Citrus Sinensis ID: 040527

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MEKSIPKCGKSERLQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
cccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccccccccHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccEEEEEccccccccccccccccccEEEEEEEEEccccHHHHHHccccHHHHHHHHEEccccccEEEEEEEcccccEEEEEEcEEEccccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEEEccccccccccccccccccHHHHHHHcccccccEEEEEEccEEEEEcccccccccccccEEEEEEEEEcccccHHHHHHHccccccEEEEEEEEccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHcccccccccEEEEc
cccccccccccccccccccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccEEEcccEEEEEEEcEEEccccccccccHHHEEEEEEEEEEccHHHHHHHHHcccHHHEEEEEEcccccccEEEEEEEccccEEEEEEEccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEcccccccccccccccccHHHHHHHHHHHHcccEEEEccccHEEHccccccccccccccEEEEEEccccHHHHHHHHHHccccccEEEEEcccccccccccccccccHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcEEEEEEcccccHHHHHHHHHcccccccccEEEEc
meksipkcgkserlQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSrwkhlwtslpclcfddslwfkdkrpgestQDVLTRFANFVNKVLLFHSADinkfsvhcsepniyltdlpplkswVSSAIERNVGDIELNHVYVDVLIElpdnictcKTLEMLKLKldfdfkiptsricfpslkclhaemyyphstciteklftiCPVLEDLLIEIHledkhsvtnlnisSLTLKRLTLSLEKVLFsntkhqvmirapnlehlciyDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDlqefdppnipaDRMLQLLKGITNTRFLSLSAGIISALdcafedyiptfpyltYLKVEIEESGFRLLPIILRslpnlgameidflivgdnlrwtepqcvpnclllHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFergsktckvefl
meksipkcgkserlQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKllifergsktckvefl
MEKSIPKCGKSERLQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVledllieihledKHSVTNLNIssltlkrltlslEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
***************************LPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTC*****
**************************SLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
MEKSIPKCGKSERLQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
**********************DRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSIPKCGKSERLQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVLLFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHSTCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSMKEACSKKLFQKLLIFERGSKTCKVEFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query468 2.2.26 [Sep-21-2011]
Q8H1M0442 F-box/FBD/LRR-repeat prot yes no 0.893 0.945 0.302 9e-37
Q9FJC1426 Putative FBD-associated F no no 0.878 0.964 0.288 7e-35
Q56XS8456 F-box/FBD/LRR-repeat prot no no 0.897 0.921 0.294 2e-33
Q9FNI8466 FBD-associated F-box prot no no 0.876 0.879 0.296 3e-33
Q8L7H1381 F-box/LRR-repeat protein no no 0.730 0.897 0.320 2e-32
Q9FLA2438 Putative F-box/FBD/LRR-re no no 0.886 0.947 0.286 4e-32
Q9FNJ5450 F-box/FBD/LRR-repeat prot no no 0.891 0.926 0.280 2e-31
Q94B46468 F-box/LRR-repeat protein no no 0.893 0.893 0.299 2e-31
Q9FNJ4443 Putative F-box/FBD/LRR-re no no 0.882 0.932 0.285 2e-31
Q9M3B7 630 Putative F-box/LRR-repeat no no 0.861 0.639 0.304 7e-31
>sp|Q8H1M0|FDL16_ARATH F-box/FBD/LRR-repeat protein At2g26030 OS=Arabidopsis thaliana GN=At2g26030 PE=2 SV=2 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 139/460 (30%), Positives = 226/460 (49%), Gaps = 42/460 (9%)

Query: 23  DRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGEST 82
           DRI  LPD +L  +LS+LP   +V+T +LS RW+ LW  +P L    S +     P E+ 
Sbjct: 4   DRICELPDSLLTQVLSYLPTIDSVKTSVLSKRWEFLWLRVPVLDLKVSDF-----PDEN- 57

Query: 83  QDVLTRFANFVNKVLLFH-SADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIEL 141
                 +A+F++  L F+  + + KF +   E   Y  D   L  WV + ++R +  ++ 
Sbjct: 58  ------YASFIDNFLEFNRKSRMRKFKLKYDE---YTYDDDRLAGWVVTTVDRGIQHLDA 108

Query: 142 NHVYVDVLIE--LPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAE-MYYPHST 198
                ++ +   +P NI  C TL  L L +    + P   +  PSLK +H E ++Y    
Sbjct: 109 KGFETNMCVREFMPQNIYKCNTLVSLML-VTVGIENPEFVVSLPSLKIMHLEDVWYYDDP 167

Query: 199 CITEKLFTICPVLEDLLI--EIHLEDKHSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVM 256
            I EK+ + CPVLED ++   I   +   +  L + SL+L+   L+ E  + S T   V 
Sbjct: 168 LIMEKIISGCPVLEDFVLIRPIDFCNLDVLQFLRVRSLSLRSFRLTFEYSV-SCTYFSVE 226

Query: 257 IRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNI-PADRMLQ 315
           I AP LE+L   DD   + +V  + SL+ +  D EF+  F       +P ++   D +  
Sbjct: 227 IDAPRLEYLNFNDDQSDTIVVKNMTSLSMIDIDSEFNVKFGG--SRLEPGDLRKRDIIRD 284

Query: 316 LLKGITNTRFLSLSAGIISALDCAFEDY-IPTFPYLTYLKVEIEESGFRLLPIILRSLPN 374
            L  I+  R + +S   +  LD   +   IP F  L  L+  +  S  +LL + L S PN
Sbjct: 285 FLTAISCVRHMIISRRTLEVLDRYSKLVPIPKFDNLYRLQAAVSRSMLQLLLVFLESCPN 344

Query: 375 LGAMEIDFLIVGDNLRWTEPQ-----CVPNCLLLHVKKIEICGF-EGLKHELELVKYLLK 428
           L  + +DF +       TEP+      VP CLL  ++ +EI     G +   +LV+Y LK
Sbjct: 345 LENLILDFTVS------TEPEQDGLTYVPQCLLSSLECVEIRELIMGEETGEKLVRYFLK 398

Query: 429 NSEVLDKMIIRSMKEACSKK---LFQKLLIFERGSKTCKV 465
           NS VL K+I+R    + + +   +F++L  F + S++C+V
Sbjct: 399 NSVVLKKLILRLEDSSIANQDSDIFKELSTFTKRSRSCEV 438

Arabidopsis thaliana (taxid: 3702)
>sp|Q9FJC1|FBD31_ARATH Putative FBD-associated F-box protein At5g53635 OS=Arabidopsis thaliana GN=At5g53635 PE=4 SV=1 Back     alignment and function description
>sp|Q56XS8|FDL2_ARATH F-box/FBD/LRR-repeat protein At1g13780 OS=Arabidopsis thaliana GN=At1g13780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNI8|FBD32_ARATH FBD-associated F-box protein At5g22730 OS=Arabidopsis thaliana GN=At5g22730 PE=2 SV=2 Back     alignment and function description
>sp|Q8L7H1|FBL75_ARATH F-box/LRR-repeat protein At4g14103 OS=Arabidopsis thaliana GN=At4g14103 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLA2|FDL34_ARATH Putative F-box/FBD/LRR-repeat protein At5g44950 OS=Arabidopsis thaliana GN=At5g44950 PE=4 SV=1 Back     alignment and function description
>sp|Q9FNJ5|FDL31_ARATH F-box/FBD/LRR-repeat protein At5g22660 OS=Arabidopsis thaliana GN=At5g22660 PE=2 SV=1 Back     alignment and function description
>sp|Q94B46|FBL74_ARATH F-box/LRR-repeat protein At4g14096 OS=Arabidopsis thaliana GN=At4g14096 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNJ4|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1 Back     alignment and function description
>sp|Q9M3B7|FBL54_ARATH Putative F-box/LRR-repeat protein At3g49150 OS=Arabidopsis thaliana GN=At3g49150 PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query468
147812093 607 hypothetical protein VITISV_040899 [Viti 0.925 0.713 0.371 8e-58
296086770411 unnamed protein product [Vitis vinifera] 0.799 0.909 0.337 6e-46
383101004530 F-box family protein [Arabidopsis haller 0.888 0.784 0.318 9e-38
224114976462 predicted protein [Populus trichocarpa] 0.897 0.909 0.318 2e-37
297825705440 F-box family protein [Arabidopsis lyrata 0.882 0.938 0.309 4e-36
15225244442 F-box/FBD/LRR-repeat protein [Arabidopsi 0.893 0.945 0.302 6e-35
296086764348 unnamed protein product [Vitis vinifera] 0.690 0.928 0.343 1e-33
24415593442 hypothetical protein [Arabidopsis thalia 0.893 0.945 0.297 2e-33
334188372426 F-box/RNI-like/FBD-like domains-containi 0.878 0.964 0.288 5e-33
297844280455 F16A14.1 [Arabidopsis lyrata subsp. lyra 0.846 0.870 0.302 3e-32
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 172/463 (37%), Positives = 249/463 (53%), Gaps = 30/463 (6%)

Query: 19  QEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRP 78
           +E  D IS+LPDE+LCHILSFLP K AV T ILS RW++LW S+P L FDD LW      
Sbjct: 6   EESRDIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTL 65

Query: 79  GESTQDVLTRFANFVNKVLLFHSAD-INKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVG 137
            E  + ++  F NFV+ VL       I KF +   + N     L  + SW+  A+ER V 
Sbjct: 66  VELEERIIM-FQNFVDGVLRHSEVSCIKKFRLGYRDNN-----LDSVYSWICIALERRVQ 119

Query: 138 DIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAEMYYPHS 197
           +++L H+ +D  +ELP     CKTL ++KL       IPT+ +  PSLK LH +      
Sbjct: 120 ELDL-HLLIDWRVELPPMFFICKTLVVVKLSCALFLDIPTT-VWLPSLKALHLKSVEYSD 177

Query: 198 TCITEKLFTICPVLEDLLIEIHLEDKHSVTNLNISSLTLKRLTLSLEKVLF----SNTKH 253
               +KL + CPVLE+L+IE    D   V N++  SL + R+    +         +  +
Sbjct: 178 DDSIQKLLSGCPVLEELVIEREERDNQWVVNVSNPSLKILRIFFFTDGFAHPYEQEDQDY 237

Query: 254 QVMIRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFD--PPNIPAD 311
           +V++ APNLE+L I D     Y V +L SL +   D+E      +D +EF+  P N    
Sbjct: 238 KVVVDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVE------QDSEEFEESPHNGGIS 291

Query: 312 R---MLQLLKGITNTRFLSLSAGIISALDCAFEDY-IPTFPYLTYLK-VEIEESGFRLLP 366
               + +LL  I+N + LSL+   + +L     DY +PTF  +T L+ + I    +  LP
Sbjct: 292 YHGPIYELLGRISNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLP 351

Query: 367 IILRSLPNLGAMEIDFLIVGDNL--RWTEPQCVPNCLLLHVKKIEICGFEGLKHELELVK 424
             L S PNL A+ I+     + +   W  P  VP CL+LH+K+IEI    G  +ELE V+
Sbjct: 352 NFLHSSPNLEALVIETGYTNELIPEGWLMPLQVPACLVLHLKEIEIRRIVGEDYELEAVE 411

Query: 425 YLLKNSEVLDKMIIRSMKEACSKK--LFQKLLIFERGSKTCKV 465
           YLLKN+EVL +M I   +    ++  + +KLL   RGS++C V
Sbjct: 412 YLLKNAEVLQQMTIDCHESYMDQEFCVCKKLLGLPRGSRSCFV 454

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|383101004|emb|CCD74546.1| F-box family protein [Arabidopsis halleri subsp. halleri] Back     alignment and taxonomy information
>gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297825705|ref|XP_002880735.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297326574|gb|EFH56994.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15225244|ref|NP_180173.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|79323090|ref|NP_001031420.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|143016455|sp|Q8H1M0.2|FDL16_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At2g26030 gi|3413710|gb|AAC31233.1| hypothetical protein [Arabidopsis thaliana] gi|50058977|gb|AAT69233.1| hypothetical protein At2g26030 [Arabidopsis thaliana] gi|51971321|dbj|BAD44325.1| unknown protein [Arabidopsis thaliana] gi|330252692|gb|AEC07786.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|330252693|gb|AEC07787.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296086764|emb|CBI32913.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|24415593|gb|AAN52167.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334188372|ref|NP_001190533.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] gi|75262547|sp|Q9FJC1.1|FBD31_ARATH RecName: Full=Putative FBD-associated F-box protein At5g53635 gi|9759202|dbj|BAB09739.1| heat shock transcription factor HSF30-like protein [Arabidopsis thaliana] gi|332009006|gb|AED96389.1| F-box/RNI-like/FBD-like domains-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297844280|ref|XP_002890021.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] gi|297335863|gb|EFH66280.1| F16A14.1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query468
TAIR|locus:2057422442 AT2G26030 "AT2G26030" [Arabido 0.903 0.957 0.287 1.2e-33
TAIR|locus:2014859456 AT1G13780 "AT1G13780" [Arabido 0.905 0.929 0.279 2.3e-32
TAIR|locus:2162489450 AT5G22660 "AT5G22660" [Arabido 0.897 0.933 0.264 7.7e-32
TAIR|locus:2162484466 AT5G22730 "AT5G22730" [Arabido 0.884 0.888 0.279 2.6e-31
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.933 0.968 0.262 4.2e-31
TAIR|locus:2037578458 AT1G78750 "AT1G78750" [Arabido 0.940 0.960 0.257 1.4e-30
TAIR|locus:505006456468 AT4G14096 "AT4G14096" [Arabido 0.540 0.540 0.292 3.5e-30
TAIR|locus:2081157520 AT3G59200 "AT3G59200" [Arabido 0.920 0.828 0.281 6e-30
TAIR|locus:2155327438 AT5G44950 "AT5G44950" [Arabido 0.905 0.968 0.260 6.2e-30
TAIR|locus:2082861 630 AT3G49150 "AT3G49150" [Arabido 0.863 0.641 0.276 2.6e-29
TAIR|locus:2057422 AT2G26030 "AT2G26030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 366 (133.9 bits), Expect = 1.2e-33, P = 1.2e-33
 Identities = 131/455 (28%), Positives = 209/455 (45%)

Query:    23 DRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLWFKDKRPGEST 82
             DRI  LPD +L  +LS+LP   +V+T +LS RW+ LW  +P L     L   D  P E+ 
Sbjct:     4 DRICELPDSLLTQVLSYLPTIDSVKTSVLSKRWEFLWLRVPVL----DLKVSDF-PDEN- 57

Query:    83 QDVLTRFANFVNKVLLFH-SADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIEL 141
                   +A+F++  L F+  + + KF +   E   Y  D   L  WV + ++R +  ++ 
Sbjct:    58 ------YASFIDNFLEFNRKSRMRKFKLKYDE---YTYDDDRLAGWVVTTVDRGIQHLDA 108

Query:   142 NHVYVDVLIE--LPDNICTCKTLEMLKLKLDFDFKIPTSRICFPSLKCLHAE-MYYPHST 198
                  ++ +   +P NI  C TL  L L +    + P   +  PSLK +H E ++Y    
Sbjct:   109 KGFETNMCVREFMPQNIYKCNTLVSLML-VTVGIENPEFVVSLPSLKIMHLEDVWYYDDP 167

Query:   199 CITEKLFTICPVXXXXXXXXXXXXKH-SVTN-LNIXXXXXXXXXXXXEKVLFSNTKHQVM 256
              I EK+ + CPV             +  V   L +            E  + S T   V 
Sbjct:   168 LIMEKIISGCPVLEDFVLIRPIDFCNLDVLQFLRVRSLSLRSFRLTFEYSV-SCTYFSVE 226

Query:   257 IRAPNLEHLCIYDDTLVSYMVHELHSLTEVHFDIEFDKYFVEDLQEFDPPNI-PADRMLQ 315
             I AP LE+L   DD   + +V  + SL+ +  D EF+  F       +P ++   D +  
Sbjct:   227 IDAPRLEYLNFNDDQSDTIVVKNMTSLSMIDIDSEFNVKFGGS--RLEPGDLRKRDIIRD 284

Query:   316 LLKGITNTRFLSLSAGIISALDCAFEDY-IPTFPYLTYLKVEIEESGFRLLPIILRSLPN 374
              L  I+  R + +S   +  LD   +   IP F  L  L+  +  S  +LL + L S PN
Sbjct:   285 FLTAISCVRHMIISRRTLEVLDRYSKLVPIPKFDNLYRLQAAVSRSMLQLLLVFLESCPN 344

Query:   375 LGAMEIDFLIVGDNLRWTEPQCVPNCLLLHVKKIEICGF-EGLKHELELVKYLLKNSEVL 433
             L  + +DF  V           VP CLL  ++ +EI     G +   +LV+Y LKNS VL
Sbjct:   345 LENLILDFT-VSTEPEQDGLTYVPQCLLSSLECVEIRELIMGEETGEKLVRYFLKNSVVL 403

Query:   434 DKMIIRSMKEACSKK---LFQKLLIFERGSKTCKV 465
              K+I+R    + + +   +F++L  F + S++C+V
Sbjct:   404 KKLILRLEDSSIANQDSDIFKELSTFTKRSRSCEV 438
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2014859 AT1G13780 "AT1G13780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162484 AT5G22730 "AT5G22730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006456 AT4G14096 "AT4G14096" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155327 AT5G44950 "AT5G44950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082861 AT3G49150 "AT3G49150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H1M0FDL16_ARATHNo assigned EC number0.30210.89310.9457yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query468
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 9e-13
pfam0838751 pfam08387, FBD, FBD 1e-11
pfam1293747 pfam12937, F-box-like, F-box-like 2e-05
pfam0064648 pfam00646, F-box, F-box domain 8e-05
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information 
 Score = 62.9 bits (154), Expect = 9e-13
 Identities = 26/71 (36%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 400 CLLLHVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRSM--KEACSKKLFQKLLIFE 457
           CLL  ++ +EI G+ G + E ELVKY L+N+  L K+ I      +    ++ ++LL   
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVETSDDEEKLEILKELLSLP 61

Query: 458 RGSKTCKVEFL 468
           R S +C+V+FL
Sbjct: 62  RASSSCQVQFL 72

Length = 72
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
>gnl|CDD|221867 pfam12937, F-box-like, F-box-like Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 468
KOG4341483 consensus F-box protein containing LRR [General fu 99.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.65
smart0057972 FBD domain in FBox and BRCT domain containing plan 99.34
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.12
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.06
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.91
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.89
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.88
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.59
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.5
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.49
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.36
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.3
KOG4341483 consensus F-box protein containing LRR [General fu 98.26
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.22
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.13
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.12
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.09
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.97
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.89
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.8
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.72
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.7
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.7
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.65
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 97.54
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.39
KOG0617264 consensus Ras suppressor protein (contains leucine 97.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.07
KOG0617264 consensus Ras suppressor protein (contains leucine 97.05
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.91
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.89
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 96.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 96.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.27
KOG4237498 consensus Extracellular matrix protein slit, conta 95.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.79
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.47
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.35
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 95.3
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.25
PLN03150623 hypothetical protein; Provisional 95.14
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.11
KOG2997366 consensus F-box protein FBX9 [General function pre 94.79
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.58
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 94.35
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.02
PLN03150623 hypothetical protein; Provisional 93.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 93.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.59
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.21
PRK15386426 type III secretion protein GogB; Provisional 93.0
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 92.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 92.66
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 91.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.92
KOG4237498 consensus Extracellular matrix protein slit, conta 89.61
KOG2123 388 consensus Uncharacterized conserved protein [Funct 89.48
PRK15386 426 type III secretion protein GogB; Provisional 89.27
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 85.64
PF13013109 F-box-like_2: F-box-like domain 85.61
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 85.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.19
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 83.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 80.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 80.18
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.69  E-value=7.9e-19  Score=163.63  Aligned_cols=345  Identities=16%  Similarity=0.128  Sum_probs=182.6

Q ss_pred             ccCCCChHHHHHHhcCCCchhhhhhhhhhhhHHHH------hccCceeEeecCcccccCCCCCCchhhhcHHHHHHHHHH
Q 040527           24 RISSLPDEILCHILSFLPIKCAVQTCILSSRWKHL------WTSLPCLCFDDSLWFKDKRPGESTQDVLTRFANFVNKVL   97 (468)
Q Consensus        24 ~~s~LPd~vL~~Ils~L~~~~~~r~s~vskrWr~l------w~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l   97 (468)
                      ..-.||+|++.+|||+|+++.++|++++|+-|...      |..+.-..|..+.-.                 ..|...+
T Consensus        71 ~~~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g-----------------~VV~~~~  133 (483)
T KOG4341|consen   71 ISRSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDG-----------------GVVENMI  133 (483)
T ss_pred             ccccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCC-----------------cceehHh
Confidence            33469999999999999999999999999999864      554432222211110                 1122222


Q ss_pred             hhCCCCceeEEeecCCCCCcCCCCCcHHHHHHHHHhcCceEEEEEEEecceeeecCCCccccCccceEEecccccCCC--
Q 040527           98 LFHSADINKFSVHCSEPNIYLTDLPPLKSWVSSAIERNVGDIELNHVYVDVLIELPDNICTCKTLEMLKLKLDFDFKI--  175 (468)
Q Consensus        98 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~wl~~~~~~~l~~L~l~~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~--  175 (468)
                      .+. |                               ..+++|.+.++.+..+..+-.....|++++.|.+.+|...+.  
T Consensus       134 ~Rc-g-------------------------------g~lk~LSlrG~r~v~~sslrt~~~~CpnIehL~l~gc~~iTd~s  181 (483)
T KOG4341|consen  134 SRC-G-------------------------------GFLKELSLRGCRAVGDSSLRTFASNCPNIEHLALYGCKKITDSS  181 (483)
T ss_pred             hhh-c-------------------------------cccccccccccccCCcchhhHHhhhCCchhhhhhhcceeccHHH
Confidence            222 2                               223344443333222333333334455555555555542111  


Q ss_pred             -CCCcccCCcccEEEEE-EEecCcccchhhhhccCCccceEEEeeee-ccCCCeeeEEEEcCcccEEEEeeeeecccCCc
Q 040527          176 -PTSRICFPSLKCLHAE-MYYPHSTCITEKLFTICPVLEDLLIEIHL-EDKHSVTNLNISSLTLKRLTLSLEKVLFSNTK  252 (468)
Q Consensus       176 -~~~~~~~~~L~~L~L~-~~~~~~~~l~~~l~~~cp~Le~L~L~~c~-~~~~~~~~~~i~~~~L~~L~l~~~~~~~~~~~  252 (468)
                       ......|++|+.|+|. |...++..+. .+..+||+|+.|+++.|. +.+.+++.+.-.+..|+.+...+|....++.+
T Consensus       182 ~~sla~~C~~l~~l~L~~c~~iT~~~Lk-~la~gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l  260 (483)
T KOG4341|consen  182 LLSLARYCRKLRHLNLHSCSSITDVSLK-YLAEGCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEAL  260 (483)
T ss_pred             HHHHHHhcchhhhhhhcccchhHHHHHH-HHHHhhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHH
Confidence             0012245555555555 4444444444 555555555555555554 11113333333334444444444442222222


Q ss_pred             eeEEEecCCeeEEEEeccccc-eEEE----ecCCCeeEEEEeeeeecccccCcCCCCCCCCchhhHHHHhhhcCceeEEE
Q 040527          253 HQVMIRAPNLEHLCIYDDTLV-SYMV----HELHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITNTRFLS  327 (468)
Q Consensus       253 ~~i~~~~p~L~~L~l~~~~~~-~~~~----~~~~~L~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~~~~l~~L~  327 (468)
                      ..+.-.++.+..+++..|... +..+    ..+..|+.+..         .++.     .+++..+..+.+++.+|+.|.
T Consensus       261 ~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~---------s~~t-----~~~d~~l~aLg~~~~~L~~l~  326 (483)
T KOG4341|consen  261 LKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCY---------SSCT-----DITDEVLWALGQHCHNLQVLE  326 (483)
T ss_pred             HHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcc---------cCCC-----CCchHHHHHHhcCCCceEEEe
Confidence            222223333333332222100 0000    00111111111         0111     113667788889999999999


Q ss_pred             EecccccccccccccC-CCCCCCcceEEEEEecCCch-hHHHHHhcCCCCceEEEeee--ecCCCCCCCCCCccCccccc
Q 040527          328 LSAGIISALDCAFEDY-IPTFPYLTYLKVEIEESGFR-LLPIILRSLPNLGAMEIDFL--IVGDNLRWTEPQCVPNCLLL  403 (468)
Q Consensus       328 l~~~~~~~~~~l~~~~-~~~~~~L~~L~l~~~~~~~~-~l~~ll~~~p~L~~L~l~~~--~~~~~~~w~~~~~~~~~~~~  403 (468)
                      +..+..-  ....+.. -..++.|+.|++..+....+ .+..+-.+||.|++|.++++  ++++.   ........|-..
T Consensus       327 l~~c~~f--sd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~itD~g---i~~l~~~~c~~~  401 (483)
T KOG4341|consen  327 LSGCQQF--SDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCELITDEG---IRHLSSSSCSLE  401 (483)
T ss_pred             ccccchh--hhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhhhhhhh---hhhhhhcccccc
Confidence            9988640  1111112 24778899999998887664 48899999999999999973  44442   222222346678


Q ss_pred             ceeEEEEEeecCchHHHHHHHHHHhcCcccceEEEEe
Q 040527          404 HVKKIEICGFEGLKHELELVKYLLKNSEVLDKMIIRS  440 (468)
Q Consensus       404 ~L~~v~i~~~~g~~~e~~~~~~ll~~a~~L~~l~i~~  440 (468)
                      +|.++++.+..+...  +..+ .+.+++.||++.++-
T Consensus       402 ~l~~lEL~n~p~i~d--~~Le-~l~~c~~Leri~l~~  435 (483)
T KOG4341|consen  402 GLEVLELDNCPLITD--ATLE-HLSICRNLERIELID  435 (483)
T ss_pred             ccceeeecCCCCchH--HHHH-HHhhCcccceeeeec
Confidence            899999998877643  2233 467889999977765

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query468
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 2e-06
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 3e-06
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 6e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 75.3 bits (184), Expect = 2e-14
 Identities = 86/494 (17%), Positives = 148/494 (29%), Gaps = 117/494 (23%)

Query: 8   CGKSE-RLQVLNQEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSL-PCL 65
            GK+   L V    K+     +  +I    L+     C     +L    K L   + P  
Sbjct: 161 SGKTWVALDVCLSYKVQC--KMDFKI--FWLNL--KNCNSPETVLEMLQK-LLYQIDPNW 213

Query: 66  CFDDSLWFKDKRPGESTQDVLTRFANFVNKV----LL-----FHSADINKFSVHCSEPNI 116
                     K    S Q  L R     +K     LL      ++   N F++ C     
Sbjct: 214 TSRSDHSSNIKLRIHSIQAELRRL--LKSKPYENCLLVLLNVQNAKAWNAFNLSC----- 266

Query: 117 YLTDLPPLKSWVSSAIERNVGDIELNHVYVDV-LIELPDNICTCKTLEMLKLKLDFDF-K 174
                   K  +++   + V D         + L      +   +   +L   LD     
Sbjct: 267 --------KILLTTR-FKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQD 317

Query: 175 IPTSRIC--FPSLKCLHAEM---------YYPHSTCITEKLFTICPVLEDLLIEIHLEDK 223
           +P   +    P    + AE           + H  C  +KL TI        IE      
Sbjct: 318 LP-REVLTTNPRRLSIIAESIRDGLATWDNWKHVNC--DKLTTI--------IES----- 361

Query: 224 HSVTNLNISSLTLKRLTLSLEKVLFSNTKHQVMIRAPNLEHLCIY----DDTLVSYMVHE 279
            S+  L       +++   L   +F        I  P    L +       + V  +V++
Sbjct: 362 -SLNVLE--PAEYRKMFDRL--SVFPP---SAHI--P-TILLSLIWFDVIKSDVMVVVNK 410

Query: 280 LHSLTEVHFDIEFDKYFVEDLQEFDPPNIPADRMLQLLKGITN----TRFLSLSAGIISA 335
           LH  + V    +     +  +   +   +  +    L + I +     +       I   
Sbjct: 411 LHKYSLVEKQPKESTISIPSIY-LE-LKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPY 468

Query: 336 LDCAFEDYIPTFPYLTY-LKVEIEESG-FRLLPIILRSLPNLGAMEIDFL---IVGDNLR 390
           LD     Y   + ++ + LK  IE      L  ++             FL   I  D+  
Sbjct: 469 LD----QYF--YSHIGHHLK-NIEHPERMTLFRMVFLDF--------RFLEQKIRHDSTA 513

Query: 391 WTEPQCVPNCLLLHVKKIE--ICGFEGLKHEL--ELVKYLLKNSEVLDKMIIRSMKEACS 446
           W     + N  L  +K  +  IC  +     L   ++ +L K  E L    I S K    
Sbjct: 514 WNASGSILN-TLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENL----ICS-KYTD- 566

Query: 447 KKLFQKLLIFERGS 460
             L +  L+ E  +
Sbjct: 567 --LLRIALMAEDEA 578
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Length = 297 Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query468
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.32
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.2
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.16
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.14
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.14
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.1
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.1
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.03
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.03
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.02
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.01
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.01
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.01
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.0
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.99
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.99
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.98
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 98.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.92
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.91
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.9
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.88
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.85
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.85
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.82
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.8
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.8
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.77
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.75
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.75
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.68
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.68
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.64
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.64
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.61
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.55
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.55
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.54
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.54
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.53
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.51
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.51
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.48
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.45
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.45
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.35
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.35
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.32
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.32
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.32
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.3
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.2
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.09
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.08
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.04
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.03
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.02
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.97
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.92
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.92
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.88
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.78
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.71
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.68
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.56
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.46
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.38
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.37
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.29
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.2
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.17
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.1
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.01
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.94
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.91
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.73
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 96.31
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.98
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 94.63
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.07
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.69
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 83.03
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
Probab=99.83  E-value=3e-21  Score=201.15  Aligned_cols=36  Identities=11%  Similarity=0.352  Sum_probs=33.0

Q ss_pred             CCCChHHHHHHhcCC-CchhhhhhhhhhhhHHHHhcc
Q 040527           26 SSLPDEILCHILSFL-PIKCAVQTCILSSRWKHLWTS   61 (468)
Q Consensus        26 s~LPd~vL~~Ils~L-~~~~~~r~s~vskrWr~lw~~   61 (468)
                      +.||||++.+||+|| +++|++++++|||||++++..
T Consensus        14 ~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~   50 (592)
T 3ogk_B           14 VATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSE   50 (592)
T ss_dssp             CCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhc
Confidence            389999999999999 899999999999999988543
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 468
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 2e-09
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 1e-08
d1p22a1118 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b 3e-06
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 7e-06
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 52.8 bits (126), Expect = 2e-09
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 19 QEKMDRISSLPDEILCHILSFLPIKCAVQTCILSSRWKHLWTSLPCLCFDDSLW 72
          Q + D IS LP E+  ++LSFL  K  +Q       W+        L  D+ LW
Sbjct: 13 QFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRI-------LAEDNLLW 59
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query468
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.15
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.09
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.66
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.64
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.57
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.54
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.54
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.48
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.47
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.34
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.16
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.15
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.13
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.1
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.09
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.0
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.98
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.94
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.91
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.84
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.74
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.37
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.32
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.96
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.45
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.79
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 90.95
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.15  E-value=8.3e-14  Score=128.61  Aligned_cols=57  Identities=21%  Similarity=0.047  Sum_probs=31.6

Q ss_pred             hhhcCceeEEEEecccccccccccccCCCCCCCcceEEEEEecCCchhHHHHHhcCCCCc
Q 040527          317 LKGITNTRFLSLSAGIISALDCAFEDYIPTFPYLTYLKVEIEESGFRLLPIILRSLPNLG  376 (468)
Q Consensus       317 l~~~~~l~~L~l~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~l~~ll~~~p~L~  376 (468)
                      +..+++|+.|+++++..-  ..-....+..+++|+.|++..+ .....+..+.+.||+|+
T Consensus       196 l~~~~~L~~L~L~~C~~i--~~~~l~~L~~~~~L~~L~l~~~-~~d~~l~~l~~~lp~L~  252 (284)
T d2astb2         196 FFQLNYLQHLSLSRCYDI--IPETLLELGEIPTLKTLQVFGI-VPDGTLQLLKEALPHLQ  252 (284)
T ss_dssp             GGGCTTCCEEECTTCTTC--CGGGGGGGGGCTTCCEEECTTS-SCTTCHHHHHHHSTTSE
T ss_pred             hcccCcCCEEECCCCCCC--ChHHHHHHhcCCCCCEEeeeCC-CCHHHHHHHHHhCcccc
Confidence            345677777777764320  1111123445677777777544 23355666667777765
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure