Citrus Sinensis ID: 040555

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
SGIEASYVSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGSKTVSDKNANNDTTEPGCSSHKPVQKLGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQKNACLSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKISILDKDFKEHLMP
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHccc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccHHHHHHHcccccccHHccccHHcccc
sgieasyvSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVaglghaapyISFAFKAISKHFCCLKNAILDQIhvsgsktvsdknanndttepgcsshkpvqklgflrpphwrsqralpDHAVAVLKTWLYenflhpyptdsdkqILAKQtglsknqvsNWFINARVRLWKPMVEEVHMLEigqtqttseatnsnfgvpsdhlntlfpEKLYQATQILqaehvptkhcrnkraqapeqneeqknaclsnlpsdqhigfsgsSGVTLALALNqndgndlsrpfpLKQIRKLLVNHKISILDKDFKEHLMP
sgieasyvssklAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSgsktvsdknanndttepgcsshkpvQKLGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTglsknqvsnWFINARVRLWKPMVEEVHMLEIGQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQKNACLSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKIsildkdfkehlmp
SGIEASYVSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGSKTVSDKNANNDTTEPGCSSHKPVQKLGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQKNACLSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKISILDKDFKEHLMP
******YVSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHV****************************LGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQ*************V*SDHLNTLFPEKLYQATQILQA******************************************GVTLALALN********RPFPLKQIRKLLVNHKISILDK********
******************LLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNA******************************************************VAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLW*******************************************************************************************************************QI**LL*NHKISILDKDFKEHL**
********SSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGSKTVSDKNANNDTTEPGCSSHKPVQKLGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPT******************NACLSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKISILDKDFKEHLMP
*****SYVSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGSKTV******************************WRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIG**************************************************************C*SNLPSDQHI***GSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKISILDKDFKE*L**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGIEASYVSSKLAWHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGSKTVSDKNANNDTTEPGCSSHKPVQKLGFLRPPHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQKNACLSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPLKQIRKLLVNHKISILDKDFKEHLMP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query313 2.2.26 [Sep-21-2011]
Q9LZM8575 BEL1-like homeodomain pro yes no 0.811 0.441 0.398 1e-50
O65685532 BEL1-like homeodomain pro no no 0.575 0.338 0.486 1e-45
Q9SIW1482 BEL1-like homeodomain pro no no 0.568 0.369 0.482 3e-45
Q9FWS9524 BEL1-like homeodomain pro no no 0.517 0.309 0.482 7e-43
Q9SW80739 BEL1-like homeodomain pro no no 0.530 0.224 0.459 8e-43
Q9FXG8538 BEL1-like homeodomain pro no no 0.546 0.317 0.462 5e-42
Q9SJJ3584 BEL1-like homeodomain pro no no 0.616 0.330 0.478 7e-42
Q94KL5627 BEL1-like homeodomain pro no no 0.530 0.264 0.453 1e-41
Q9SJ56680 BEL1-like homeodomain pro no no 0.488 0.225 0.485 6e-40
Q1PFD1290 BEL1-like homeodomain pro no no 0.578 0.624 0.401 4e-38
>sp|Q9LZM8|BLH9_ARATH BEL1-like homeodomain protein 9 OS=Arabidopsis thaliana GN=BLH9 PE=1 SV=1 Back     alignment and function desciption
 Score =  200 bits (508), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/316 (39%), Positives = 171/316 (54%), Gaps = 62/316 (19%)

Query: 23  KVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVS-- 80
           +VY +YK Y +Q+Q+V+ SFE VAGLGHAAPY + A KA+SKHF CLKNAI DQ+  S  
Sbjct: 240 EVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYANLALKALSKHFKCLKNAITDQLQFSHN 299

Query: 81  ---------------GSKTVSDKNANNDTTEPGCSSHKPVQKLGFL--RPPHWRSQRALP 123
                           +KT S +   +D++   CS+    Q+ GF     P WR  R LP
Sbjct: 300 NKIQQQQQCGHPMNSENKTDSLRFGGSDSSRGLCSAG---QRHGFPDHHAPVWRPHRGLP 356

Query: 124 DHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHM 183
           + AV VL+ WL+++FLHPYPTD+DK +LAKQTGLS+NQVSNWFINARVR+WKPMVEE+HM
Sbjct: 357 ERAVTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMVEEIHM 416

Query: 184 LEIGQTQTT------SEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRA 237
           LE  Q+Q +       E T++          T+FP+          A+  P      +RA
Sbjct: 417 LETRQSQRSSSSSWRDERTST----------TVFPDNSNNNPSSSSAQQRPNNSSPPRRA 466

Query: 238 QAPEQNEEQKNACL-------------------SNLPSDQHIGFSGSSGVTLALALNQND 278
           +  + +    N                      SN+P    +  S + GV+L L L+   
Sbjct: 467 RNDDVHGTNNNNSYVNSGSGGGSAVGFSYGIGSSNVPV---MNSSTNGGVSLTLGLHHQI 523

Query: 279 GNDLSRPFPLKQIRKL 294
           G  L  PFP+   ++ 
Sbjct: 524 G--LPEPFPMTTAQRF 537
Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate.
Arabidopsis thaliana (taxid: 3702)
>sp|O65685|BLH6_ARATH BEL1-like homeodomain protein 6 OS=Arabidopsis thaliana GN=BLH6 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIW1|BLH7_ARATH BEL1-like homeodomain protein 7 OS=Arabidopsis thaliana GN=BLH7 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWS9|BLH3_ARATH BEL1-like homeodomain protein 3 OS=Arabidopsis thaliana GN=BLH3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SW80|BLH2_ARATH BEL1-like homeodomain protein 2 OS=Arabidopsis thaliana GN=BLH2 PE=1 SV=3 Back     alignment and function description
>sp|Q9FXG8|BLH10_ARATH BEL1-like homeodomain protein 10 OS=Arabidopsis thaliana GN=BLH10 PE=1 SV=1 Back     alignment and function description
>sp|Q9SJJ3|BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana GN=BLH8 PE=1 SV=1 Back     alignment and function description
>sp|Q94KL5|BLH4_ARATH BEL1-like homeodomain protein 4 OS=Arabidopsis thaliana GN=BLH4 PE=2 SV=2 Back     alignment and function description
>sp|Q9SJ56|BLH1_ARATH BEL1-like homeodomain protein 1 OS=Arabidopsis thaliana GN=BLH1 PE=1 SV=1 Back     alignment and function description
>sp|Q1PFD1|BLH11_ARATH BEL1-like homeodomain protein 11 OS=Arabidopsis thaliana GN=BLH11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
255566520 426 bel1 homeotic protein, putative [Ricinus 0.856 0.629 0.571 2e-79
296086164 935 unnamed protein product [Vitis vinifera] 0.843 0.282 0.536 1e-68
147802503 1164 hypothetical protein VITISV_002486 [Viti 0.843 0.226 0.536 1e-68
224101055286 predicted protein [Populus trichocarpa] 0.792 0.867 0.55 3e-68
359481727 609 PREDICTED: uncharacterized protein LOC10 0.853 0.438 0.491 1e-65
147770644 642 hypothetical protein VITISV_024375 [Viti 0.853 0.415 0.491 1e-65
224109438288 predicted protein [Populus trichocarpa] 0.798 0.868 0.523 3e-64
297740294 561 unnamed protein product [Vitis vinifera] 0.814 0.454 0.478 2e-61
255577967 599 bel1 homeotic protein, putative [Ricinus 0.853 0.445 0.467 1e-60
225449354 472 PREDICTED: BEL1-like homeodomain protein 0.725 0.480 0.548 3e-59
>gi|255566520|ref|XP_002524245.1| bel1 homeotic protein, putative [Ricinus communis] gi|223536522|gb|EEF38169.1| bel1 homeotic protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  301 bits (772), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 190/278 (68%), Gaps = 10/278 (3%)

Query: 16  ELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILD 75
           +L L+  +VY +YKLYCQQMQSVV SF+TVAGLG+AAPY  +A K +SKHF CLKNA+LD
Sbjct: 122 KLMLMLDEVYRRYKLYCQQMQSVVESFQTVAGLGNAAPYFCYAIKLVSKHFTCLKNALLD 181

Query: 76  QIHVSGSKTVSDKNANN----DTTEPGCSSHK-PVQKLGFLRPPHWRSQRALPDHAVAVL 130
           QIH +G KT  D N          E G   H+ P     FL+ P WRSQR LPDHAVA+L
Sbjct: 182 QIHFTG-KTSDDGNEKVPRFWAADEQGSVQHQNPALNFSFLQHPVWRSQRGLPDHAVALL 240

Query: 131 KTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEIGQTQ 190
           KTWL+E+FLHPYPTDSDKQILA+QTGLS+ QVSNWFINARVRLWKPMVEEV+ L   Q Q
Sbjct: 241 KTWLFEHFLHPYPTDSDKQILAQQTGLSRTQVSNWFINARVRLWKPMVEEVYKLASQQAQ 300

Query: 191 TTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQKNAC 250
              EA N N  +PSD    L  EKL Q +   +AE+   K  RN+ A  P Q ++ K+  
Sbjct: 301 VPLEAVNHNANLPSD----LSMEKLPQTSNQQKAENFHLKRSRNELADIPVQRQDHKSVS 356

Query: 251 LSNLPSDQHIGFSGSSGVTLALALNQNDGNDLSRPFPL 288
             NL      G SGS+GV+LAL L+QN+G D SRP P+
Sbjct: 357 FDNLTRHYQTGISGSNGVSLALGLHQNNGTDSSRPLPI 394

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086164|emb|CBI31605.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802503|emb|CAN73118.1| hypothetical protein VITISV_002486 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224101055|ref|XP_002312123.1| predicted protein [Populus trichocarpa] gi|222851943|gb|EEE89490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359481727|ref|XP_002272686.2| PREDICTED: uncharacterized protein LOC100266680 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770644|emb|CAN73410.1| hypothetical protein VITISV_024375 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224109438|ref|XP_002315195.1| predicted protein [Populus trichocarpa] gi|222864235|gb|EEF01366.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297740294|emb|CBI30476.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577967|ref|XP_002529855.1| bel1 homeotic protein, putative [Ricinus communis] gi|223530631|gb|EEF32505.1| bel1 homeotic protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225449354|ref|XP_002277603.1| PREDICTED: BEL1-like homeodomain protein 9-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
TAIR|locus:2185183575 RPL "AT5G02030" [Arabidopsis t 0.830 0.452 0.429 3.6e-50
TAIR|locus:2057856584 BLH8 "AT2G27990" [Arabidopsis 0.568 0.304 0.529 1.9e-42
TAIR|locus:2139614532 BLH6 "AT4G34610" [Arabidopsis 0.869 0.511 0.381 4e-42
TAIR|locus:2042609482 BLH7 "AT2G16400" [Arabidopsis 0.629 0.408 0.452 1.2e-40
TAIR|locus:2018398524 BLH3 "AT1G75410" [Arabidopsis 0.543 0.324 0.472 1.8e-39
TAIR|locus:2039250680 BLH1 "AT2G35940" [Arabidopsis 0.520 0.239 0.485 7.6e-39
TAIR|locus:2115000739 BLH2 "AT4G36870" [Arabidopsis 0.571 0.242 0.448 1.9e-38
TAIR|locus:2049035627 BLH4 "BEL1-like homeodomain 4" 0.581 0.290 0.44 3.3e-38
TAIR|locus:2013154538 BEL10 "AT1G19700" [Arabidopsis 0.584 0.340 0.45 3.4e-38
TAIR|locus:2018457290 BLH11 "BEL1-like homeodomain 1 0.578 0.624 0.406 1.9e-35
TAIR|locus:2185183 RPL "AT5G02030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 522 (188.8 bits), Expect = 3.6e-50, P = 3.6e-50
 Identities = 128/298 (42%), Positives = 171/298 (57%)

Query:    23 KVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAILDQIHVSGS 82
             +VY +YK Y +Q+Q+V+ SFE VAGLGHAAPY + A KA+SKHF CLKNAI DQ+  S +
Sbjct:   240 EVYKRYKQYYEQLQAVMGSFECVAGLGHAAPYANLALKALSKHFKCLKNAITDQLQFSHN 299

Query:    83 KTVSDK-------NANNDTTE---PGCSSHKPV----QKLGFL--RPPHWRSQRALPDHA 126
               +  +       N+ N T      G  S + +    Q+ GF     P WR  R LP+ A
Sbjct:   300 NKIQQQQQCGHPMNSENKTDSLRFGGSDSSRGLCSAGQRHGFPDHHAPVWRPHRGLPERA 359

Query:   127 VAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEEVHMLEI 186
             V VL+ WL+++FLHPYPTD+DK +LAKQTGLS+NQVSNWFINARVR+WKPMVEE+HMLE 
Sbjct:   360 VTVLRAWLFDHFLHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVRVWKPMVEEIHMLET 419

Query:   187 GQTQTTSEATNSNFGVPSDHLNTLFPEKLYQATQILQAEHVPTKHCRNKRAQAPEQNEEQ 246
              Q+Q +S ++  +    +    T+FP+          A+  P      +RA+  + +   
Sbjct:   420 RQSQRSSSSSWRDERTST----TVFPDNSNNNPSSSSAQQRPNNSSPPRRARNDDVHGTN 475

Query:   247 KNACLSNLPSD--QHIGFS---GSS-----------GVTLALALNQNDGNDLSRPFPL 288
              N    N  S     +GFS   GSS           GV+L L L+   G  L  PFP+
Sbjct:   476 NNNSYVNSGSGGGSAVGFSYGIGSSNVPVMNSSTNGGVSLTLGLHHQIG--LPEPFPM 531
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0007389 "pattern specification process" evidence=RCA;IMP
GO:0010051 "xylem and phloem pattern formation" evidence=RCA;IMP
GO:0080006 "internode patterning" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0010076 "maintenance of floral meristem identity" evidence=IGI
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI
GO:0048645 "organ formation" evidence=IGI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IMP
GO:0048457 "floral whorl morphogenesis" evidence=IMP
GO:0010154 "fruit development" evidence=IMP
GO:0048367 "shoot system development" evidence=IGI
GO:0010077 "maintenance of inflorescence meristem identity" evidence=IGI
GO:0010223 "secondary shoot formation" evidence=IGI
GO:0006306 "DNA methylation" evidence=RCA
GO:0006342 "chromatin silencing" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009886 "post-embryonic morphogenesis" evidence=RCA
GO:0009887 "organ morphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0048438 "floral whorl development" evidence=RCA
GO:0048439 "flower morphogenesis" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
GO:0048507 "meristem development" evidence=RCA
GO:0048513 "organ development" evidence=RCA
GO:0048519 "negative regulation of biological process" evidence=RCA
TAIR|locus:2057856 BLH8 "AT2G27990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139614 BLH6 "AT4G34610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042609 BLH7 "AT2G16400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018398 BLH3 "AT1G75410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039250 BLH1 "AT2G35940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115000 BLH2 "AT4G36870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049035 BLH4 "BEL1-like homeodomain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013154 BEL10 "AT1G19700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018457 BLH11 "BEL1-like homeodomain 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
pfam07526139 pfam07526, POX, Associated with HOX 2e-25
smart00574140 smart00574, POX, domain associated with HOX domain 1e-20
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 4e-20
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 8e-13
smart0038957 smart00389, HOX, Homeodomain 2e-11
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-06
>gnl|CDD|219452 pfam07526, POX, Associated with HOX Back     alignment and domain information 
 Score = 98.5 bits (246), Expect = 2e-25
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 7/68 (10%)

Query: 15  HELQ-----LLAL--KVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFC 67
            ELQ     LL++  +V  +Y+ Y  QMQ V++SFE VAGLG A PY + A +A+S+HF 
Sbjct: 72  QELQRKKAKLLSMLEEVDRRYRQYYDQMQMVISSFEAVAGLGAAKPYTALALQAMSRHFR 131

Query: 68  CLKNAILD 75
           CL++AI  
Sbjct: 132 CLRDAISG 139

The function of this domain is unknown. It is often found in plant proteins associated with pfam00046. Length = 139
>gnl|CDD|214728 smart00574, POX, domain associated with HOX domains Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 313
PF07526140 POX: Associated with HOX; InterPro: IPR006563 This 99.93
KOG0775304 consensus Transcription factor SIX and related HOX 99.93
KOG0773342 consensus Transcription factor MEIS1 and related H 99.93
smart00574140 POX domain associated with HOX domains. 99.91
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 99.65
KOG0774334 consensus Transcription factor PBX and related HOX 99.6
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.47
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.46
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.44
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.0
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 98.96
KOG0843197 consensus Transcription factor EMX1 and related HO 98.94
KOG0489261 consensus Transcription factor zerknullt and relat 98.94
KOG0850245 consensus Transcription factor DLX and related pro 98.9
KOG0488309 consensus Transcription factor BarH and related HO 98.89
KOG0493342 consensus Transcription factor Engrailed, contains 98.86
KOG0483198 consensus Transcription factor HEX, contains HOX a 98.85
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 98.78
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 98.76
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 98.75
COG5576156 Homeodomain-containing transcription factor [Trans 98.73
KOG0848317 consensus Transcription factor Caudal, contains HO 98.64
KOG2251228 consensus Homeobox transcription factor [Transcrip 98.63
KOG0492246 consensus Transcription factor MSH, contains HOX d 98.62
KOG3802398 consensus Transcription factor OCT-1, contains POU 98.56
KOG0491194 consensus Transcription factor BSH, contains HOX d 98.43
KOG0494332 consensus Transcription factor CHX10 and related H 98.4
KOG0486351 consensus Transcription factor PTX1, contains HOX 98.38
KOG4577383 consensus Transcription factor LIM3, contains LIM 98.28
KOG2252558 consensus CCAAT displacement protein and related h 98.27
KOG0847288 consensus Transcription factor, contains HOX domai 98.14
KOG0844408 consensus Transcription factor EVX1, contains HOX 98.0
KOG0849354 consensus Transcription factor PRD and related pro 97.79
KOG0490235 consensus Transcription factor, contains HOX domai 97.69
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 97.3
KOG0773342 consensus Transcription factor MEIS1 and related H 97.18
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.91
KOG0490235 consensus Transcription factor, contains HOX domai 96.61
KOG1146 1406 consensus Homeobox protein [General function predi 93.36
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 86.12
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 84.56
>PF07526 POX: Associated with HOX; InterPro: IPR006563 This domain in found exclusively in plant proteins, associated with HOX domains which may suggest these proteins are homeodomain transcription factors Back     alignment and domain information 
Probab=99.93  E-value=6.6e-27  Score=201.50  Aligned_cols=61  Identities=49%  Similarity=0.781  Sum_probs=59.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccccHHHHHHHHHhhcccchHHHH
Q 040555           14 WHELQLLALKVYWKYKLYCQQMQSVVASFETVAGLGHAAPYISFAFKAISKHFCCLKNAIL   74 (313)
Q Consensus        14 ~~~l~~~l~ev~~ry~~y~~qmq~v~~sfe~~ag~g~a~~y~~lal~~~Sr~Fr~l~~~i~   74 (313)
                      +.|||+||||||+||+|||+|||+||+|||+|||.|+|++||+||+++|||||||||++|.
T Consensus        79 K~KLl~mL~eVd~RY~qY~~Qmq~VvssFe~vaG~gaA~~YtalAlqamSrhFR~LRdaI~  139 (140)
T PF07526_consen   79 KAKLLSMLDEVDRRYRQYYDQMQAVVSSFEAVAGLGAAAPYTALALQAMSRHFRCLRDAIS  139 (140)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcchhhHHHHHHHHHHHHHHHHHHhc
Confidence            3499999999999999999999999999999999999999999999999999999999996

>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>smart00574 POX domain associated with HOX domains Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
1x2n_A73 Solution Structure Of The Homeobox Domain Of Human 2e-11
3k2a_A67 Crystal Structure Of The Homeobox Domain Of Human H 2e-10
2lk2_A89 Solution Nmr Structure Of Homeobox Domain (171-248) 4e-10
2dmn_A83 The Solution Structure Of The Homeobox Domain Of Hu 1e-09
1b72_B87 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-07
1lfu_P82 Nmr Solution Stucture Of The Extended Pbx Homeodoma 3e-07
1du6_A64 Solution Structure Of The Truncated Pbx Homeodomain 3e-07
1puf_B73 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 4e-07
1b8i_B63 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 1e-06
4egc_A559 Crystal Structure Of Mbp-fused Human Six1 Bound To 6e-05
>pdb|1X2N|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Pknox1 Length = 73 Back     alignment and structure 
Iteration: 1

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 27/52 (51%), Positives = 40/52 (76%)
Query: 122 LPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRL 173
           LP HA  V+++WL+++  HPYPT+ +K+ +A QT L+  QV+NWFINAR R+
Sbjct: 14  LPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 65
>pdb|3K2A|A Chain A, Crystal Structure Of The Homeobox Domain Of Human Homeobox Protein Meis2 Length = 67 Back     alignment and structure
>pdb|2LK2|A Chain A, Solution Nmr Structure Of Homeobox Domain (171-248) Of Human Homeobox Protein Tgif1, Northeast Structural Genomics Consortium Target Hr4411b Length = 89 Back     alignment and structure
>pdb|2DMN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Tgif2lx Length = 83 Back     alignment and structure
>pdb|1B72|B Chain B, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 87 Back     alignment and structure
>pdb|1LFU|P Chain P, Nmr Solution Stucture Of The Extended Pbx Homeodomain Bound To Dna Length = 82 Back     alignment and structure
>pdb|1DU6|A Chain A, Solution Structure Of The Truncated Pbx Homeodomain Length = 64 Back     alignment and structure
>pdb|1PUF|B Chain B, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 73 Back     alignment and structure
>pdb|1B8I|B Chain B, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 63 Back     alignment and structure
>pdb|4EGC|A Chain A, Crystal Structure Of Mbp-fused Human Six1 Bound To Human Eya2 Eya Domain Length = 559 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 6e-35
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 8e-33
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 1e-32
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 8e-32
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 2e-31
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 5e-31
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 3e-29
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-26
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 2e-25
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 5e-25
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-09
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 6e-09
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 3e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 4e-08
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 7e-08
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-07
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-05
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 5e-05
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 6e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-04
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-04
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-04
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 7e-04
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 8e-04
3d1n_I151 POU domain, class 6, transcription factor 1; prote 9e-04
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
 Score =  121 bits (305), Expect = 6e-35
 Identities = 28/84 (33%), Positives = 45/84 (53%)

Query: 116 WRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWK 175
            R +R     A  +L  + Y +  +PYP++  K+ LAK+ G++ +QVSNWF N R+R  K
Sbjct: 2   RRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKK 61

Query: 176 PMVEEVHMLEIGQTQTTSEATNSN 199
            + +      I   +T   ATN +
Sbjct: 62  NIGKFQEEANIYAAKTAVTATNVS 85
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.78
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.76
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.75
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.74
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.7
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.69
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.68
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.68
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.66
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.57
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.56
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.54
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.54
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.54
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.53
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.53
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.53
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.52
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.52
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.52
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.52
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.52
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.52
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.51
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.51
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.5
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.5
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.5
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.5
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.49
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.49
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.49
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.48
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.48
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.47
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.47
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.47
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.47
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.47
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.46
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.46
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.46
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.46
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.45
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.44
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.44
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.44
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.43
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.43
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.43
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.42
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.42
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.41
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.41
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.4
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.39
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.39
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.38
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.38
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.37
2e19_A64 Transcription factor 8; homeobox domain, structura 99.34
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.33
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.31
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.31
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.31
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.28
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.28
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.28
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.24
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.23
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.21
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.21
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.04
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.03
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.0
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.99
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 96.87
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.23
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
Probab=99.78  E-value=2.3e-19  Score=139.99  Aligned_cols=67  Identities=37%  Similarity=0.768  Sum_probs=61.1

Q ss_pred             CCCCCCCCCChhHHHHHHHHHHHccCCCCCCHHHHHHHHHHhCCChHHHhhhhhhhHhhhchhhHHH
Q 040555          114 PHWRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPMVEE  180 (313)
Q Consensus       114 ~~~r~rr~lp~~a~~iL~~wf~~h~~~PYPs~~eK~~LA~~tgLs~~QV~NWF~N~R~R~kk~~~~e  180 (313)
                      ..+++++.|+..++.+|++||.+|..||||+.++|..||..|||+..||.|||+|+|+|.|++++++
T Consensus         6 ~~rk~R~~~s~~q~~~L~~~f~~~~~~pYPs~~~r~~LA~~~gLs~~qV~~WFqNrR~r~k~~~~~~   72 (83)
T 2dmn_A            6 SGKKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNWFINARRRILPDMLQQ   72 (83)
T ss_dssp             CCCCCCSSCCHHHHHHHHHHHHHTTTTCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHTHHHHTCC
T ss_pred             CCCCCCCcCCHHHHHHHHHHHHHhccCCCCCHHHHHHHHHHHCcCHHHhhHHhhhhHhhhcHHHHHh
Confidence            3455666799999999999999999999999999999999999999999999999999999887644
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 313
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-18
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-17
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 9e-16
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-08
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-07
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-07
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-05
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-05
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-05
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-04
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-04
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-04
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-04
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-04
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-04
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 4e-04
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 4e-04
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-04
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 7e-04
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 8e-04
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 0.001
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 0.001
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 0.001
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 0.002
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 0.002
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein pknox1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.9 bits (187), Expect = 2e-18
 Identities = 27/57 (47%), Positives = 41/57 (71%)

Query: 117 RSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRL 173
             +  LP HA  V+++WL+++  HPYPT+ +K+ +A QT L+  QV+NWFINAR R+
Sbjct: 4   NKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRI 60
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.76
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.75
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.59
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.59
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.59
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.59
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.58
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.56
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.56
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.56
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.56
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.55
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.55
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.55
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.54
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.54
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.53
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.53
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.53
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.52
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.51
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.5
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.47
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.46
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.45
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.45
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.43
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.39
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.38
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.33
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 80.77
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: pbx1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=3.2e-19  Score=134.75  Aligned_cols=62  Identities=37%  Similarity=0.723  Sum_probs=58.4

Q ss_pred             CCCCCCCChhHHHHHHHHHHHccCCCCCCHHHHHHHHHHhCCChHHHhhhhhhhHhhhchhh
Q 040555          116 WRSQRALPDHAVAVLKTWLYENFLHPYPTDSDKQILAKQTGLSKNQVSNWFINARVRLWKPM  177 (313)
Q Consensus       116 ~r~rr~lp~~a~~iL~~wf~~h~~~PYPs~~eK~~LA~~tgLs~~QV~NWF~N~R~R~kk~~  177 (313)
                      +|+++.|+++++.+|+.||.+|..||||+.++|.+||..|||+.+||.|||+|+|+|.|+..
T Consensus         2 rk~R~~~t~~q~~~Le~~f~~~~~~pYPs~~~k~~La~~~gl~~~qv~~WF~N~R~r~k~~~   63 (73)
T d1pufb_           2 RRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNI   63 (73)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHTTTSCCCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHCT
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHCcCHHHhHHHHHHHHHHhcccc
Confidence            56777899999999999999999999999999999999999999999999999999998754
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure