             HHhCCCCCC-CcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHCCCHH------------HHHHH
Confidence            666666543 44556677777777777777777777777777777777777777777777777            88888


Q ss_pred             hcCccccccccccccCCcHHHHHHhcCCHHHHHHHHhcCCCCccccccCCCchHHHHHHhcCCHHHHHHHHhcCCC---C
Q 040452          201 LNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPE---F  277 (316)
Q Consensus       201 l~~~~~~~~~~~~~~~~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~L~~~~~~---~  277 (316)
                      ++.+.  ..+..+..|.||||.|+..|+.+++++|+++|.+ . +..+..|.||||+|+..|+.+++++|++.|++   .
T Consensus       265 l~~~~--~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~gad~n~~  340 (437)
T 1n11_A          265 LSKQA--NGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-V-DATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAK  340 (437)
T ss_dssp             HTTTC--CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-T-TCCCSSCCCHHHHHHHSSCSHHHHHHHHTTCCTTCC
T ss_pred             HhcCC--CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCcc-C-CCCCCCCCCHHHHHHHcCcHHHHHHHHhcCCCCCCC
Confidence            88887  6677788899999999999999999999998887 4 67788899999999999999999999999988   5


Q ss_pred             CCCCCChHHHHHHcCCHHHHHHHHhccccccCcccccc
Q 040452          278 NGEGDTPLPVAAKFGHFNIANVLIKREKLAQHEDEELE  315 (316)
Q Consensus       278 ~~~g~t~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~  315 (316)
                      +..|.||||+|+..|+.+++++|+++|++++..+.+|.
T Consensus       341 ~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~  378 (437)
T 1n11_A          341 TKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGT  378 (437)
T ss_dssp             CTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSC
T ss_pred             CCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCC
Confidence            57799999999999999999999999999999888775
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-17
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-12
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-07
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-13
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-09
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 79.2 bits (194), Expect = 3e-17
 Identities = 53/203 (26%), Positives = 86/203 (42%), Gaps = 20/203 (9%)

Query: 104 TALHEAVCHGNVQVVKILTGQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVS 163
           T LH A   G++ +VK L  +    P  +N   +T L++AA+  ++E+   LL+N   V+
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGAS-PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVN 60

Query: 164 YEGPNGKTALHAAAMHFYYGKCLVCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYA 223
            +  + +T LH AA                  +   LL N       L    G TP+H A
Sbjct: 61  AKAKDDQTPLHCAARI------------GHTNMVKLLLENNANP--NLATTAGHTPLHIA 106

Query: 224 AYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQRHARTVKTILSLNPEFN---GE 280
           A     + +  LL++     + C  +   T L +AA     R  + +L  +   N     
Sbjct: 107 AREGHVETVLALLEKE--ASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKN 164

Query: 281 GDTPLPVAAKFGHFNIANVLIKR 303
           G TPL VA    + +I  +L+ R
Sbjct: 165 GLTPLHVAVHHNNLDIVKLLLPR 187
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.5e-40  Score=284.25  Aligned_cols=294  Identities=23%  Similarity=0.227  Sum_probs=191.2

Q ss_pred             chHHHHHHcCCCCcccccccccccccccccccccCcchhhhhhhcccCcchHHHHHHHHhhc-------hhhhhccChhh
Q 040452            8 PNLFKAAAEGHADEPFKKDTRSNEIRGLLTAQAKNRIRHINIISQKSKTGSTKFMEEILEIC-------PSVLHKSMPKA   80 (316)
Q Consensus         8 ~~l~~A~~~g~~~~~~~~ll~~~~~~~~~~~~~~~t~L~~A~~~~~g~~~i~~~L~~~~~~~-------~~~~~~~~~~~   80 (316)
                      ||||.||..|+++ +|++|++ .|.+....+..|.||||+|  +..|+.+++++|++++...       .++++.+..  
T Consensus         2 TpL~~Aa~~g~~~-~v~~Ll~-~g~~in~~d~~g~TpL~~A--~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A~~--   75 (408)
T d1n11a_           2 TPLHVASFMGHLP-IVKNLLQ-RGASPNVSNVKVETPLHMA--ARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAR--   75 (408)
T ss_dssp             CHHHHHHHHTCHH-HHHHHHH-TTCCSCCSSSCCCCHHHHH--HHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHHHH--
T ss_pred             ChHHHHHHCcCHH-HHHHHHH-CCCCCCCCCCCCCCHHHHH--HHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHH--
Confidence            7999999999999 9999998 6766556677799999999  9999999999999973211       122222222  


Q ss_pred             hhhHHHHHHhHhhhhC--------------------------------------CCCCCCCcHHhHHHHcCCHHHHHHHH
Q 040452           81 ILRSTLLRNLAILIYC--------------------------------------PADDENNTALHEAVCHGNVQVVKILT  122 (316)
Q Consensus        81 ~~~~~~~~~~~~l~~~--------------------------------------~~d~~~~t~l~~A~~~~~~~~~~~Ll  122 (316)
                      .++.++++   +|+..                                      ..+..+.++++.|+..++.+++++|+
T Consensus        76 ~g~~~~~~---~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll  152 (408)
T d1n11a_          76 IGHTNMVK---LLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL  152 (408)
T ss_dssp             HTCHHHHH---HHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHH
T ss_pred             cCCHHHHH---HHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHH
Confidence            44555555   55432                                      12355667777777777777777777


Q ss_pred             hCCCCCCCCCCCCCCchhHHHHhcCCHHHHHHHHhCCCCCccCCCCCCCHHHHHHHhhcccccc----------------
Q 040452          123 GQDPDYPYSANNYGKTQLYLAAKGRYSEMVIELLENSTSVSYEGPNGKTALHAAAMHFYYGKCL----------------  186 (316)
Q Consensus       123 ~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~L~~a~~~~~~~~~~----------------  186 (316)
                      +.+.++. ..+..+.+||++|+..|+.+++++|+++|++++..+..|.||+|.+......+...                
T Consensus       153 ~~~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  231 (408)
T d1n11a_         153 ERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQG  231 (408)
T ss_dssp             HTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTC
T ss_pred             HcCCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCC
Confidence            7776643 55566777777777777777777777777777666666666666555433321000                


Q ss_pred             -----ccCcccHHHHHHHHhcCccccccccccccCCcHHHHHHhcCCHHHHHHHHhcCCCCccccccCCCchHHHHHHhc
Q 040452          187 -----VCSSENWVIIAASLLNNKVIILKPLFVVIGWTPIHYAAYYDQYQLIHMLLKRGSNCFKYCCQRSKMTALRLAAGQ  261 (316)
Q Consensus       187 -----~~~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~t~l~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~t~l~~A~~~  261 (316)
                           .....+...+++++.....  .....+..|.||++.|+..++.+++++|+++|++ . +..+..+.|||+.++..
T Consensus       232 ~t~l~~a~~~~~~~~~~~~~~~~~--~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~-~-~~~~~~~~t~L~~~~~~  307 (408)
T d1n11a_         232 VTPLHLAAQEGHAEMVALLLSKQA--NGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVM-V-DATTRMGYTPLHVASHY  307 (408)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHTTTC--CTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCC-T-TCCCSSCCCHHHHHHHS
T ss_pred             CCHHHHHHHhCcHhHhhhhhcccc--ccccccCCCCChhhhhhhcCcHHHHHHHHHCCCc-c-ccccccccccchhhccc
Confidence                 0011112235566666554  4455566667777777777777777777776666 3 44555566666666666


Q ss_pred             CCHHHHHHHHhcCCC---CCCCCCChHHHHHHcCCHHHHHHHHhccccccCcccccc
Q 040452          262 RHARTVKTILSLNPE---FNGEGDTPLPVAAKFGHFNIANVLIKREKLAQHEDEELE  315 (316)
Q Consensus       262 ~~~~~v~~L~~~~~~---~~~~g~t~l~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~  315 (316)
                      ++.++++++++.|++   ++.+|.||||+|++.|+.++|++|+++||+++.+|.+|+
T Consensus       308 ~~~~~~~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~  364 (408)
T d1n11a_         308 GNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGT  364 (408)
T ss_dssp             SCSHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSC
T ss_pred             CcceeeeeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCC
Confidence            666666666666665   445666666666666666666666666666666666654
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure