Citrus Sinensis ID: 040483
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| 225444627 | 917 | PREDICTED: respiratory burst oxidase hom | 0.818 | 0.206 | 0.596 | 8e-65 | |
| 255550343 | 934 | respiratory burst oxidase, putative [Ric | 0.805 | 0.199 | 0.536 | 2e-52 | |
| 449450207 | 896 | PREDICTED: LOW QUALITY PROTEIN: respirat | 0.735 | 0.189 | 0.557 | 2e-49 | |
| 449477631 | 881 | PREDICTED: respiratory burst oxidase hom | 0.735 | 0.192 | 0.557 | 3e-49 | |
| 356558443 | 972 | PREDICTED: respiratory burst oxidase hom | 0.748 | 0.177 | 0.489 | 5e-48 | |
| 356556422 | 899 | PREDICTED: respiratory burst oxidase hom | 0.735 | 0.189 | 0.489 | 3e-47 | |
| 356530463 | 892 | PREDICTED: respiratory burst oxidase hom | 0.735 | 0.190 | 0.5 | 3e-46 | |
| 326532616 | 958 | predicted protein [Hordeum vulgare subsp | 0.731 | 0.176 | 0.497 | 4e-46 | |
| 218202208 | 877 | hypothetical protein OsI_31509 [Oryza sa | 0.528 | 0.139 | 0.704 | 1e-42 | |
| 357528848 | 952 | RecName: Full=Respiratory burst oxidase | 0.774 | 0.188 | 0.453 | 2e-42 |
| >gi|225444627|ref|XP_002277540.1| PREDICTED: respiratory burst oxidase homolog protein E [Vitis vinifera] gi|297738517|emb|CBI27762.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 252 bits (644), Expect = 8e-65, Method: Compositional matrix adjust.
Identities = 142/238 (59%), Positives = 163/238 (68%), Gaps = 49/238 (20%)
Query: 7 SSSRSNYSRT-----------DYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDA 55
SS RSNYSRT DY VG AMLPIFLNDL N +Q DLVE+T+ELEDD+
Sbjct: 9 SSKRSNYSRTYDFPEELVDSGDYAVGGAMLPIFLNDLRPNHRQ----DLVEVTLELEDDS 64
Query: 56 VVFR-------------------------------QKFGWLRSGSS---PDIEERTMSGR 81
+V +KF WLRS SS + E+ T+S R
Sbjct: 65 IVLCSVTPTATANPSGDEAATGFLGRSLSATSKLCRKFSWLRSTSSRASSEAEDPTISAR 124
Query: 82 DERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDF 141
D R+I AKLQRTRS A++AL GLRFI K GASDA+EL + VES F+SL++DGLL+REDF
Sbjct: 125 DARKITAKLQRTRSSAQQALKGLRFIRKTTGASDADELWKKVESRFKSLAKDGLLSREDF 184
Query: 142 GECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDM 199
GECIGMVDSKEFAVGIFDALARRR QK+G+ITKEEL +FWLQISDQSFDARLQIFFDM
Sbjct: 185 GECIGMVDSKEFAVGIFDALARRRRQKMGRITKEELRDFWLQISDQSFDARLQIFFDM 242
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255550343|ref|XP_002516222.1| respiratory burst oxidase, putative [Ricinus communis] gi|223544708|gb|EEF46224.1| respiratory burst oxidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449450207|ref|XP_004142855.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog protein E-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449477631|ref|XP_004155076.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356558443|ref|XP_003547516.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356556422|ref|XP_003546525.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356530463|ref|XP_003533800.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|326532616|dbj|BAK05237.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
| >gi|218202208|gb|EEC84635.1| hypothetical protein OsI_31509 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|357528848|sp|O81211.2|RBOHE_ARATH RecName: Full=Respiratory burst oxidase homolog protein E; AltName: Full=NADPH oxidase RBOHE; Short=AtRBOHE | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 231 | ||||||
| TAIR|locus:2024603 | 944 | RBOH F "respiratory burst oxid | 0.558 | 0.136 | 0.492 | 3.4e-26 | |
| TAIR|locus:2036104 | 843 | RBOHB "respiratory burst oxida | 0.649 | 0.177 | 0.440 | 2.6e-22 | |
| TAIR|locus:2128248 | 941 | AT4G11230 [Arabidopsis thalian | 0.601 | 0.147 | 0.437 | 7e-22 | |
| TAIR|locus:2157348 | 905 | RHD2 "ROOT HAIR DEFECTIVE 2" [ | 0.502 | 0.128 | 0.508 | 5.6e-21 | |
| UNIPROTKB|Q5ZAJ0 | 905 | RBOHB "Respiratory burst oxida | 0.593 | 0.151 | 0.425 | 1.2e-20 | |
| TAIR|locus:2183309 | 902 | RBOHA "respiratory burst oxida | 0.467 | 0.119 | 0.495 | 7.7e-19 | |
| TAIR|locus:2117258 | 849 | AT4G25090 [Arabidopsis thalian | 0.463 | 0.126 | 0.5 | 2.4e-18 | |
| TAIR|locus:2160917 | 921 | RBOHD "respiratory burst oxida | 0.506 | 0.127 | 0.464 | 7.3e-18 | |
| TAIR|locus:2168113 | 886 | AT5G60010 [Arabidopsis thalian | 0.584 | 0.152 | 0.375 | 8.1e-17 | |
| TAIR|locus:2077192 | 912 | AT3G45810 [Arabidopsis thalian | 0.476 | 0.120 | 0.410 | 3.7e-16 |
| TAIR|locus:2024603 RBOH F "respiratory burst oxidase protein F" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 307 (113.1 bits), Expect = 3.4e-26, P = 3.4e-26
Identities = 65/132 (49%), Positives = 87/132 (65%)
Query: 68 GSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTF 127
G+ + + R R+ +A+L RTRS A+RAL GLRFIS D V+S F
Sbjct: 147 GAGGGLVNSALEARALRKQRAQLDRTRSSAQRALRGLRFISNKQKNVDGWND---VQSNF 203
Query: 128 ESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQ 187
E ++G + R DF +CIGM DSKEFA+ +FDAL+RRR K+ KI +EL E+W QI+D+
Sbjct: 204 EKFEKNGYIYRSDFAQCIGMKDSKEFALELFDALSRRRRLKVEKINHDELYEYWSQINDE 263
Query: 188 SFDARLQIFFDM 199
SFD+RLQIFFD+
Sbjct: 264 SFDSRLQIFFDI 275
|
|
| TAIR|locus:2036104 RBOHB "respiratory burst oxidase homolog B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128248 AT4G11230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157348 RHD2 "ROOT HAIR DEFECTIVE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZAJ0 RBOHB "Respiratory burst oxidase homolog protein B" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2183309 RBOHA "respiratory burst oxidase homolog A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117258 AT4G25090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160917 RBOHD "respiratory burst oxidase homologue D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2168113 AT5G60010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077192 AT3G45810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00016386001 | SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (917 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| pfam08414 | 96 | pfam08414, NADPH_Ox, Respiratory burst NADPH oxida | 3e-42 |
| >gnl|CDD|203934 pfam08414, NADPH_Ox, Respiratory burst NADPH oxidase | Back alignment and domain information |
|---|
Score = 138 bits (349), Expect = 3e-42
Identities = 60/99 (60%), Positives = 69/99 (69%), Gaps = 3/99 (3%)
Query: 93 TRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKE 152
T+S A RAL GL+FISK G D VE F+ L+ DG L R FGECIGM DSKE
Sbjct: 1 TKSSAARALKGLKFISKTDGGVDG---WNEVEKRFDKLAVDGYLPRSKFGECIGMNDSKE 57
Query: 153 FAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDA 191
FA+ +FDALARRR K+ ITKEEL EFW QI+DQSFD+
Sbjct: 58 FALELFDALARRRRIKVDSITKEELKEFWEQITDQSFDS 96
|
This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N-terminus of an EF-hand (pfam00036), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants. Length = 96 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| PF08414 | 100 | NADPH_Ox: Respiratory burst NADPH oxidase; InterPr | 100.0 | |
| PTZ00183 | 158 | centrin; Provisional | 96.55 | |
| PTZ00184 | 149 | calmodulin; Provisional | 96.17 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 91.82 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 90.05 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 87.79 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 85.81 |
| >PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.3e-57 Score=354.39 Aligned_cols=100 Identities=66% Similarity=1.019 Sum_probs=79.4
Q ss_pred hhhhccchHHHHhccccccccccCCcchHHHHHHHHHHHHhhhccCCccccccccccCCCCcHHHHHHHHHHHhhhcCCC
Q 040483 89 KLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQK 168 (231)
Q Consensus 89 ~ldRskS~A~~ALkGLrFIskt~g~~~~~~gW~~VEkRFd~La~dG~L~Rs~FgeCIGM~dSkEFA~ELFDALaRRR~i~ 168 (231)
+|+||+|+|++||||||||++++++. ++|++||+||++|++||+|||++||+||||+||||||+||||||||||+|+
T Consensus 1 rldRt~S~A~~ALkGLrFIskt~~~~---~~W~~VE~RFd~La~dG~L~rs~Fg~CIGM~dSkeFA~eLFdALaRrr~i~ 77 (100)
T PF08414_consen 1 RLDRTKSGAQRALKGLRFISKTTGGA---DGWKEVEKRFDKLAKDGLLPRSDFGECIGMKDSKEFAGELFDALARRRGIK 77 (100)
T ss_dssp -----HHHHHHHHHHHHHHHHHH--------HHHHHHHHHHH-BTTBEEGGGHHHHHT--S-HHHHHHHHHHHHHHTT--
T ss_pred CCCcchhHHHHHHhcccceecCCCCc---cCHHHHHHHHHHhCcCCcccHHHHHHhcCCcccHHHHHHHHHHHHHhcCCc
Confidence 58999999999999999999998874 589999999999999999999999999999999999999999999999999
Q ss_pred CCCCCHHHHHHHHHHhhCCChhH
Q 040483 169 IGKITKEELGEFWLQISDQSFDA 191 (231)
Q Consensus 169 ~~~ItK~EL~eFW~qIsDqsFDS 191 (231)
.++|||+||+|||+|||||||||
T Consensus 78 ~~~I~k~eL~efW~qisD~sFDs 100 (100)
T PF08414_consen 78 GDSITKDELKEFWEQISDQSFDS 100 (100)
T ss_dssp SSEE-HHHHHHHHHHHH---HHH
T ss_pred cCCcCHHHHHHHHHHhhccCCCC
Confidence 99999999999999999999997
|
It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A. |
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 231 | ||||
| 3a8r_A | 179 | The Structure Of The N-Terminal Regulatory Domain O | 9e-20 |
| >pdb|3A8R|A Chain A, The Structure Of The N-Terminal Regulatory Domain Of A Plant Nadph Oxidase Length = 179 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 231 | |||
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 9e-41 |
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 | Back alignment and structure |
|---|
Score = 136 bits (344), Expect = 9e-41
Identities = 51/110 (46%), Positives = 68/110 (61%), Gaps = 4/110 (3%)
Query: 92 RTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSK 151
T+S A AL GL+F++ G VE F L DG+L R FG+CIGM S
Sbjct: 3 GTKSSAAVALKGLQFVTAKVGNDGWAA----VEKRFNQLQVDGVLLRSRFGKCIGMDGSD 58
Query: 152 EFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYN 201
EFAV +FD+LAR+RG +TK+EL +F+ Q++DQ FD RL+ FFDM +
Sbjct: 59 EFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVD 108
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.62 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 97.42 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 97.34 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 97.24 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 97.15 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 97.05 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 96.98 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 96.94 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 96.9 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 96.83 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 96.8 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 96.77 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 96.75 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 96.73 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 96.72 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 96.71 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 96.71 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 96.68 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 96.63 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 96.61 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 96.61 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 96.49 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 96.47 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 96.45 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 96.45 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 96.44 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 96.4 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 96.39 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 96.37 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 96.34 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 96.33 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 96.27 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 96.25 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 96.24 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 96.24 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 96.21 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 96.2 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 96.2 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 96.2 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 96.19 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 96.18 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 96.16 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 96.13 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 96.08 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 96.05 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 96.05 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 95.91 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 95.84 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 95.73 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 95.7 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 95.66 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 95.61 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 95.58 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 95.58 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 95.48 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 95.46 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 95.44 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 95.4 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 95.39 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 95.38 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 95.33 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 95.32 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 95.3 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 95.25 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 95.22 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 95.2 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 95.14 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 95.12 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 95.12 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 95.05 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 94.96 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 94.88 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 94.87 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 94.84 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 94.81 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 94.79 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 94.73 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 94.71 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 94.57 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 94.49 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 94.48 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 94.45 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 94.36 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 94.27 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 94.26 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 94.24 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 94.24 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 94.17 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 94.09 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 94.02 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 93.99 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 93.97 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 93.84 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 93.68 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 93.64 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 93.51 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 93.5 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 93.09 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 93.09 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 93.01 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 92.92 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 92.69 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 92.68 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 92.53 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 92.5 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 92.5 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 92.48 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 92.39 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 92.26 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 92.15 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 91.97 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 91.64 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 91.59 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 91.53 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 91.53 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 91.46 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 91.31 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 91.15 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 91.12 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 91.11 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 91.08 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 91.08 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 91.08 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 91.06 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 90.78 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 90.73 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 90.61 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 90.58 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 90.47 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 90.4 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 90.4 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 90.25 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 90.18 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 89.94 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 89.87 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 89.63 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 89.53 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 89.44 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 89.33 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 89.24 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 89.15 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 89.05 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 88.77 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 88.56 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 88.47 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 88.43 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 88.12 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 87.93 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 87.67 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 87.59 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 87.53 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 87.19 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 87.14 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 87.08 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 86.97 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 86.56 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 86.46 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 86.22 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 86.16 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 86.05 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 86.04 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 85.58 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 85.29 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 85.04 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 84.78 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 84.65 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 84.63 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 84.33 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 84.19 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 83.85 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 83.79 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 83.78 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 83.67 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 83.63 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 83.59 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 83.4 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 83.25 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 83.11 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 82.95 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 82.76 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 82.6 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 82.52 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 82.04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 81.99 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 81.97 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 81.97 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 81.97 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 81.96 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 81.73 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 81.59 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 81.54 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 81.53 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 81.24 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 81.23 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 80.91 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 80.91 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 80.88 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 80.53 |
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
Probab=99.62 E-value=5e-16 Score=122.57 Aligned_cols=111 Identities=46% Similarity=0.738 Sum_probs=101.6
Q ss_pred ccchHHHHhccccccccccCCcchHHHHHHHHHHHHhhhccCCccccccccccCCCCcHHHHHHHHHHHhhhcCCCCCCC
Q 040483 93 TRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKI 172 (231)
Q Consensus 93 skS~A~~ALkGLrFIskt~g~~~~~~gW~~VEkRFd~La~dG~L~Rs~FgeCIGM~dSkEFA~ELFDALaRRR~i~~~~I 172 (231)
++|+++.++.+|+||++.... +.|.+++++|+.+-.+|.|.++.|+.|+|++.+++++.+||.++.+++....+.|
T Consensus 4 ~~~~~~~~~~~l~~~~~~~~~----~~~~~~~~~F~~~D~dG~I~~~el~~~lg~~~~~~~~~~i~~~~d~~~~~~~~~i 79 (179)
T 3a8r_A 4 TKSSAAVALKGLQFVTAKVGN----DGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVL 79 (179)
T ss_dssp CHHHHHHHHHHHHHHHHHHCC----CCHHHHHHHHHHHCBTTBEEGGGHHHHHTCCSCHHHHHHHHHHHHHHHTCCSSEE
T ss_pred CCcchhhhHHHHHHHHhccch----hhHHHHHHHHhccCCCCCCcHHHHHHHHCCCCcHHHHHHHHHHHHHhccCCCCCc
Confidence 456677899999999987654 3699999999988889999999999999999999999999999999888777789
Q ss_pred CHHHHHHHHHHhhCCChhHHHHHHHHhhcCCCCce
Q 040483 173 TKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVI 207 (231)
Q Consensus 173 tK~EL~eFW~qIsDqsFDSRLQiFFDMvDKn~D~~ 207 (231)
+.+|+.+||.++++......|+..|.++|+|.||.
T Consensus 80 ~~~ef~~~~~~~~~~~~~~~l~~~F~~~D~d~dG~ 114 (179)
T 3a8r_A 80 TKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGR 114 (179)
T ss_dssp CHHHHHHHHHHHHCCCHHHHHHHHHHHHCTTCSSC
T ss_pred CHHHHHHHHHHHcCCCHHHHHHHHHHHHCCCCCCc
Confidence 99999999999999999999999999999999994
|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 231 | |||
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 98.12 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 98.0 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 97.93 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 97.68 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 97.68 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 97.36 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 97.25 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 97.14 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 96.34 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 95.53 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 95.38 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 94.25 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 94.17 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 93.91 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 92.84 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 91.77 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 91.75 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 91.56 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 90.68 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 90.37 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 90.05 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 89.88 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 89.19 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 88.42 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 88.4 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 88.04 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 87.86 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 87.66 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 87.62 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 87.53 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 87.33 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 87.26 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 86.41 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 85.78 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 85.4 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 85.12 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 84.75 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 83.82 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 83.03 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 82.9 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 81.46 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 80.73 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 80.68 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 80.5 |
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Frequenin (neuronal calcium sensor 1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.12 E-value=1.3e-06 Score=66.66 Aligned_cols=85 Identities=19% Similarity=0.212 Sum_probs=74.4
Q ss_pred HHHHHHHHhhhccCCcccccccccc----CCCCcHHHHHHHHHHHhhhcCCCCCCCCHHHHHHHHHHhhCCChhHHHHHH
Q 040483 121 RLVESTFESLSEDGLLAREDFGECI----GMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIF 196 (231)
Q Consensus 121 ~~VEkRFd~La~dG~L~Rs~FgeCI----GM~dSkEFA~ELFDALaRRR~i~~~~ItK~EL~eFW~qIsDqsFDSRLQiF 196 (231)
..+-++|.++..+|.+.+..|.+++ ++.++.++|..||+++.+.. .+.|+-+|+-.++..++..+.+.+++..
T Consensus 25 ~~l~~~F~~~~~~g~i~~~ef~~~~~~~~~~~~~~~~~~~if~~~d~~~---dg~I~~~EF~~~l~~~~~~~~~e~l~~~ 101 (187)
T d1g8ia_ 25 QQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENK---DGRIEFSEFIQALSVTSRGTLDEKLRWA 101 (187)
T ss_dssp HHHHHHHHHHCTTSEEEHHHHHHHHHHHCTTSCTHHHHHHHHHHHCTTC---SSEEEHHHHHHHHHHHHHCCHHHHHHHH
T ss_pred HHHHHHHHHHCCCCCcCHHHHHHHHHHhcCCCCHHHHHHHHHHHhCcCC---CCCCcHHHHHHHHHHhccCchhhhHHHH
Confidence 4567889999899999999998887 45678999999999996543 2569999999999999999999999999
Q ss_pred HHhhcCCCCcee
Q 040483 197 FDMYNHLLQVIR 208 (231)
Q Consensus 197 FDMvDKn~D~~~ 208 (231)
|.++|.|.||..
T Consensus 102 F~~~D~d~dG~i 113 (187)
T d1g8ia_ 102 FKLYDLDNDGYI 113 (187)
T ss_dssp HHHHCTTCSSEE
T ss_pred HHHHhcCCCCeE
Confidence 999999999963
|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|