Citrus Sinensis ID: 040515


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
ccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccccEEcccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEEEcc
ccEEcEccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccHHHHHHHHHcccEcccccccHHHcccccEcccccEEHHHHHHHcccccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHcccHHHEEEEEccccccHHHHHHHHHHHHHHHcccccEEEcEEEccHHHHcEcHHHHHHHHHHHHHHHHHHcEEccccccccEccccccEccccccEEcccccEEEEEEEEcccEEEEEEEEccc
GPNHAAVTACATGAHSIGDAArmiqfgdsdvmvaggtessiDALSMAGFCksralttkyngtpqeasrpfdcgrdgfeLEHAKKRGAKIYAEVRgygmsgdahhitqphidgKGAILAMTRALKQsglqshqvdyvnahatstplgdtveATAIRTVfsdhatsgslafsstKGAIGHLLGAAGAVEAIFAVLTIHhgvapltlnlakpdpifndnfmpltaskdmpisaalsnsfgfggtnaslLFTKCQ
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTkyngtpqeasrpfdCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKgaighllgaagaVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
******VTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKY************CGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLF****
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
*********CATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKC*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q8L3X9461 3-oxoacyl-[acyl-carrier-p yes no 0.984 0.535 0.776 1e-115
P56902421 3-oxoacyl-[acyl-carrier-p yes no 0.976 0.581 0.555 9e-73
O94297426 Putative 3-oxoacyl-[acyl- yes no 0.980 0.577 0.519 2e-70
Q9NWU1459 3-oxoacyl-[acyl-carrier-p yes no 0.960 0.525 0.552 7e-69
Q9D404459 3-oxoacyl-[acyl-carrier-p yes no 0.960 0.525 0.544 4e-68
O34340413 3-oxoacyl-[acyl-carrier-p yes no 0.980 0.595 0.513 3e-66
Q83E37414 3-oxoacyl-[acyl-carrier-p yes no 0.980 0.594 0.496 8e-66
Q9KQH9414 3-oxoacyl-[acyl-carrier-p yes no 0.984 0.596 0.505 2e-64
P55338415 3-oxoacyl-[acyl-carrier-p yes no 0.984 0.595 0.503 7e-64
Q0VCA7460 3-oxoacyl-[acyl-carrier-p yes no 0.960 0.523 0.540 1e-61
>sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 Back     alignment and function desciption
 Score =  413 bits (1061), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/259 (77%), Positives = 224/259 (86%), Gaps = 12/259 (4%)

Query: 1   GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYN 60
           GPNHAAVTACATGAHSIGDA RMIQFGD+DVMVAGGTESSIDALS+AGF +SRAL+TK+N
Sbjct: 200 GPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFN 259

Query: 61  GTPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQP 108
            +PQEASRPFDC RDGF            E EHAK+RGAKIYAE+ GYGMSGDAHHITQP
Sbjct: 260 SSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQP 319

Query: 109 HIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLA 168
             DGKGA+LAMTRAL+QSGL  +Q+DYVNAHATSTP+GD VEA AI+TVFS+HATSG+LA
Sbjct: 320 PEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATSGTLA 379

Query: 169 FSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPI 228
           FSSTKGA GHLLGAAGAVEAIF++L IHHGVAP+TLN+  PDPIF+  FMPLT SK M +
Sbjct: 380 FSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLV 439

Query: 229 SAALSNSFGFGGTNASLLF 247
             A+SNSFGFGGTNASLLF
Sbjct: 440 RTAMSNSFGFGGTNASLLF 458




Catalyzes all the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Able to elongate saturated acyl chains from 4 to at least 16 carbons. Uses malonyl-CoA but not acetyl-CoA as primer substrate. When expressed in a heterologous system, reveals a bimodal distribution of products, with peaks at C8 and C14-C16.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 1
>sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 Back     alignment and function description
>sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 Back     alignment and function description
>sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 Back     alignment and function description
>sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=2 SV=1 Back     alignment and function description
>sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=3 SV=1 Back     alignment and function description
>sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 Back     alignment and function description
>sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=3 SV=3 Back     alignment and function description
>sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 Back     alignment and function description
>sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 Back     alignment and function description

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2058359461 AT2G04540 [Arabidopsis thalian 0.984 0.535 0.733 3.2e-97
ASPGD|ASPL0000064843430 AN7489 [Emericella nidulans (t 0.988 0.576 0.527 3.7e-64
UNIPROTKB|E1BYY7461 OXSM "3-oxoacyl-[acyl-carrier- 0.976 0.531 0.517 9.7e-64
UNIPROTKB|Q0C090428 fabF "3-oxoacyl-[acyl-carrier- 0.980 0.574 0.521 2.6e-63
TIGR_CMR|SPO_2271421 SPO_2271 "3-oxoacyl-(acyl carr 0.976 0.581 0.494 9.3e-59
TIGR_CMR|APH_0930423 APH_0930 "3-oxoacyl-(acyl-carr 0.968 0.574 0.496 1.9e-58
UNIPROTKB|F1RS43273 OXSM "Uncharacterized protein" 0.960 0.882 0.505 3.2e-58
UNIPROTKB|Q9NWU1459 OXSM "3-oxoacyl-[acyl-carrier- 0.960 0.525 0.509 4e-58
POMBASE|SPBC887.13c426 SPBC887.13c "3-oxoacyl-[acyl-c 0.980 0.577 0.484 4e-58
UNIPROTKB|E2R866460 OXSM "3-oxoacyl-[acyl-carrier- 0.960 0.523 0.509 5.1e-58
TAIR|locus:2058359 AT2G04540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 966 (345.1 bits), Expect = 3.2e-97, P = 3.2e-97
 Identities = 190/259 (73%), Positives = 213/259 (82%)

Query:     1 GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYN 60
             GPNHAAVTACATGAHSIGDA RMIQFGD+DVMVAGGTESSIDALS+AGF +SRAL+TK+N
Sbjct:   200 GPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFN 259

Query:    61 GTPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQP 108
              +PQEASRPFDC RDGF            E EHAK+RGAKIYAE+ GYGMSGDAHHITQP
Sbjct:   260 SSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQP 319

Query:   109 HIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLA 168
               DGKGA+LAMTRAL+QSGL  +Q+DYVNAHATSTP+GD VEA AI+TVFS+HATSG+LA
Sbjct:   320 PEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATSGTLA 379

Query:   169 FSSTKXXXXXXXXXXXXVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPI 228
             FSSTK            VEAIF++L IHHGVAP+TLN+  PDPIF+  FMPLT SK M +
Sbjct:   380 FSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLV 439

Query:   229 SAALSNSFGFGGTNASLLF 247
               A+SNSFGFGGTNASLLF
Sbjct:   440 RTAMSNSFGFGGTNASLLF 458




GO:0003824 "catalytic activity" evidence=IEA
GO:0004312 "fatty acid synthase activity" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0006633 "fatty acid biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0042335 "cuticle development" evidence=RCA
ASPGD|ASPL0000064843 AN7489 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYY7 OXSM "3-oxoacyl-[acyl-carrier-protein] synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C090 fabF "3-oxoacyl-[acyl-carrier-protein] synthase 2" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2271 SPO_2271 "3-oxoacyl-(acyl carrier protein) synthase II" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|APH_0930 APH_0930 "3-oxoacyl-(acyl-carrier-protein) synthase II" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
UNIPROTKB|F1RS43 OXSM "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NWU1 OXSM "3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPBC887.13c SPBC887.13c "3-oxoacyl-[acyl-carrier-protein]-synthase condensing enzyme (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E2R866 OXSM "3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L3X9KASM_ARATH2, ., 3, ., 1, ., 4, 10.77600.98400.5357yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.II.519.1
3-oxoacyl-[acyl-carrier-protein] synthase II (EC-2.3.1.179) (415 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_LG_IX0832
[acyl-carrier protein] S-malonyltransferase (EC-2.3.1.39) (371 aa)
   0.982
gw1.III.1824.1
hypothetical protein (176 aa)
      0.922
grail3.0116012802
enoyl-[acyl-carrier-protein] reductase (EC-1.3.1.10) (395 aa)
      0.909
eugene3.00031909
enoyl-[acyl-carrier-protein] reductase (EC-1.3.1.10) (395 aa)
      0.908
eugene3.00160402
SubName- Full=Putative uncharacterized protein; (391 aa)
      0.908
gw1.VIII.2033.1
hypothetical protein (266 aa)
      0.905
gw1.XV.2222.1
hypothetical protein (278 aa)
       0.899
gw1.XII.1777.1
hypothetical protein (278 aa)
       0.899
gw1.V.169.1
acyl- [acyl-carrier protein] desaturase (EC-1.14.19.2); Converts stearoyl-ACP to oleoyl-ACP by [...] (352 aa)
       0.899
gw1.I.9606.1
hypothetical protein (292 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
PLN02836437 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protei 1e-168
TIGR03150407 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protei 1e-134
PRK07314411 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protei 1e-132
cd00834406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot 1e-124
PTZ00050421 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein 1e-118
PRK06333424 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protei 1e-107
COG0304412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy 1e-105
PRK08439406 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protei 1e-77
PRK08722414 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protei 3e-77
PRK14691342 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protei 2e-70
PLN02787540 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protei 4e-70
PRK07967406 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protei 2e-68
PRK07910418 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protei 2e-67
PRK06501425 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protei 5e-62
PRK05952381 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protei 4e-60
PRK09185392 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protei 1e-59
PRK09116405 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protei 7e-54
cd00833421 cd00833, PKS, polyketide synthases (PKSs) polymeri 4e-49
cd00828407 cd00828, elong_cond_enzymes, "elongating" condensi 7e-44
PRK07103410 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl 1e-41
pfam02801119 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase 3e-41
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating co 4e-36
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 4e-31
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 1e-28
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family 1e-23
cd00832399 cd00832, CLF, Chain-length factor (CLF) is a facto 7e-20
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 2e-14
smart00825298 smart00825, PKS_KS, Beta-ketoacyl synthase 1e-13
cd00751386 cd00751, thiolase, Thiolase are ubiquitous enzymes 8e-07
PRK05790393 PRK05790, PRK05790, putative acyltransferase; Prov 1e-04
PRK09052399 PRK09052, PRK09052, acetyl-CoA acetyltransferase; 3e-04
TIGR01930386 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltrans 5e-04
PRK06445394 PRK06445, PRK06445, acetyl-CoA acetyltransferase; 6e-04
pfam00108262 pfam00108, Thiolase_N, Thiolase, N-terminal domain 8e-04
cd00751386 cd00751, thiolase, Thiolase are ubiquitous enzymes 0.002
COG0183392 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid 0.002
PRK06205404 PRK06205, PRK06205, acetyl-CoA acetyltransferase; 0.004
PRK06147348 PRK06147, PRK06147, 3-oxoacyl-(acyl carrier protei 0.004
>gnl|CDD|215449 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
 Score =  472 bits (1217), Expect = e-168
 Identities = 211/260 (81%), Positives = 228/260 (87%), Gaps = 12/260 (4%)

Query: 1   GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYN 60
           GPNHAAVTACATGAHSIGDA RMIQFGD+DVMVAGGTESSIDALS+AGF +SRAL+TK+N
Sbjct: 175 GPNHAAVTACATGAHSIGDAFRMIQFGDADVMVAGGTESSIDALSIAGFSRSRALSTKFN 234

Query: 61  GTPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQP 108
             P EASRPFDC RDGF            ELEHAK+RGAKIYAEVRGYGMSGDAHHITQP
Sbjct: 235 SCPTEASRPFDCDRDGFVIGEGAGVLVLEELEHAKRRGAKIYAEVRGYGMSGDAHHITQP 294

Query: 109 HIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLA 168
           H DG+GA+LAMTRAL+QSGL  +QVDYVNAHATSTPLGD VEA AI+TVFS+HATSG LA
Sbjct: 295 HEDGRGAVLAMTRALQQSGLHPNQVDYVNAHATSTPLGDAVEARAIKTVFSEHATSGGLA 354

Query: 169 FSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPI 228
           FSSTKGA GHLLGAAGAVEAIF+VL IHHG+AP TLNL +PDPIF+D F+PLTASK M I
Sbjct: 355 FSSTKGATGHLLGAAGAVEAIFSVLAIHHGIAPPTLNLERPDPIFDDGFVPLTASKAMLI 414

Query: 229 SAALSNSFGFGGTNASLLFT 248
            AALSNSFGFGGTNASLLFT
Sbjct: 415 RAALSNSFGFGGTNASLLFT 434


Length = 437

>gnl|CDD|200247 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>gnl|CDD|235987 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|240245 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>gnl|CDD|235781 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|236265 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|181539 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|173154 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>gnl|CDD|215421 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>gnl|CDD|181184 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|236129 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|235817 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|235653 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|236398 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|181657 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>gnl|CDD|217236 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|180261 PRK05790, PRK05790, putative acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181626 PRK09052, PRK09052, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233642 TIGR01930, AcCoA-C-Actrans, acetyl-CoA acetyltransferases Back     alignment and domain information
>gnl|CDD|180563 PRK06445, PRK06445, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238383 cd00751, thiolase, Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235741 PRK06205, PRK06205, acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235715 PRK06147, PRK06147, 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 100.0
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 100.0
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 100.0
KOG1394440 consensus 3-oxoacyl-(acyl-carrier-protein) synthas 100.0
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 100.0
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 100.0
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 100.0
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
cd00832399 CLF Chain-length factor (CLF) is a factor required 100.0
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK08439406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
COG3321 1061 Polyketide synthase modules and related proteins [ 100.0
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 100.0
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 100.0
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 100.0
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 100.0
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 100.0
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 100.0
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 100.0
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 100.0
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.97
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 99.96
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.93
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.91
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.9
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.9
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.89
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.89
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.89
PRK05656393 acetyl-CoA acetyltransferase; Provisional 99.89
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.89
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.88
PRK09051394 beta-ketothiolase; Provisional 99.88
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 99.87
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.87
PRK07661391 acetyl-CoA acetyltransferase; Provisional 99.87
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 99.87
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.87
PRK06365430 acetyl-CoA acetyltransferase; Provisional 99.87
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.87
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.86
PRK08256391 lipid-transfer protein; Provisional 99.86
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.86
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.86
PLN02287452 3-ketoacyl-CoA thiolase 99.86
PRK05790393 putative acyltransferase; Provisional 99.86
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 99.86
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.86
PRK08963428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.85
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.85
PRK06158384 thiolase; Provisional 99.85
PRK06059399 lipid-transfer protein; Provisional 99.85
PRK06289403 acetyl-CoA acetyltransferase; Provisional 99.85
PRK06157398 acetyl-CoA acetyltransferase; Validated 99.85
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.84
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.84
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.84
cd00829375 SCP-x_thiolase Thiolase domain associated with ste 99.84
PRK08313386 acetyl-CoA acetyltransferase; Provisional 99.84
cd00826393 nondecarbox_cond_enzymes nondecarboxylating conden 99.84
PRK06065392 acetyl-CoA acetyltransferase; Provisional 99.84
TIGR02446430 FadI fatty oxidation complex, beta subunit FadI. T 99.84
PRK07851406 acetyl-CoA acetyltransferase; Provisional 99.84
PLN02644394 acetyl-CoA C-acetyltransferase 99.83
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.83
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.83
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.83
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.83
PRK06066385 acetyl-CoA acetyltransferase; Provisional 99.82
KOG1390396 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.82
PRK06025417 acetyl-CoA acetyltransferase; Provisional 99.82
PRK08170426 acetyl-CoA acetyltransferase; Provisional 99.81
PRK09268427 acetyl-CoA acetyltransferase; Provisional 99.8
KOG1406408 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44 99.76
KOG1389435 consensus 3-oxoacyl CoA thiolase [Lipid transport 99.72
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 99.69
PRK07855386 lipid-transfer protein; Provisional 99.67
PRK07937352 lipid-transfer protein; Provisional 99.64
KOG1391396 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.64
PRK08257498 acetyl-CoA acetyltransferase; Validated 99.63
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 99.62
KOG1392465 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.59
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.4
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 99.37
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.24
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 99.21
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.2
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.07
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.04
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 99.02
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.98
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.97
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 98.96
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 98.94
PRK06840339 hypothetical protein; Validated 98.83
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 98.75
cd00827324 init_cond_enzymes "initiating" condensing enzymes 98.73
PRK04262347 hypothetical protein; Provisional 98.67
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.53
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 98.46
TIGR01835379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 98.33
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 98.25
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 98.19
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.13
PLN03172393 chalcone synthase family protein; Provisional 97.98
PRK08304337 stage V sporulation protein AD; Validated 97.94
PLN03169391 chalcone synthase family protein; Provisional 97.93
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 97.9
PLN03171399 chalcone synthase-like protein; Provisional 97.84
PLN03170401 chalcone synthase; Provisional 97.78
PLN02854521 3-ketoacyl-CoA synthase 97.74
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 97.74
PLN03173391 chalcone synthase; Provisional 97.61
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 97.51
PRK12404334 stage V sporulation protein AD; Provisional 97.48
PLN02577459 hydroxymethylglutaryl-CoA synthase 97.29
PLN03168389 chalcone synthase; Provisional 97.27
PLN02377502 3-ketoacyl-CoA synthase 97.22
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 95.38
PLN02932478 3-ketoacyl-CoA synthase 94.57
PLN02192511 3-ketoacyl-CoA synthase 94.31
TIGR01833454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 93.12
PRK06065 392 acetyl-CoA acetyltransferase; Provisional 92.04
PRK12578 385 acetyl-CoA acetyltransferase; Provisional 91.26
PLN00415466 3-ketoacyl-CoA synthase 91.19
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 91.04
PRK06059 399 lipid-transfer protein; Provisional 91.0
PRK06158 384 thiolase; Provisional 90.78
PRK05790 393 putative acyltransferase; Provisional 90.34
PF07451329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 89.77
PRK06205 404 acetyl-CoA acetyltransferase; Provisional 89.4
PRK06157 398 acetyl-CoA acetyltransferase; Validated 89.31
PRK08304 337 stage V sporulation protein AD; Validated 89.29
cd00327 254 cond_enzymes Condensing enzymes; Family of enzymes 89.24
PRK09051 394 beta-ketothiolase; Provisional 88.86
PLN02644 394 acetyl-CoA C-acetyltransferase 88.81
TIGR02845 327 spore_V_AD stage V sporulation protein AD. Bacillu 88.55
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 88.29
PRK07801 382 acetyl-CoA acetyltransferase; Provisional 88.22
PRK06954 397 acetyl-CoA acetyltransferase; Provisional 88.22
PRK08256 391 lipid-transfer protein; Provisional 87.96
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 87.92
PRK08235 393 acetyl-CoA acetyltransferase; Provisional 87.65
CHL00203 326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 87.36
PRK08313 386 acetyl-CoA acetyltransferase; Provisional 87.04
PLN02932 478 3-ketoacyl-CoA synthase 87.02
PRK08142 388 acetyl-CoA acetyltransferase; Provisional 86.83
TIGR00747 318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 86.48
PRK07937 352 lipid-transfer protein; Provisional 86.4
PRK05656 393 acetyl-CoA acetyltransferase; Provisional 86.28
PRK12404 334 stage V sporulation protein AD; Provisional 86.25
PRK09052 399 acetyl-CoA acetyltransferase; Provisional 86.25
PF00108 264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 86.14
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 86.08
PRK09258 338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 86.04
PLN03168 389 chalcone synthase; Provisional 86.0
PLN02287 452 3-ketoacyl-CoA thiolase 85.94
PLN02377 502 3-ketoacyl-CoA synthase 85.9
PRK06445 394 acetyl-CoA acetyltransferase; Provisional 85.9
TIGR01930 386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 85.88
PRK06366 388 acetyl-CoA acetyltransferase; Provisional 85.74
COG0533 342 QRI7 Metal-dependent proteases with possible chape 85.63
PRK12880 353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 85.58
PRK07204 329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 85.49
PRK07851 406 acetyl-CoA acetyltransferase; Provisional 85.48
PRK07855 386 lipid-transfer protein; Provisional 84.58
PRK06066 385 acetyl-CoA acetyltransferase; Provisional 84.55
PRK09352 319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 84.55
PRK06504 390 acetyl-CoA acetyltransferase; Provisional 84.41
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 84.13
cd00751 386 thiolase Thiolase are ubiquitous enzymes that cata 84.05
PRK12879 325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 83.97
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 83.82
PRK08131 401 acetyl-CoA acetyltransferase; Provisional 83.58
PLN02192 511 3-ketoacyl-CoA synthase 83.51
PRK08963 428 fadI 3-ketoacyl-CoA thiolase; Reviewed 83.5
cd00831 361 CHS_like Chalcone and stilbene synthases; plant-sp 83.35
PRK06816 378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 83.13
PRK04262 347 hypothetical protein; Provisional 83.09
TIGR00748 345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 82.83
PLN02326 379 3-oxoacyl-[acyl-carrier-protein] synthase III 82.59
PRK07850 387 acetyl-CoA acetyltransferase; Provisional 82.48
cd00826 393 nondecarbox_cond_enzymes nondecarboxylating conden 82.37
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 81.81
PRK07515 372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 81.72
PLN03172 393 chalcone synthase family protein; Provisional 81.38
COG0332 323 FabH 3-oxoacyl-[acyl-carrier-protein] 81.34
cd00827 324 init_cond_enzymes "initiating" condensing enzymes 81.01
PLN00415 466 3-ketoacyl-CoA synthase 80.93
PRK07108 392 acetyl-CoA acetyltransferase; Provisional 80.86
cd00829 375 SCP-x_thiolase Thiolase domain associated with ste 80.67
PRK06840 339 hypothetical protein; Validated 80.46
PRK06064 389 acetyl-CoA acetyltransferase; Provisional 80.41
PRK06633 392 acetyl-CoA acetyltransferase; Provisional 80.33
PF09663 365 Amido_AtzD_TrzD: Amidohydrolase ring-opening prote 80.09
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.1e-56  Score=376.41  Aligned_cols=246  Identities=52%  Similarity=0.823  Sum_probs=228.3

Q ss_pred             CCeeecchhhHHHHHHHHHHHHHHHhCCcCEEEEeCcCCCcChhhHHHHhhhhhcccccCCCCCCcccccccCCCcc---
Q 040515            1 GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGF---   77 (251)
Q Consensus         1 Gp~~tv~~~casgl~Al~~A~~~I~~G~~d~alvgg~e~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~f~~~~~g~---   77 (251)
                      ||+++++++|+|++.||..|+++|++|++|++||||+|..+++..+..|..++.++...+.+|+..|+|||.+++|+   
T Consensus        82 Gp~~ti~~aCaSg~~Al~~A~~~I~~G~~d~~ivgg~d~~~~~~~~~~f~~~~~ls~~~~~~p~~~~rPFd~~r~G~v~g  161 (342)
T PRK14691         82 GPIGAPVTACAAGVQAIGDAVRMIRNNEADVALCGGAEAVIDTVSLAGFAAARALSTHFNSTPEKASRPFDTARDGFVMG  161 (342)
T ss_pred             CCccccccHhHHHHHHHHHHHHHHHcCCCCEEEEecccccCCHHHHHHHHHhhhhhcCCCCCCCcCCCCCCCCCCCcccc
Confidence            89999999999999999999999999999999999999999999899999999998655667889999999999999   


Q ss_pred             ---------chhhhhhcCCeEEEEEeeeeecCCCCCCCCCCCChHHHHHHHHHHHHHcCCCCCCccEEEecCCCCcCCcH
Q 040515           78 ---------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDT  148 (251)
Q Consensus        78 ---------~~~~A~~~g~~~~a~i~g~~~~~~~~~~~~~~~~~~~~~~a~~~al~~Agi~~~dId~i~~h~~gt~~~D~  148 (251)
                               ++++|+++|.++|++|+|++..+|+.+...+.+++.+..++++++|+++||+|+||||||+|||||+.+|.
T Consensus       162 EGAa~lvLes~~~A~~rG~~i~a~I~g~~~~~d~~~~~~p~p~~~~~~~ai~~AL~~Agl~p~dIdyIeaHgtgT~~~D~  241 (342)
T PRK14691        162 EGAGLLIIEELEHALARGAKPLAEIVGYGTSADAYHMTSGAEDGDGAYRAMKIALRQAGITPEQVQHLNAHATSTPVGDL  241 (342)
T ss_pred             ceEEEEEEeeHHHHHhCCCCceEEEEEEEEEcCCCCCCCCCCCHHHHHHHHHHHHHHcCCCHHHCCEEEecCCCCcCCCH
Confidence                     67889999999999999999999998877778889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccCCCCceeeecccCCccchhhhhhHHHHHHHHHHHhhCCccCcCCCCCCCCCC-CCCCCccccCCCCC
Q 040515          149 VEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIF-NDNFMPLTASKDMP  227 (251)
Q Consensus       149 ~E~~a~~~~~~~~~~~~~~~v~~~k~~~Gh~~~AsG~~~l~~~~~~l~~~~ip~~~~~~~~~~~~-~~~~~~~~~~~~~~  227 (251)
                      +|..||+++|+..   .++||++.|+++||+++|+|+++++.++++|++++|||++|+++|+|++ .+++++ ...++.+
T Consensus       242 ~E~~Ai~~~fg~~---~~~~v~s~K~~~GH~~~AaG~~~~~~~~l~l~~~~ippt~n~~~~d~~~~~~~~v~-~~~~~~~  317 (342)
T PRK14691        242 GEINAIKHLFGES---NALAITSTKSATGHLLGAAGGLETIFTVLALRDQIVPATLNLENPDPAAKGLNIIA-GNAQPHD  317 (342)
T ss_pred             HHHHHHHHHhCCC---CCceEECCcccccCCcchhhHHHHHHHHHHHhCCccCCcCCCCCCCccccccCccc-CCCccCC
Confidence            9999999999853   2489999999999999999999999999999999999999999999988 477776 4445556


Q ss_pred             CcEEEEecccccceeeeeEeeec
Q 040515          228 ISAALSNSFGFGGTNASLLFTKC  250 (251)
Q Consensus       228 ~~~~lv~~~g~gG~~~~~vl~~~  250 (251)
                      .+++|+|+|||||+|+++||++|
T Consensus       318 ~~~al~nsfgfGG~n~~lvl~~~  340 (342)
T PRK14691        318 MTYALSNGFGFAGVNASILLKRW  340 (342)
T ss_pred             CCEEEEeCccCCCeeEEEEEeec
Confidence            89999999999999999999987



>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1394 consensus 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism] Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG0533 QRI7 Metal-dependent proteases with possible chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PF09663 Amido_AtzD_TrzD: Amidohydrolase ring-opening protein (Amido_AtzD_TrzD); InterPro: IPR014086 Members of this family are ring-opening amidohydrolases, including cyanuric acid amidohydrolase (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1w0i_A431 Arabidopsis Thaliana Mitochondrial Kas Length = 431 1e-108
1j3n_A408 Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protei 7e-66
3e60_A424 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 6e-63
2iwy_A438 Human Mitochondrial Beta-ketoacyl Acp Synthase Leng 2e-62
3kzu_A428 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 5e-62
2c9h_A444 Structure Of Mitochondrial Beta-Ketoacyl Synthase L 3e-61
4ddo_A451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 4e-56
1e5m_A416 Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kas 6e-56
2gfw_A427 Structure Of Wild Type E. Coli Fabf (Kasii) Length 3e-55
1b3n_A412 Beta-Ketoacyl Carrier Protein Synthase As A Drug Ta 4e-55
4f32_A451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 8e-55
2gfy_A427 Structure Of E. Coli Fabf(K335a) Mutant With Covale 2e-54
3hnz_A427 Structure Of E. Coli Fabf(C163a) In Complex With Pl 5e-54
2gfv_A427 Structure Of E. Coli Fabf (Kasii) C163q Mutant Leng 1e-53
2gqd_A437 The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii 3e-53
3o04_A413 Crystal Structure Of The Beta-Keto-Acyl Carrier Pro 6e-52
2wgd_A416 Crystal Structure Of Kasa Of Mycobacterium Tubercul 9e-44
2wgf_A416 Crystal Structure Of Mycobacterium Tuberculosis C17 2e-42
1fj4_A406 The Structure Of Beta-Ketoacyl-[acyl Carrier Protei 7e-42
1dd8_A406 Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Pr 7e-42
1h4f_A406 E. Coli Beta-Ketoacyl [acyl Carrier Protein] Syntha 1e-41
1ox0_A430 The Crystal Structure Of Beta-Ketoacyl-[acyl Carrie 4e-41
2byw_A418 Structure Of Escherichia Coli Beta-Ketoacyl (Acyl C 4e-41
2byz_A418 Structure Of E. Coli Kas I H298q Mutant In Complex 4e-41
2byy_A418 E. Coli Kas I H298e Mutation Length = 418 4e-41
2rjt_A428 Crystal Structure Analysis Of A Surface Entropy Red 6e-41
3u0f_A411 The Structure Of Beta-Ketoacyl Synthase From Brucel 2e-40
3lrf_A428 Crystal Structure Of Beta-Ketoacyl Synthase From Br 2e-40
2alm_A431 Crystal Structure Analysis Of A Mutant Beta-Ketoacy 3e-40
1f91_A406 Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In 2e-38
1ek4_A418 Beta-Ketoacyl [acyl Carrier Protein] Synthase I In 2e-38
2vb7_C406 Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Ap 2e-38
3oyt_A410 1.84 Angstrom Resolution Crystal Structure Of 3-Oxo 4e-38
2gp6_A434 X-Ray Crystal Structure Of Mycobacterium Tuberculos 3e-36
1tqy_A424 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 7e-32
4ewg_A412 Crystal Structure Of A Beta-Ketoacyl Synthase From 2e-27
2qo3_A 915 Crystal Structure Of [ks3][at3] Didomain From Modul 2e-12
2hg4_A 917 Structure Of The Ketosynthase-acyltransferase Didom 5e-12
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 3e-07
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 3e-07
3zen_D3089 Cryo-em Structure Of The Mycobacterial Fatty Acid S 9e-04
>pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas Length = 431 Back     alignment and structure

Iteration: 1

Score = 387 bits (994), Expect = e-108, Method: Compositional matrix adjust. Identities = 190/259 (73%), Positives = 213/259 (82%), Gaps = 12/259 (4%) Query: 1 GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYN 60 GPNHAAVTACATGAHSIGDA RMIQFGD+DVMVAGGTESSIDALS+AGF +SRAL+TK+N Sbjct: 170 GPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFN 229 Query: 61 GTPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQP 108 +PQEASRPFDC RDGF E EHAK+RGAKIYAE+ GYGMSGDAHHITQP Sbjct: 230 SSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQP 289 Query: 109 HIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLA 168 DGKGA+LAMTRAL+QSGL +Q+DYVNAHATSTP+GD VEA AI+TVFS+HATSG+LA Sbjct: 290 PEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATSGTLA 349 Query: 169 FSSTKXXXXXXXXXXXXVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPI 228 FSSTK VEAIF++L IHHGVAP+TLN+ PDPIF+ FMPLT SK M + Sbjct: 350 FSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLV 409 Query: 229 SAALSNSFGFGGTNASLLF 247 A+SNSFGFGGTNASLLF Sbjct: 410 RTAMSNSFGFGGTNASLLF 428
>pdb|1J3N|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protein) Synthase Ii From Thermus Thermophilus Hb8 Length = 408 Back     alignment and structure
>pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Bartonella Henselae Length = 424 Back     alignment and structure
>pdb|2IWY|A Chain A, Human Mitochondrial Beta-ketoacyl Acp Synthase Length = 438 Back     alignment and structure
>pdb|3KZU|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|2C9H|A Chain A, Structure Of Mitochondrial Beta-Ketoacyl Synthase Length = 444 Back     alignment and structure
>pdb|4DDO|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis Length = 451 Back     alignment and structure
>pdb|1E5M|A Chain A, Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kasii) From Synechocystis Sp Length = 416 Back     alignment and structure
>pdb|2GFW|A Chain A, Structure Of Wild Type E. Coli Fabf (Kasii) Length = 427 Back     alignment and structure
>pdb|1B3N|A Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 Back     alignment and structure
>pdb|4F32|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis In Complex With Platencin Length = 451 Back     alignment and structure
>pdb|2GFY|A Chain A, Structure Of E. Coli Fabf(K335a) Mutant With Covalently Linked Dodecanoic Acid Length = 427 Back     alignment and structure
>pdb|3HNZ|A Chain A, Structure Of E. Coli Fabf(C163a) In Complex With Platensimycin Length = 427 Back     alignment and structure
>pdb|2GFV|A Chain A, Structure Of E. Coli Fabf (Kasii) C163q Mutant Length = 427 Back     alignment and structure
>pdb|2GQD|A Chain A, The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii (Fabf) From Staphylococcus Aureus Length = 437 Back     alignment and structure
>pdb|3O04|A Chain A, Crystal Structure Of The Beta-Keto-Acyl Carrier Protein Synthase Ii (Lmo2201) From Listeria Monocytogenes Length = 413 Back     alignment and structure
>pdb|2WGD|A Chain A, Crystal Structure Of Kasa Of Mycobacterium Tuberculosis Length = 416 Back     alignment and structure
>pdb|2WGF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis C171q Kasa Variant Length = 416 Back     alignment and structure
>pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I In Complex With Thiolactomycin, Implications For Drug Design Length = 406 Back     alignment and structure
>pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I From Escherichia Coli Length = 406 Back     alignment and structure
>pdb|1H4F|A Chain A, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I K328r Length = 406 Back     alignment and structure
>pdb|1OX0|A Chain A, The Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 430 Back     alignment and structure
>pdb|2BYW|A Chain A, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I Lys328ala Mutant Length = 418 Back     alignment and structure
>pdb|2BYZ|A Chain A, Structure Of E. Coli Kas I H298q Mutant In Complex With C12 Fatty Acid Length = 418 Back     alignment and structure
>pdb|2BYY|A Chain A, E. Coli Kas I H298e Mutation Length = 418 Back     alignment and structure
>pdb|2RJT|A Chain A, Crystal Structure Analysis Of A Surface Entropy Reduction Mutant Of S. Pneumoniae Fabf Length = 428 Back     alignment and structure
>pdb|3U0F|A Chain A, The Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Bound To The Fragment 7-Hydroxycoumarin Length = 411 Back     alignment and structure
>pdb|3LRF|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|2ALM|A Chain A, Crystal Structure Analysis Of A Mutant Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 431 Back     alignment and structure
>pdb|1F91|A Chain A, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex With C10 Fatty Acid Substrate Length = 406 Back     alignment and structure
>pdb|1EK4|A Chain A, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex With Dodecanoic Acid To 1.85 Resolution Length = 418 Back     alignment and structure
>pdb|2VB7|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo Structure After Soak In Peg Solution Length = 406 Back     alignment and structure
>pdb|3OYT|A Chain A, 1.84 Angstrom Resolution Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase I (Fabb) From Yersinia Pestis Co92 Length = 410 Back     alignment and structure
>pdb|2GP6|A Chain A, X-Ray Crystal Structure Of Mycobacterium Tuberculosis Beta- Ketoacyl Acyl Carrier Protein Synthase Ii (Mtkasb) Length = 434 Back     alignment and structure
>pdb|1TQY|A Chain A, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 424 Back     alignment and structure
>pdb|4EWG|A Chain A, Crystal Structure Of A Beta-Ketoacyl Synthase From Burkholderia Phymatum Stm815 Length = 412 Back     alignment and structure
>pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure
>pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|3ZEN|D Chain D, Cryo-em Structure Of The Mycobacterial Fatty Acid Synthase Length = 3089 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 1e-150
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 1e-143
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 1e-143
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 1e-141
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 1e-138
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 1e-138
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 1e-135
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 1e-134
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 1e-134
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 1e-134
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 1e-134
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 1e-133
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 1e-131
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 1e-129
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 1e-129
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 1e-127
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 1e-122
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 4e-79
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 5e-60
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 2e-65
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 5e-63
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 6e-44
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 3e-27
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 2e-23
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 8e-23
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 2e-16
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 3e-06
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 5e-06
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 1e-05
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 4e-05
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 4e-05
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 4e-05
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 5e-05
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 6e-05
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 7e-05
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 2e-04
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 2e-04
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 4e-04
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 4e-04
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 5e-04
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 6e-04
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Length = 431 Back     alignment and structure
 Score =  424 bits (1093), Expect = e-150
 Identities = 201/261 (77%), Positives = 224/261 (85%), Gaps = 12/261 (4%)

Query: 1   GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYN 60
           GPNHAAVTACATGAHSIGDA RMIQFGD+DVMVAGGTESSIDALS+AGF +SRAL+TK+N
Sbjct: 170 GPNHAAVTACATGAHSIGDATRMIQFGDADVMVAGGTESSIDALSVAGFSRSRALSTKFN 229

Query: 61  GTPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQP 108
            +PQEASRPFDC RDGF            E EHAK+RGAKIYAE+ GYGMSGDAHHITQP
Sbjct: 230 SSPQEASRPFDCDRDGFVIGEGSGVIVLEEYEHAKRRGAKIYAELCGYGMSGDAHHITQP 289

Query: 109 HIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLA 168
             DGKGA+LAMTRAL+QSGL  +Q+DYVNAHATSTP+GD VEA AI+TVFS+HATSG+LA
Sbjct: 290 PEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAVEARAIKTVFSEHATSGTLA 349

Query: 169 FSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPI 228
           FSSTKGA GHLLGAAGAVEAIF++L IHHGVAP+TLN+  PDPIF+  FMPLT SK M +
Sbjct: 350 FSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNPDPIFDKRFMPLTTSKKMLV 409

Query: 229 SAALSNSFGFGGTNASLLFTK 249
             A+SNSFGFGGTNASLLF  
Sbjct: 410 RTAMSNSFGFGGTNASLLFAS 430


>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Length = 428 Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Length = 451 Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Length = 438 Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Length = 434 Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Length = 416 Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Length = 427 Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Length = 416 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Length = 430 Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Length = 413 Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 408 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Length = 437 Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 424 Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Length = 406 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Length = 412 Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Length = 428 Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 415 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 401 Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Length = 390 Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Length = 387 Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Length = 393 Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Length = 394 Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Length = 396 Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Length = 395 Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Length = 418 Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Length = 442 Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Length = 392 Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Length = 397 Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Length = 395 Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Length = 407 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 100.0
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 100.0
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 100.0
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 100.0
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 100.0
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 100.0
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 100.0
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 100.0
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 100.0
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 100.0
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 100.0
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 100.0
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 100.0
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 100.0
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 100.0
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 100.0
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 100.0
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 100.0
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 100.0
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
3zen_D3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.96
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.96
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 99.96
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.95
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.95
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.95
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 99.95
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.94
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.94
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 99.94
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.94
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.94
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.92
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.88
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 99.86
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.8
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.8
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.79
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 99.73
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 99.71
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 99.69
1u0m_A382 Putative polyketide synthase; type III polyketide 99.61
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 99.57
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 99.48
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.46
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 99.45
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.43
1xpm_A396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 99.35
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.29
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 99.24
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 99.24
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 99.18
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 99.12
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 99.11
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 99.09
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 98.94
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 98.87
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 98.86
1xes_A413 Dihydropinosylvin synthase; native structure, tran 98.85
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 98.85
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 98.84
2f82_A450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 98.84
3awk_A402 Chalcone synthase-like polyketide synthase; type I 98.81
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 98.78
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 98.75
3oit_A387 OS07G0271500 protein; type III polyketide synthase 98.73
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 98.72
3e1h_A465 PKSIIINC, putative uncharacterized protein; resorc 98.69
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 98.66
3v4n_A388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 98.66
3sqz_A425 Putative hydroxymethylglutaryl-COA synthase; thiol 98.53
3v7i_A413 Putative polyketide synthase; type III polyketide 98.47
2p8u_A478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 98.2
2v4w_A460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 97.57
4e1l_A 395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 90.49
4dd5_A 396 Acetyl-COA acetyltransferase; structural genomics, 90.23
2wya_A 460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 88.8
3il3_A 323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 88.49
3ss6_A 394 Acetyl-COA acetyltransferase; structural genomics, 88.02
3goa_A 387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 87.99
3s21_A 345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 87.59
4ewp_A 350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 87.22
3il6_A 321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 87.15
3h78_A 359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 87.14
4dfe_A 333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 86.65
3v7i_A 413 Putative polyketide synthase; type III polyketide 85.78
3led_A 392 3-oxoacyl-acyl carrier protein synthase III; struc 85.57
4efi_A 354 3-oxoacyl-(acyl-carrier protein) synthase; structu 84.85
3euo_A 379 Type III pentaketide synthase; alpha helix, acyltr 84.83
3gwa_A 365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 84.67
2iik_A 418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 84.49
2ib8_A 395 Acetyl-COA acetyltransferase; thiolase fold, potas 83.79
1ulq_A 401 Putative acetyl-COA acetyltransferase; structural 82.98
1ted_A 393 PKS18; thiolase fold, substrate binding tunnel, tr 82.56
1hnj_A 317 Beta-ketoacyl-acyl carrier protein synthase III; F 82.22
1u6e_A 335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 81.55
2ebd_A 309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 81.41
1zow_A 313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 81.35
1mzj_A 339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 81.18
2h84_A 374 Steely1; thiolase-fold, type III polyketide syntha 80.71
1u0m_A 382 Putative polyketide synthase; type III polyketide 80.49
3s3l_A 357 CERJ; acyltransferase, FABH homologue, KS III homo 80.29
1wl4_A 397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 80.06
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
Probab=100.00  E-value=8.6e-54  Score=374.01  Aligned_cols=241  Identities=38%  Similarity=0.616  Sum_probs=223.3

Q ss_pred             CCeeecchhhHHHHHHHHHHHHHHHhCCcCEEEEeCcCCCcChhhHHHHhhhhhcccccCCCCCCcccccccCCCcc---
Q 040515            1 GPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGF---   77 (251)
Q Consensus         1 Gp~~tv~~~casgl~Al~~A~~~I~~G~~d~alvgg~e~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~f~~~~~g~---   77 (251)
                      ||+++|+++|+|+++||++|+++|++|+||++||||+|. +++.....|...+.++.. ..+|+..|+|||..++|+   
T Consensus       159 gp~~~v~~aCsS~l~Al~~A~~~I~~G~~d~~LvgG~e~-~s~~~~~~~~~~~~l~~~-~~~p~~~~rpfd~~~~G~~~g  236 (412)
T 4ewg_A          159 GRIVPTSSACASGSQAIGYAYENIAMGKQTLMLAGGAEE-LSGPAVAVFDTLYATSTR-NDEPHLTPRPFDAKRDGLVVG  236 (412)
T ss_dssp             SCEEECCCGGGHHHHHHHHHHHHHHTTSCSEEEEEEEEC-CCHHHHHHHHTTTCBCCC-TTCGGGCCCTTBTTCCCBCBB
T ss_pred             CCcccccchhHHHHHHHHHHHHHHHcCCCCEEEEecccc-CCHHHHHHHHHhhccccC-CCCCCCCCCCCCCCCCCCceE
Confidence            799999999999999999999999999999999999999 888888889888888764 556778999999999998   


Q ss_pred             ---------chhhhhhcCCeEEEEEeeeeecCCCCCCCCCCCChHHHHHHHHHHHHHcCCCCCCccEEEecCCCCcCCcH
Q 040515           78 ---------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDT  148 (251)
Q Consensus        78 ---------~~~~A~~~g~~~~a~i~g~~~~~~~~~~~~~~~~~~~~~~a~~~al~~Agi~~~dId~i~~h~~gt~~~D~  148 (251)
                               ++++|+++|+++|++|+|++.++|+.+++.|  ...++.++++++|++||++|+||||||+|||||+.+|.
T Consensus       237 eGAaavvL~~~~~A~~~g~~i~a~i~g~~~~~dg~~~~~p--~~~~~~~ai~~Al~~Agl~~~dId~ve~Hgtgt~~~D~  314 (412)
T 4ewg_A          237 EGAATLVLEEYEHAKARGATIHAEIVGFGCNSDGAHMTQP--TASTMARAMQLALEDAKLDANAIAYVNAHGTSTDRGDV  314 (412)
T ss_dssp             CEEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECSSCSSSC--CHHHHHHHHHHHHHHTTCCGGGEEEEECCCCCCHHHHH
T ss_pred             CeEEEEEEccHHHHhhCCCcEEEEEEEEEEcCCCCCCCCC--CHHHHHHHHHHHHHHcCCCHHHCCEEEccCCCCccccH
Confidence                     6788999999999999999999999877665  58899999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhccCCCCceeeecccCCccchhhhhhHHHHHHHHHHHhhCCccCcCCCCCCCCCC-CCCCCccccCCCCC
Q 040515          149 VEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKPDPIF-NDNFMPLTASKDMP  227 (251)
Q Consensus       149 ~E~~a~~~~~~~~~~~~~~~v~~~k~~~Gh~~~AsG~~~l~~~~~~l~~~~ip~~~~~~~~~~~~-~~~~~~~~~~~~~~  227 (251)
                      +|..++..+|+..     ++|++.|+++||+++|+|++++++++++|+++++||++|+++|+|.+ ++++++ .+.+..+
T Consensus       315 ~E~~al~~~~~~~-----~~v~s~K~~~GH~~gAsG~~~~~~~~~~l~~~~ipp~~~~~~~~p~~~~~~~v~-~~~~~~~  388 (412)
T 4ewg_A          315 AESQATARTFGER-----MPISSLKSYVGHTLGACGALEAWWTIEMMKRNWYAPTLNLTEVDPACAPLDYIR-GEARAID  388 (412)
T ss_dssp             HHHHHHHHHHCTT-----CEEECTHHHHCBCGGGHHHHHHHHHHHHHHHTEECCCTTCCSBCTTSCCCEECC-SSCEECC
T ss_pred             HHHHHHHHHcCCC-----CeeeCccccccccHHHHHHHHHHHHHHHHhcCCcCCCCCCCCCCCccccccccc-CcccCCC
Confidence            9999999999753     89999999999999999999999999999999999999999999999 788776 4455567


Q ss_pred             CcEEEEecccccceeeeeEeeecC
Q 040515          228 ISAALSNSFGFGGTNASLLFTKCQ  251 (251)
Q Consensus       228 ~~~~lv~~~g~gG~~~~~vl~~~~  251 (251)
                      .+++++|+|||||+|+|+||++|+
T Consensus       389 ~~~~~~~sfgfGG~na~~vl~~~~  412 (412)
T 4ewg_A          389 AEYVMSNNFAFGGINTSLIFRRVR  412 (412)
T ss_dssp             CSEEEEEEEEGGGEEEEEEEECCC
T ss_pred             CCEEEEeeecCCcceEEEEEeeCC
Confidence            899999999999999999999985



>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d2ix4a2161 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II 1e-50
d2gfva2161 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II 5e-41
d1e5ma2161 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II 1e-38
d1j3na2159 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II 4e-38
d1ox0a2158 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II 2e-35
d2vbaa2151 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I 1e-34
d1tqya2205 c.95.1.1 (A:219-423) Actinorhodin polyketide putat 2e-34
d1tqyb2194 c.95.1.1 (B:210-403) Actinorhodin polyketide putat 6e-23
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 4e-20
d2ix4a1270 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II 7e-19
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 4e-15
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 3e-14
d2vbaa1253 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E 5e-14
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 3e-12
d1tqya1216 c.95.1.1 (A:3-218) Actinorhodin polyketide putativ 7e-11
d1tqyb1208 c.95.1.1 (B:2-209) Actinorhodin polyketide putativ 8e-11
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 161 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]
 Score =  161 bits (407), Expect = 1e-50
 Identities = 124/160 (77%), Positives = 140/160 (87%)

Query: 90  YAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTV 149
           YAE+ GYGMSGDAHHITQP  DGKGA+LAMTRAL+QSGL  +Q+DYVNAHATSTP+GD V
Sbjct: 1   YAELCGYGMSGDAHHITQPPEDGKGAVLAMTRALRQSGLCPNQIDYVNAHATSTPIGDAV 60

Query: 150 EATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKP 209
           EA AI+TVFS+HATSG+LAFSSTKGA GHLLGAAGAVEAIF++L IHHGVAP+TLN+  P
Sbjct: 61  EARAIKTVFSEHATSGTLAFSSTKGATGHLLGAAGAVEAIFSILAIHHGVAPMTLNVKNP 120

Query: 210 DPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTK 249
           DPIF+  FMPLT SK M +  A+SNSFGFGGTNASLLF  
Sbjct: 121 DPIFDKRFMPLTTSKKMLVRTAMSNSFGFGGTNASLLFAS 160


>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 161 Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 159 Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 158 Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 151 Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 205 Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 194 Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 216 Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 100.0
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 100.0
d1e5ma2161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 100.0
d1ox0a2158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 100.0
d2ix4a2161 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 100.0
d2gfva2161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 100.0
d1j3na2159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 100.0
d2vbaa2151 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 100.0
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 99.74
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 99.71
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.68
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.68
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.68
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.66
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.64
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.62
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.61
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.61
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 98.46
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 98.42
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 98.42
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 98.41
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 98.39
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 97.82
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 97.59
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 97.54
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 97.23
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 96.87
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 96.74
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 96.59
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 96.46
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 96.4
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 96.0
d1ee0a2160 Pyrone synthase (PyS, chalcone synthase 2) {Gerber 95.75
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 95.74
d1bi5a2154 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 95.6
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 95.24
d1u0ua2156 Dihydropinosylvin synthase {Scots pine (Pinus sylv 95.24
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 91.83
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 90.82
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 89.64
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 89.21
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 87.89
d1m3ka1 268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 86.41
d1teda_ 372 Polyketide synthase PKS18 {Mycobacterium tuberculo 85.43
d1ulqa1 273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 84.79
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 82.62
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 81.56
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA
species: Streptomyces coelicolor [TaxId: 1902]
Probab=100.00  E-value=2e-46  Score=295.19  Aligned_cols=187  Identities=35%  Similarity=0.611  Sum_probs=174.1

Q ss_pred             CCCCcccccccCCCcc------------chhhhhhcCCeEEEEEeeeeecCCCCCCCCCCCChHHHHHHHHHHHHHcCCC
Q 040515           62 TPQEASRPFDCGRDGF------------ELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQ  129 (251)
Q Consensus        62 ~~~~~~~~f~~~~~g~------------~~~~A~~~g~~~~a~i~g~~~~~~~~~~~~~~~~~~~~~~a~~~al~~Agi~  129 (251)
                      +|++.|||||..++||            ++++|+++|+++|++|.|+++++|+.+.+.+.++...+.++++++|++++++
T Consensus         2 ~P~~~~rpFD~~adG~v~gEGa~~~vL~~~~~A~~~g~~i~a~i~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~a~i~   81 (205)
T d1tqya2           2 DPEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESRTD   81 (205)
T ss_dssp             CGGGCCCTTBTTCCCBCEECEEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECSSCSSCCCTTCHHHHHHHHHHHHHHTCC
T ss_pred             CCCCCCCCccCCCCCEeeEeeEEEEEEeEHHHHHHCCCceEEEEEeeEccccccccCcccccccccchhhhhHHhhhcCC
Confidence            5889999999999999            6788999999999999999999999988888888889999999999999999


Q ss_pred             CCCccEEEecCCCCcCCcHHHHHHHHHHhhccCCCCceeeecccCCccchhhhhhHHHHHHHHHHHhhCCccCcCCCCCC
Q 040515          130 SHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLTIHHGVAPLTLNLAKP  209 (251)
Q Consensus       130 ~~dId~i~~h~~gt~~~D~~E~~a~~~~~~~~~~~~~~~v~~~k~~~Gh~~~AsG~~~l~~~~~~l~~~~ip~~~~~~~~  209 (251)
                      |+||+|||+|||||+.+|.+|..++.++|+....  +++|+++|+++||+++|+|++++++++++|++++|||++|++.+
T Consensus        82 ~~~i~~ie~hgtGt~~~D~~E~~ai~~~~~~~~~--~~~v~s~K~~~GH~~~AsG~~~li~~~~~l~~g~ipp~~~~~~~  159 (205)
T d1tqya2          82 ATDIDYINAHGSGTRQNDRHETAAYKRALGEHAR--RTPVSSIKSMVGHSLGAIGSLEIAACVLALEHGVVPPTANLRTS  159 (205)
T ss_dssp             GGGCCEEECCCCCCHHHHHHHHHHHHHHTGGGGG--GSCEECTHHHHCBCTTTHHHHHHHHHHHHHHHCEECCBTTCCSB
T ss_pred             ccceeeeeccccccccCchhHHHHHHHhhccccC--CceeeeecccccccccccchhHHHHHHHHHhCCeEcccCCCCCC
Confidence            9999999999999999999999999999986443  48999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCccccCCCCCCcEEEEecccccceeeeeEeeecC
Q 040515          210 DPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ  251 (251)
Q Consensus       210 ~~~~~~~~~~~~~~~~~~~~~~lv~~~g~gG~~~~~vl~~~~  251 (251)
                      +|+++++.++ ...+..+.+++++|+|||||+|+|+||++++
T Consensus       160 ~p~~~~~~v~-~~~~~~~~~~a~~~s~GfGG~na~~vl~~~~  200 (205)
T d1tqya2         160 DPECDLDYVP-LEARERKLRSVLTVGSGFGGFQSAMVLRDAE  200 (205)
T ss_dssp             BTTBCSCCCB-SSCEECCCSEEEEEEEETTTEEEEEEEECHH
T ss_pred             CCCCCcccCC-CCCcCCCCCEEEEeCCCCCceeEEEEEeeCC
Confidence            9999998888 4455567899999999999999999999864



>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure