Citrus Sinensis ID: 040483


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MRSLSRSSSRSNYSRTDYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQKFGWLRSGSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELEPLPTTTQI
cccccccccccccccccccccccccHHHHcccccccccccccccEEEEEccccccEEEEEcccccccccccccHHcccccHHHHHHHHHHHHcHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccHEcccccccccccccccEEEEEEEEccccEEEEEccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHcccEEEcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccc
mrslsrsssrsnysrtdygvgramLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQKfgwlrsgsspdieertmsgrDERRIKAKLQRTRSGAKRALNGLRFIskaagasdAEELRRLVESTFESLSedgllaredfgecigmvdskEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIrlippdfnpllsreleplptttqi
mrslsrsssrsnysrtdygvgRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQkfgwlrsgsspdieertmsgrderrikaklqrtrsgakralnglrfiskaagasdaeELRRLVESTFeslsedgllAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFnpllsreleplptttqi
MrslsrsssrsnysrTDYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQKFGWLRSGSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELEPLPTTTQI
*****************YGVGRAMLPIFLNDL**********DLVELTIELEDDAVVFRQKFGWLR*****************************************************************EDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPL**************
*******************************************LVELTIELEDDAV********************************************LNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQ***KITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELEPLP*****
**************RTDYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQKFGWLRSGSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELE********
***************************************QAQDLVELTIELEDDAVVFRQKFGW***********************************ALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELEPLP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSLSRSSSRSNYSRTDYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDAVVFRQKFGWLRSGSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVIRLIPPDFNPLLSRELEPLPTTTQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
O81211 952 Respiratory burst oxidase yes no 0.774 0.188 0.453 3e-44
Q948U0 963 Respiratory burst oxidase N/A no 0.437 0.104 0.590 1e-28
O48538 944 Respiratory burst oxidase no no 0.558 0.136 0.492 2e-28
Q948T9 867 Respiratory burst oxidase N/A no 0.463 0.123 0.531 3e-25
Q9SBI0 843 Respiratory burst oxidase no no 0.632 0.173 0.426 1e-24
O81210 905 Respiratory burst oxidase no no 0.705 0.180 0.379 1e-23
Q9SUT8 941 Probable respiratory burs no no 0.454 0.111 0.508 2e-22
Q2HXL0 938 Respiratory burst oxidase N/A no 0.536 0.132 0.454 4e-22
Q5ZAJ0 905 Respiratory burst oxidase no no 0.484 0.123 0.465 2e-21
Q6J2K5 905 Respiratory burst oxidase N/A no 0.484 0.123 0.465 2e-21
>sp|O81211|RBOHE_ARATH Respiratory burst oxidase homolog protein E OS=Arabidopsis thaliana GN=RBOHE PE=2 SV=2 Back     alignment and function desciption
 Score =  178 bits (451), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 147/247 (59%), Gaps = 68/247 (27%)

Query: 21  GRAMLPIFLNDLSRNSQQEQA-----QDLVELTIELE--DDAVV---------------- 57
           G AMLP+FLNDLSRNS +  +     ++LVE+T+EL+  DD+++                
Sbjct: 33  GGAMLPVFLNDLSRNSGESGSGSSWERELVEVTLELDVGDDSILVCGMSEAASVDSRARS 92

Query: 58  ------------------FRQKFG-------WLRSGSSP------DIEERT------MSG 80
                              RQK G       W  + SS       D+E +T      ++ 
Sbjct: 93  VDLVTARLSRNLSNASTRIRQKLGKLLRSESWKTTTSSTAGERDRDLERQTAVTLGILTA 152

Query: 81  RDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAE--------ELRRLVESTFESLSE 132
           RD+R+  AKLQR+ S A+RAL GL+FI+K    +           ++ + VE  FESLS+
Sbjct: 153 RDKRKEDAKLQRSTSSAQRALKGLQFINKTTRGNSCVCDWDCDCDQMWKKVEKRFESLSK 212

Query: 133 DGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDAR 192
           +GLLAR+DFGEC+GMVDSK+FAV +FDALARRR QK+ KITK+EL +FWLQISDQSFDAR
Sbjct: 213 NGLLARDDFGECVGMVDSKDFAVSVFDALARRRRQKLEKITKDELHDFWLQISDQSFDAR 272

Query: 193 LQIFFDM 199
           LQIFFDM
Sbjct: 273 LQIFFDM 279




Calcium-dependent NADPH oxidase that generates superoxide.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 3EC: .EC: -
>sp|Q948U0|RBOHA_SOLTU Respiratory burst oxidase homolog protein A OS=Solanum tuberosum GN=RBOHA PE=1 SV=1 Back     alignment and function description
>sp|O48538|RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana GN=RBOHF PE=1 SV=1 Back     alignment and function description
>sp|Q948T9|RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum GN=RBOHB PE=1 SV=1 Back     alignment and function description
>sp|Q9SBI0|RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana GN=RBOHB PE=2 SV=1 Back     alignment and function description
>sp|O81210|RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana GN=RBOHC PE=2 SV=2 Back     alignment and function description
>sp|Q9SUT8|RBOHI_ARATH Probable respiratory burst oxidase homolog protein I OS=Arabidopsis thaliana GN=RBOHI PE=3 SV=2 Back     alignment and function description
>sp|Q2HXL0|RBOHC_SOLTU Respiratory burst oxidase homolog protein C OS=Solanum tuberosum GN=RBOHC PE=1 SV=2 Back     alignment and function description
>sp|Q5ZAJ0|RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica GN=RBOHB PE=1 SV=1 Back     alignment and function description
>sp|Q6J2K5|RBOHB_ORYSI Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. indica GN=RBOHB PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
225444627 917 PREDICTED: respiratory burst oxidase hom 0.818 0.206 0.596 8e-65
255550343 934 respiratory burst oxidase, putative [Ric 0.805 0.199 0.536 2e-52
449450207 896 PREDICTED: LOW QUALITY PROTEIN: respirat 0.735 0.189 0.557 2e-49
449477631 881 PREDICTED: respiratory burst oxidase hom 0.735 0.192 0.557 3e-49
356558443 972 PREDICTED: respiratory burst oxidase hom 0.748 0.177 0.489 5e-48
356556422 899 PREDICTED: respiratory burst oxidase hom 0.735 0.189 0.489 3e-47
356530463 892 PREDICTED: respiratory burst oxidase hom 0.735 0.190 0.5 3e-46
326532616 958 predicted protein [Hordeum vulgare subsp 0.731 0.176 0.497 4e-46
218202208 877 hypothetical protein OsI_31509 [Oryza sa 0.528 0.139 0.704 1e-42
357528848 952 RecName: Full=Respiratory burst oxidase 0.774 0.188 0.453 2e-42
>gi|225444627|ref|XP_002277540.1| PREDICTED: respiratory burst oxidase homolog protein E [Vitis vinifera] gi|297738517|emb|CBI27762.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 142/238 (59%), Positives = 163/238 (68%), Gaps = 49/238 (20%)

Query: 7   SSSRSNYSRT-----------DYGVGRAMLPIFLNDLSRNSQQEQAQDLVELTIELEDDA 55
           SS RSNYSRT           DY VG AMLPIFLNDL  N +Q    DLVE+T+ELEDD+
Sbjct: 9   SSKRSNYSRTYDFPEELVDSGDYAVGGAMLPIFLNDLRPNHRQ----DLVEVTLELEDDS 64

Query: 56  VVFR-------------------------------QKFGWLRSGSS---PDIEERTMSGR 81
           +V                                 +KF WLRS SS    + E+ T+S R
Sbjct: 65  IVLCSVTPTATANPSGDEAATGFLGRSLSATSKLCRKFSWLRSTSSRASSEAEDPTISAR 124

Query: 82  DERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDF 141
           D R+I AKLQRTRS A++AL GLRFI K  GASDA+EL + VES F+SL++DGLL+REDF
Sbjct: 125 DARKITAKLQRTRSSAQQALKGLRFIRKTTGASDADELWKKVESRFKSLAKDGLLSREDF 184

Query: 142 GECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDM 199
           GECIGMVDSKEFAVGIFDALARRR QK+G+ITKEEL +FWLQISDQSFDARLQIFFDM
Sbjct: 185 GECIGMVDSKEFAVGIFDALARRRRQKMGRITKEELRDFWLQISDQSFDARLQIFFDM 242




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255550343|ref|XP_002516222.1| respiratory burst oxidase, putative [Ricinus communis] gi|223544708|gb|EEF46224.1| respiratory burst oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449450207|ref|XP_004142855.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog protein E-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449477631|ref|XP_004155076.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356558443|ref|XP_003547516.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] Back     alignment and taxonomy information
>gi|356556422|ref|XP_003546525.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] Back     alignment and taxonomy information
>gi|356530463|ref|XP_003533800.1| PREDICTED: respiratory burst oxidase homolog protein E-like [Glycine max] Back     alignment and taxonomy information
>gi|326532616|dbj|BAK05237.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|218202208|gb|EEC84635.1| hypothetical protein OsI_31509 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|357528848|sp|O81211.2|RBOHE_ARATH RecName: Full=Respiratory burst oxidase homolog protein E; AltName: Full=NADPH oxidase RBOHE; Short=AtRBOHE Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
TAIR|locus:2024603 944 RBOH F "respiratory burst oxid 0.558 0.136 0.492 3.4e-26
TAIR|locus:2036104 843 RBOHB "respiratory burst oxida 0.649 0.177 0.440 2.6e-22
TAIR|locus:2128248 941 AT4G11230 [Arabidopsis thalian 0.601 0.147 0.437 7e-22
TAIR|locus:2157348 905 RHD2 "ROOT HAIR DEFECTIVE 2" [ 0.502 0.128 0.508 5.6e-21
UNIPROTKB|Q5ZAJ0 905 RBOHB "Respiratory burst oxida 0.593 0.151 0.425 1.2e-20
TAIR|locus:2183309 902 RBOHA "respiratory burst oxida 0.467 0.119 0.495 7.7e-19
TAIR|locus:2117258 849 AT4G25090 [Arabidopsis thalian 0.463 0.126 0.5 2.4e-18
TAIR|locus:2160917 921 RBOHD "respiratory burst oxida 0.506 0.127 0.464 7.3e-18
TAIR|locus:2168113 886 AT5G60010 [Arabidopsis thalian 0.584 0.152 0.375 8.1e-17
TAIR|locus:2077192 912 AT3G45810 [Arabidopsis thalian 0.476 0.120 0.410 3.7e-16
TAIR|locus:2024603 RBOH F "respiratory burst oxidase protein F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 3.4e-26, P = 3.4e-26
 Identities = 65/132 (49%), Positives = 87/132 (65%)

Query:    68 GSSPDIEERTMSGRDERRIKAKLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTF 127
             G+   +    +  R  R+ +A+L RTRS A+RAL GLRFIS      D       V+S F
Sbjct:   147 GAGGGLVNSALEARALRKQRAQLDRTRSSAQRALRGLRFISNKQKNVDGWND---VQSNF 203

Query:   128 ESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQ 187
             E   ++G + R DF +CIGM DSKEFA+ +FDAL+RRR  K+ KI  +EL E+W QI+D+
Sbjct:   204 EKFEKNGYIYRSDFAQCIGMKDSKEFALELFDALSRRRRLKVEKINHDELYEYWSQINDE 263

Query:   188 SFDARLQIFFDM 199
             SFD+RLQIFFD+
Sbjct:   264 SFDSRLQIFFDI 275




GO:0004601 "peroxidase activity" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050664 "oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor" evidence=IEA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA;TAS
GO:0006952 "defense response" evidence=IMP
GO:0043069 "negative regulation of programmed cell death" evidence=RCA;IMP
GO:0072593 "reactive oxygen species metabolic process" evidence=IMP
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA;TAS
GO:0016174 "NAD(P)H oxidase activity" evidence=IMP;TAS
GO:0009723 "response to ethylene stimulus" evidence=RCA;IMP
GO:0010119 "regulation of stomatal movement" evidence=IMP
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA;IMP
GO:0002679 "respiratory burst involved in defense response" evidence=IMP
GO:0050832 "defense response to fungus" evidence=RCA;IMP
GO:0052542 "defense response by callose deposition" evidence=RCA;IMP
GO:0007231 "osmosensory signaling pathway" evidence=IMP
GO:0033500 "carbohydrate homeostasis" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0007154 "cell communication" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0005887 "integral to plasma membrane" evidence=IMP
TAIR|locus:2036104 RBOHB "respiratory burst oxidase homolog B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128248 AT4G11230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157348 RHD2 "ROOT HAIR DEFECTIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZAJ0 RBOHB "Respiratory burst oxidase homolog protein B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2183309 RBOHA "respiratory burst oxidase homolog A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117258 AT4G25090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160917 RBOHD "respiratory burst oxidase homologue D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168113 AT5G60010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077192 AT3G45810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00016386001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (917 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
pfam0841496 pfam08414, NADPH_Ox, Respiratory burst NADPH oxida 3e-42
>gnl|CDD|203934 pfam08414, NADPH_Ox, Respiratory burst NADPH oxidase Back     alignment and domain information
 Score =  138 bits (349), Expect = 3e-42
 Identities = 60/99 (60%), Positives = 69/99 (69%), Gaps = 3/99 (3%)

Query: 93  TRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKE 152
           T+S A RAL GL+FISK  G  D       VE  F+ L+ DG L R  FGECIGM DSKE
Sbjct: 1   TKSSAARALKGLKFISKTDGGVDG---WNEVEKRFDKLAVDGYLPRSKFGECIGMNDSKE 57

Query: 153 FAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDA 191
           FA+ +FDALARRR  K+  ITKEEL EFW QI+DQSFD+
Sbjct: 58  FALELFDALARRRRIKVDSITKEELKEFWEQITDQSFDS 96


This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N-terminus of an EF-hand (pfam00036), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants. Length = 96

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
PF08414100 NADPH_Ox: Respiratory burst NADPH oxidase; InterPr 100.0
PTZ00183158 centrin; Provisional 96.55
PTZ00184149 calmodulin; Provisional 96.17
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 91.82
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 90.05
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 87.79
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 85.81
>PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism Back     alignment and domain information
Probab=100.00  E-value=7.3e-57  Score=354.39  Aligned_cols=100  Identities=66%  Similarity=1.019  Sum_probs=79.4

Q ss_pred             hhhhccchHHHHhccccccccccCCcchHHHHHHHHHHHHhhhccCCccccccccccCCCCcHHHHHHHHHHHhhhcCCC
Q 040483           89 KLQRTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQK  168 (231)
Q Consensus        89 ~ldRskS~A~~ALkGLrFIskt~g~~~~~~gW~~VEkRFd~La~dG~L~Rs~FgeCIGM~dSkEFA~ELFDALaRRR~i~  168 (231)
                      +|+||+|+|++||||||||++++++.   ++|++||+||++|++||+|||++||+||||+||||||+||||||||||+|+
T Consensus         1 rldRt~S~A~~ALkGLrFIskt~~~~---~~W~~VE~RFd~La~dG~L~rs~Fg~CIGM~dSkeFA~eLFdALaRrr~i~   77 (100)
T PF08414_consen    1 RLDRTKSGAQRALKGLRFISKTTGGA---DGWKEVEKRFDKLAKDGLLPRSDFGECIGMKDSKEFAGELFDALARRRGIK   77 (100)
T ss_dssp             -----HHHHHHHHHHHHHHHHHH--------HHHHHHHHHHH-BTTBEEGGGHHHHHT--S-HHHHHHHHHHHHHHTT--
T ss_pred             CCCcchhHHHHHHhcccceecCCCCc---cCHHHHHHHHHHhCcCCcccHHHHHHhcCCcccHHHHHHHHHHHHHhcCCc
Confidence            58999999999999999999998874   589999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHhhCCChhH
Q 040483          169 IGKITKEELGEFWLQISDQSFDA  191 (231)
Q Consensus       169 ~~~ItK~EL~eFW~qIsDqsFDS  191 (231)
                      .++|||+||+|||+|||||||||
T Consensus        78 ~~~I~k~eL~efW~qisD~sFDs  100 (100)
T PF08414_consen   78 GDSITKDELKEFWEQISDQSFDS  100 (100)
T ss_dssp             SSEE-HHHHHHHHHHHH---HHH
T ss_pred             cCCcCHHHHHHHHHHhhccCCCC
Confidence            99999999999999999999997



It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.

>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3a8r_A179 The Structure Of The N-Terminal Regulatory Domain O 9e-20
>pdb|3A8R|A Chain A, The Structure Of The N-Terminal Regulatory Domain Of A Plant Nadph Oxidase Length = 179 Back     alignment and structure

Iteration: 1

Score = 93.6 bits (231), Expect = 9e-20, Method: Compositional matrix adjust. Identities = 51/110 (46%), Positives = 69/110 (62%), Gaps = 4/110 (3%) Query: 93 TRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKE 152 T+S A AL GL+F++ G + VE F L DG+L R FG+CIGM S E Sbjct: 4 TKSSAAVALKGLQFVTAKVG----NDGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDE 59 Query: 153 FAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYNH 202 FAV +FD+LAR+RG +TK+EL +F+ Q++DQ FD RL+ FFDM + Sbjct: 60 FAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVDK 109

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 9e-41
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Length = 179 Back     alignment and structure
 Score =  136 bits (344), Expect = 9e-41
 Identities = 51/110 (46%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 92  RTRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSK 151
            T+S A  AL GL+F++   G          VE  F  L  DG+L R  FG+CIGM  S 
Sbjct: 3   GTKSSAAVALKGLQFVTAKVGNDGWAA----VEKRFNQLQVDGVLLRSRFGKCIGMDGSD 58

Query: 152 EFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIFFDMYN 201
           EFAV +FD+LAR+RG     +TK+EL +F+ Q++DQ FD RL+ FFDM +
Sbjct: 59  EFAVQMFDSLARKRGIVKQVLTKDELKDFYEQLTDQGFDNRLRTFFDMVD 108


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.62
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 97.42
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 97.34
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 97.24
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 97.15
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 97.05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 96.98
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 96.94
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 96.9
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 96.83
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 96.8
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 96.77
2jnf_A158 Troponin C; stretch activated muscle contraction, 96.75
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 96.73
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 96.72
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 96.71
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 96.71
3fwb_A161 Cell division control protein 31; gene gating, com 96.68
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 96.63
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 96.61
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.61
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 96.49
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 96.47
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 96.45
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 96.45
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 96.44
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 96.4
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.39
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 96.37
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 96.34
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.33
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 96.27
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 96.25
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 96.24
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 96.24
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 96.21
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 96.2
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 96.2
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 96.2
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 96.19
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 96.18
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 96.16
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.13
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 96.08
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 96.05
1y1x_A191 Leishmania major homolog of programmed cell death 96.05
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.91
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 95.84
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 95.73
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 95.7
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 95.66
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 95.61
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 95.58
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 95.58
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 95.48
3akb_A166 Putative calcium binding protein; EF-hand, metal b 95.46
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.44
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 95.4
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.39
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.38
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 95.33
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 95.32
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 95.3
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 95.25
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.22
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.2
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 95.14
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.12
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 95.12
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 95.05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 94.96
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 94.88
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 94.87
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.84
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 94.81
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 94.79
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 94.73
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 94.71
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 94.57
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 94.49
1y1x_A191 Leishmania major homolog of programmed cell death 94.48
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.45
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 94.36
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.27
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 94.26
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 94.24
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 94.24
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 94.17
3lij_A494 Calcium/calmodulin dependent protein kinase with A 94.09
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 94.02
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 93.99
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 93.97
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 93.84
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 93.68
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 93.64
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 93.51
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 93.5
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 93.09
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 93.09
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 93.01
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 92.92
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 92.69
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 92.68
3li6_A66 Calcium-binding protein; calcium signaling protein 92.53
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 92.5
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 92.5
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 92.48
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 92.39
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 92.26
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 92.15
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 91.97
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 91.64
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 91.59
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 91.53
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 91.53
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 91.46
2jnf_A158 Troponin C; stretch activated muscle contraction, 91.31
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 91.15
3fwb_A161 Cell division control protein 31; gene gating, com 91.12
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 91.11
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 91.08
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 91.08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 91.08
3akb_A166 Putative calcium binding protein; EF-hand, metal b 91.06
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 90.78
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 90.73
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 90.61
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 90.58
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 90.47
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 90.4
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 90.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 90.25
3a4u_B143 Multiple coagulation factor deficiency protein 2; 90.18
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 89.94
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 89.87
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 89.63
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 89.53
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.44
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 89.33
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 89.24
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 89.15
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 89.05
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 88.77
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 88.56
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 88.47
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 88.43
3a4u_B143 Multiple coagulation factor deficiency protein 2; 88.12
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 87.93
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 87.67
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 87.59
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 87.53
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 87.19
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 87.14
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 87.08
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 86.97
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 86.56
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 86.46
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 86.22
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 86.16
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 86.05
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 86.04
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 85.58
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 85.29
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 85.04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 84.78
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 84.65
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 84.63
1exr_A148 Calmodulin; high resolution, disorder, metal trans 84.33
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 84.19
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 83.85
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 83.79
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 83.78
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 83.67
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 83.63
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 83.59
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 83.4
2lv7_A100 Calcium-binding protein 7; metal binding protein; 83.25
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 83.11
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 82.95
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 82.76
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 82.6
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 82.52
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 82.04
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 81.99
2hps_A186 Coelenterazine-binding protein with bound coelent; 81.97
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 81.97
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 81.97
3lij_A494 Calcium/calmodulin dependent protein kinase with A 81.96
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 81.73
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 81.59
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 81.54
1avs_A90 Troponin C; muscle contraction, calcium-activated, 81.53
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 81.24
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 81.23
1qjt_A99 EH1, epidermal growth factor receptor substrate su 80.91
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 80.91
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 80.88
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 80.53
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
Probab=99.62  E-value=5e-16  Score=122.57  Aligned_cols=111  Identities=46%  Similarity=0.738  Sum_probs=101.6

Q ss_pred             ccchHHHHhccccccccccCCcchHHHHHHHHHHHHhhhccCCccccccccccCCCCcHHHHHHHHHHHhhhcCCCCCCC
Q 040483           93 TRSGAKRALNGLRFISKAAGASDAEELRRLVESTFESLSEDGLLAREDFGECIGMVDSKEFAVGIFDALARRRGQKIGKI  172 (231)
Q Consensus        93 skS~A~~ALkGLrFIskt~g~~~~~~gW~~VEkRFd~La~dG~L~Rs~FgeCIGM~dSkEFA~ELFDALaRRR~i~~~~I  172 (231)
                      ++|+++.++.+|+||++....    +.|.+++++|+.+-.+|.|.++.|+.|+|++.+++++.+||.++.+++....+.|
T Consensus         4 ~~~~~~~~~~~l~~~~~~~~~----~~~~~~~~~F~~~D~dG~I~~~el~~~lg~~~~~~~~~~i~~~~d~~~~~~~~~i   79 (179)
T 3a8r_A            4 TKSSAAVALKGLQFVTAKVGN----DGWAAVEKRFNQLQVDGVLLRSRFGKCIGMDGSDEFAVQMFDSLARKRGIVKQVL   79 (179)
T ss_dssp             CHHHHHHHHHHHHHHHHHHCC----CCHHHHHHHHHHHCBTTBEEGGGHHHHHTCCSCHHHHHHHHHHHHHHHTCCSSEE
T ss_pred             CCcchhhhHHHHHHHHhccch----hhHHHHHHHHhccCCCCCCcHHHHHHHHCCCCcHHHHHHHHHHHHHhccCCCCCc
Confidence            456677899999999987654    3699999999988889999999999999999999999999999999888777789


Q ss_pred             CHHHHHHHHHHhhCCChhHHHHHHHHhhcCCCCce
Q 040483          173 TKEELGEFWLQISDQSFDARLQIFFDMYNHLLQVI  207 (231)
Q Consensus       173 tK~EL~eFW~qIsDqsFDSRLQiFFDMvDKn~D~~  207 (231)
                      +.+|+.+||.++++......|+..|.++|+|.||.
T Consensus        80 ~~~ef~~~~~~~~~~~~~~~l~~~F~~~D~d~dG~  114 (179)
T 3a8r_A           80 TKDELKDFYEQLTDQGFDNRLRTFFDMVDKNADGR  114 (179)
T ss_dssp             CHHHHHHHHHHHHCCCHHHHHHHHHHHHCTTCSSC
T ss_pred             CHHHHHHHHHHHcCCCHHHHHHHHHHHHCCCCCCc
Confidence            99999999999999999999999999999999994



>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.12
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.0
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.93
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 97.68
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 97.68
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 97.36
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 97.25
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 97.14
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 96.34
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 95.53
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 95.38
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 94.25
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 94.17
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 93.91
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 92.84
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.77
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 91.75
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 91.56
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 90.68
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.37
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 90.05
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 89.88
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.19
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 88.42
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 88.4
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 88.04
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 87.86
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 87.66
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 87.62
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 87.53
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 87.33
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 87.26
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 86.41
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 85.78
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 85.4
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 85.12
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 84.75
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 83.82
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 83.03
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 82.9
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 81.46
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 80.73
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 80.68
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 80.5
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Frequenin (neuronal calcium sensor 1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.12  E-value=1.3e-06  Score=66.66  Aligned_cols=85  Identities=19%  Similarity=0.212  Sum_probs=74.4

Q ss_pred             HHHHHHHHhhhccCCcccccccccc----CCCCcHHHHHHHHHHHhhhcCCCCCCCCHHHHHHHHHHhhCCChhHHHHHH
Q 040483          121 RLVESTFESLSEDGLLAREDFGECI----GMVDSKEFAVGIFDALARRRGQKIGKITKEELGEFWLQISDQSFDARLQIF  196 (231)
Q Consensus       121 ~~VEkRFd~La~dG~L~Rs~FgeCI----GM~dSkEFA~ELFDALaRRR~i~~~~ItK~EL~eFW~qIsDqsFDSRLQiF  196 (231)
                      ..+-++|.++..+|.+.+..|.+++    ++.++.++|..||+++.+..   .+.|+-+|+-.++..++..+.+.+++..
T Consensus        25 ~~l~~~F~~~~~~g~i~~~ef~~~~~~~~~~~~~~~~~~~if~~~d~~~---dg~I~~~EF~~~l~~~~~~~~~e~l~~~  101 (187)
T d1g8ia_          25 QQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENK---DGRIEFSEFIQALSVTSRGTLDEKLRWA  101 (187)
T ss_dssp             HHHHHHHHHHCTTSEEEHHHHHHHHHHHCTTSCTHHHHHHHHHHHCTTC---SSEEEHHHHHHHHHHHHHCCHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCcCHHHHHHHHHHhcCCCCHHHHHHHHHHHhCcCC---CCCCcHHHHHHHHHHhccCchhhhHHHH
Confidence            4567889999899999999998887    45678999999999996543   2569999999999999999999999999


Q ss_pred             HHhhcCCCCcee
Q 040483          197 FDMYNHLLQVIR  208 (231)
Q Consensus       197 FDMvDKn~D~~~  208 (231)
                      |.++|.|.||..
T Consensus       102 F~~~D~d~dG~i  113 (187)
T d1g8ia_         102 FKLYDLDNDGYI  113 (187)
T ss_dssp             HHHHCTTCSSEE
T ss_pred             HHHHhcCCCCeE
Confidence            999999999963



>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure