Citrus Sinensis ID: 040611

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MSTFKKQSSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIEDKNNNDRKEKSSSRYEELEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
cccccHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccccHHHccccccHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcc
ccHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccHHHEEEEEHHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEc
mstfkkqssSLEHFVTDILEmspglllkantkgeTLLHIAGRHGHVDIVKDLIAEckkphqndpEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVtkedpslpydannagetplYLAAERGYKDVMQDIFLtckspaghgpmgrtALHAVAFRNDTEMTKVLLESSigtqtskvdqqgwrplhlaAHLGYYDVVKELLKADKSAaykadnegkiplhlaavfgngerneqgsntsiedknnndrkekssSRYEELEQYVNKNKEAHLVVAALIATVTFTvgitvpggyineirsdqgaavltkssdfqaFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
mstfkkqssslEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECkkphqndpEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTkedpslpydannaGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIgtqtskvdqqgwRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFgngerneqgsntsiedknnndrkeksssrYEELEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
MSTFKKQSSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIEDKNNNDRKEKSSSRYEELEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
************************************************VKDLIA************VIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTK*****PYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVF***********************************YVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVF*
MSTFK**SSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIEDKNNN******************KNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
**********LEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIED****************LEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
MSTFKKQSSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIEDKNNNDRKEKSSSRYEELEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTFKKQSSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQGSNTSIEDKNNNDRKEKSSSRYEELEQYVNKNKEAHLVVAALIATVTFTVGITVPGGYINEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFLYIYDYAAHFLLITAAVRFQVRRLKEIREEFQRIYFLVFE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query434 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.829 0.610 0.246 3e-17
Q6AWW5524 Ankyrin repeat-containing no no 0.423 0.351 0.299 1e-14
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.419 0.096 0.311 3e-13
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.407 0.090 0.306 1e-12
Q02357 1862 Ankyrin-1 OS=Mus musculus no no 0.428 0.099 0.301 4e-12
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.407 0.040 0.306 5e-12
Q80YE7 1442 Death-associated protein no no 0.412 0.124 0.303 4e-11
P53355 1430 Death-associated protein no no 0.398 0.120 0.294 4e-11
Q8BZ25745 Ankyrin repeat and protei no no 0.444 0.259 0.293 1e-10
Q8NFD2765 Ankyrin repeat and protei no no 0.405 0.230 0.305 2e-10
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 114/463 (24%), Positives = 181/463 (39%), Gaps = 103/463 (22%)

Query: 10  SLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIE 69
           S E F  ++ E+   ++ + N  GET L  A   GH+D+VK+L+    +           
Sbjct: 106 SGEEFDAEVAEIRASIVNEVNELGETALFTAADKGHLDVVKELLKYSSRES--------- 156

Query: 70  AATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYK 129
                +   N +    LH A       +V+++   D +L      +  TPL  AA RG+ 
Sbjct: 157 -----IAKKNRSGYDPLHIAAIQGHHAIVEVLLDHDATLSQTFGPSNATPLVSAAMRGHT 211

Query: 130 DVMQDIFLTCKSPAGH-----GPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQG 184
           +V+  +     S AG+         + ALH  A +   E+ K LL S       ++D++G
Sbjct: 212 EVVNQLL----SKAGNLLEISRSNNKNALHLAARQGHVEVIKALL-SKDPQLARRIDKKG 266

Query: 185 WRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNE-------QG 237
              LH+A      +VVK LL AD +   + D      LH+A      E  E         
Sbjct: 267 QTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTN 326

Query: 238 SNTSIEDKN---------------------------------NNDRKEKSSSRYE----- 259
           +NT   D                                   N  R E  S+  +     
Sbjct: 327 ANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRDELRSTVTQIKNDV 386

Query: 260 --ELEQYVNKNKEAHLV---------------------VAALIATVTFTVGITVPGGYIN 296
             +LEQ    NK  H +                     VA L ATV F    TVPGG  N
Sbjct: 387 HIQLEQTKRTNKNVHNISKELRKLHREGINNATNSVTVVAVLFATVAFAAIFTVPGGDNN 446

Query: 297 EIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGM 356
           +     G+AV+   + F+ F IF++LA+  S + V + I L     K E+ ++  I++ +
Sbjct: 447 D-----GSAVVVGRASFKIFFIFNALALFTSLAVVVVQITLVRGETKAEKRVVEVINK-L 500

Query: 357 IQLALVVMVFAFLTGTYSVLH-----SAKVLAVIISIITDGFF 394
           + LA +    AFL  +Y V+      +A+++ V+  +I  G  
Sbjct: 501 MWLASMCTSVAFLASSYIVVGRKNEWAAELVTVVGGVIMAGVL 543

Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 Back     alignment and function description
>sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 Back     alignment and function description
>sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
255585399 575 ankyrin repeat-containing protein, putat 0.877 0.662 0.327 5e-59
298205151 1006 unnamed protein product [Vitis vinifera] 0.847 0.365 0.311 4e-51
255551947 582 ankyrin repeat-containing protein, putat 0.831 0.620 0.338 3e-50
298205141 645 unnamed protein product [Vitis vinifera] 0.864 0.581 0.312 9e-50
147826716 545 hypothetical protein VITISV_009182 [Viti 0.841 0.669 0.331 3e-48
296085926466 unnamed protein product [Vitis vinifera] 0.808 0.753 0.336 3e-47
147842376 546 hypothetical protein VITISV_043077 [Viti 0.859 0.683 0.311 7e-47
147772498 708 hypothetical protein VITISV_032148 [Viti 0.488 0.299 0.450 3e-42
225432914 596 PREDICTED: ankyrin repeat-containing pro 0.483 0.352 0.455 3e-42
296085927 611 unnamed protein product [Vitis vinifera] 0.453 0.322 0.495 2e-41
>gi|255585399|ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  234 bits (598), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 247/488 (50%), Gaps = 107/488 (21%)

Query: 14  FVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATL 73
           FV + L+M P +LL+ N  G+TLLHIA R+GH+DIVK LI   +  HQ D E   EA   
Sbjct: 76  FVKEALDMCPQILLQINADGDTLLHIAARYGHLDIVKLLIEHTRAQHQ-DLESAGEAVRQ 134

Query: 74  MLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQ 133
           ML MTN++K+ ALHEA R +  ++V+++ ++DP   + +N+ GETPLYLA+ERG+ +V+ 
Sbjct: 135 MLRMTNKSKETALHEAARNDHPDLVELLIEQDPDFVHSSNDFGETPLYLASERGHLEVVV 194

Query: 134 DIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRP------ 187
            +   C S A  GP G+TALHA A      +   +L+    +  +K D+ GW P      
Sbjct: 195 IMLKACTSLAYGGPNGKTALHAAAMHRHGGIVHAILDKKT-SLVNKADEMGWTPLHYAAY 253

Query: 188 -----------------------------LHLAA-------------------------- 192
                                        LHLAA                          
Sbjct: 254 IGASRVVKQLLGYDKYVAYAADKARRRTALHLAACQANIKSMREIIFKCPDCCKLVDNRG 313

Query: 193 -HLGYYDVVKE------LLKADKSAAY---KADNEGKIPLHLAAVFGNGERN----EQGS 238
            ++ +Y V+ +      +L A+ S  Y   + D +G  PLHL A   +  R+     +G 
Sbjct: 314 WNVAHYAVISKSDDALKILLANPSCIYLVNEKDAQGNTPLHLLAALQSHPRSLMHHAKGH 373

Query: 239 NTSIEDKNNNDRKE---KSSSRYEELEQYVN----------------------KNKEAHL 273
             ++  +N    KE   +S  R +E+++++                       + +++H+
Sbjct: 374 RFAVYRQNFLCIKELLSRSPCRKKEIQEWMRDLGGGPLGQIVIKKDDFILTFERARDSHI 433

Query: 274 VVAALIATVTFTVGITVPGGY-INEIRSDQGAAVLTKSSDFQAFVIFDSLAMILSTSAVF 332
           VVAAL+ATVTF    T+PGGY  N+   DQG A+L K+S F+AF+I D++AM+LSTS++F
Sbjct: 434 VVAALVATVTFAAAFTLPGGYRSNDDEKDQGVAILGKNSAFKAFLITDAIAMVLSTSSLF 493

Query: 333 IHIYLSLIPDKIEEYILWQISRGM--IQLALVVMVFAFLTGTYSVLHSAKVLAVIISIIT 390
           IH  L+L      +  +W +      I  A+  MV AF+TGTY+VL  ++ LA+    I 
Sbjct: 494 IHFTLAL--HGYRQRFMWLMVYAFRCIVFAIEAMVVAFVTGTYAVLSPSQGLAISTCAIG 551

Query: 391 DGFFLYIY 398
             FF++++
Sbjct: 552 LSFFIFVF 559

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|298205151|emb|CBI17210.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255551947|ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|298205141|emb|CBI17200.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826716|emb|CAN61889.1| hypothetical protein VITISV_009182 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085926|emb|CBI31367.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147842376|emb|CAN69518.1| hypothetical protein VITISV_043077 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772498|emb|CAN60780.1| hypothetical protein VITISV_032148 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432914|ref|XP_002280197.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085927|emb|CBI31368.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query434
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.670 0.434 0.278 2.1e-22
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.884 0.580 0.254 1.2e-21
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.808 0.646 0.253 5.6e-20
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.486 0.329 0.268 7.7e-20
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.672 0.420 0.266 1.6e-18
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.642 0.412 0.272 9.1e-18
TAIR|locus:2031948627 AT1G05640 "AT1G05640" [Arabido 0.882 0.610 0.243 2.7e-17
TAIR|locus:2020833 616 AT1G03670 "AT1G03670" [Arabido 0.479 0.337 0.285 5.8e-16
TAIR|locus:2092522590 ITN1 "INCREASED TOLERANCE TO N 0.822 0.605 0.247 8.9e-16
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.859 0.614 0.236 2.1e-15
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 231 (86.4 bits), Expect = 2.1e-22, Sum P(2) = 2.1e-22
 Identities = 87/312 (27%), Positives = 144/312 (46%)

Query:   110 YDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGH---GPMGRTALHAVAFRNDTEMTK 166
             Y  +  G  P++ AA+  + +++++    C  PA       +G+  LH VA +N+  +T 
Sbjct:   324 YVCDQDGSFPIHSAAKNEHYEIIKEFIKRC--PASKYLLNRLGQNILH-VAAKNEASLTA 380

Query:   167 VLLESSIGTQTSKVDQQ--GWRPLHLAAHLGYYDVVK-------ELLKADKSAAYKADNE 217
              +L     T+   V Q   G  PLHLA     +D +        E+LK    +  +A + 
Sbjct:   381 YMLMHDKDTKHLGVGQDVDGNTPLHLAVMNWDFDSITCLASRNHEILKLRNKSGLRARDI 440

Query:   218 GKIPLHLAAVFGNGERNEQGSNTSIEDKNNNDRKEKSSSRYEELEQYVNKNK-EAHLVVA 276
              +  +    +F   ER            +  +  +  + +   L+   N++   A LVVA
Sbjct:   441 AESEVKPNYIFH--ERWTLALLLYAIHSSGFESVKSLTIQSVPLDPKKNRHYVNALLVVA 498

Query:   277 ALIATVTFTVGITVPGGYINEIRSDQ-GAAVLTKSSDFQAFVIFDSLAMILSTSAVFIHI 335
             AL+ATVTF  G T+PGGYI++ +    G A L  +     F++FD LAM  S + +   I
Sbjct:   499 ALVATVTFAAGFTIPGGYISDSKKPNLGRATLATNPTLFIFLLFDILAMQSSVATICTLI 558

Query:   336 YLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTYSVLHSAKVLAVIISIITDGFFL 395
             +  L  D         ++  ++  +L+ M  AFL G  + +   K L V ISII+ GFFL
Sbjct:   559 WAQL-GDLALILKSLHVALPLLLFSLLCMPVAFLFGVITAIAHVKWLLVTISIISGGFFL 617

Query:   396 Y-IYDYAAHFLL 406
             + I+    H +L
Sbjct:   618 FAIFILGPHVML 629
GO:0008219 "cell death" evidence=IMP
GO:0009751 "response to salicylic acid stimulus" evidence=IMP
GO:0009816 "defense response to bacterium, incompatible interaction" evidence=IMP
GO:0016020 "membrane" evidence=ISS;IDA
GO:0009615 "response to virus" evidence=IEP
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092522 ITN1 "INCREASED TOLERANCE TO NACL" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
pfam13962114 pfam13962, PGG, Domain of unknown function 1e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-18
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-18
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-09
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-04
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score = 92.2 bits (230), Expect = 1e-22
 Identities = 36/114 (31%), Positives = 61/114 (53%), Gaps = 4/114 (3%)

Query: 262 EQYVNKNKEAHLVVAALIATVTFTVGITVPGGYI-NEIRSDQGAAVL-TKSSDFQAFVIF 319
            +++ K + + LVVA LIATVTF  G T PGGY  ++     G  +L  K   F+AF + 
Sbjct: 1   SEWLEKTRNSLLVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVS 60

Query: 320 DSLAMILSTSAVFIHIYLSLIPDKIEEYILWQISRGMIQLALVVMVFAFLTGTY 373
           +++A + S  AV + +Y+     +     L      ++ L+L+ ++ AF  G+Y
Sbjct: 61  NTIAFVASLVAVILLLYIVPSFSR-RLPRLL-ALLTLLWLSLLSLMVAFAAGSY 112

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 434
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 99.98
PHA02876682 ankyrin repeat protein; Provisional 99.98
PHA02946446 ankyin-like protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02878477 ankyrin repeat protein; Provisional 99.97
PHA02876682 ankyrin repeat protein; Provisional 99.97
PHA02875413 ankyrin repeat protein; Provisional 99.97
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02989494 ankyrin repeat protein; Provisional 99.97
KOG0510 929 consensus Ankyrin repeat protein [General function 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02798489 ankyrin-like protein; Provisional 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02795437 ankyrin-like protein; Provisional 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
PF13962113 PGG: Domain of unknown function 99.94
PHA02792631 ankyrin-like protein; Provisional 99.94
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
PHA02730672 ankyrin-like protein; Provisional 99.93
PHA02730 672 ankyrin-like protein; Provisional 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.93
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
PHA02792631 ankyrin-like protein; Provisional 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
KOG0514452 consensus Ankyrin repeat protein [General function 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.87
PHA02741169 hypothetical protein; Provisional 99.87
PHA02884300 ankyrin repeat protein; Provisional 99.86
PHA02741169 hypothetical protein; Provisional 99.86
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.85
PHA02736154 Viral ankyrin protein; Provisional 99.85
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
PHA02736154 Viral ankyrin protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.82
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.82
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.81
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.78
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.77
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.77
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.76
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.74
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.71
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.68
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.53
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.51
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.47
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.38
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.34
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.33
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.33
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.32
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.3
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.28
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.92
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.72
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.71
PF1360630 Ank_3: Ankyrin repeat 98.71
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.66
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.6
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.57
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.52
PF1360630 Ank_3: Ankyrin repeat 98.51
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.5
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.42
KOG0522 560 consensus Ankyrin repeat protein [General function 98.39
KOG0522 560 consensus Ankyrin repeat protein [General function 98.31
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.3
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.21
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.19
KOG0520975 consensus Uncharacterized conserved protein, conta 98.14
KOG0520975 consensus Uncharacterized conserved protein, conta 98.1
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.94
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.9
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.9
KOG0511 516 consensus Ankyrin repeat protein [General function 97.75
KOG2384223 consensus Major histocompatibility complex protein 97.73
KOG2384223 consensus Major histocompatibility complex protein 97.62
KOG0511 516 consensus Ankyrin repeat protein [General function 97.5
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.83
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.38
KOG2505591 consensus Ankyrin repeat protein [General function 95.47
KOG2505591 consensus Ankyrin repeat protein [General function 95.41
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 93.82
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.04
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.97
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 88.98
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.48
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 85.39
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=9.9e-38  Score=255.70  Aligned_cols=198  Identities=27%  Similarity=0.331  Sum_probs=176.1

Q ss_pred             cHHHHHHHHHhcCCccccC-cCCCCChHHHHHHHcCCHHHHHHHHHhcCCCCCCChhhHHHHHHHhhccccCCCChHHHH
Q 040611           10 SLEHFVTDILEMSPGLLLK-ANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHE   88 (434)
Q Consensus        10 ~~~~~v~~ll~~~~~~l~~-~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~l~~~~~~g~t~Lh~   88 (434)
                      ....-++++++..|..++. .|.+|+||||+||..||.++|++|++. .++.              ++..|..|+||||.
T Consensus        14 ~~~~kveel~~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq-~nv~--------------~ddkDdaGWtPlhi   78 (226)
T KOG4412|consen   14 CEEFKVEELIQSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQ-PNVK--------------PDDKDDAGWTPLHI   78 (226)
T ss_pred             chHHHHHHHHhcChhhhhccccccCCceeeeeeecCchhHHHHHHhc-CCCC--------------CCCccccCCchhhh
Confidence            3456688888888844544 455999999999999999999999962 2222              23468999999999


Q ss_pred             HHHcCCHHHHHHHHhc-CCCCCccCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCchHHHHHHhcCCHHHHHH
Q 040611           89 AVRYNRVEVVKMVTKE-DPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKV  167 (434)
Q Consensus        89 Aa~~g~~~~v~~Ll~~-~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~  167 (434)
                      |+..|+.|+|+.|+.+ +++++ ..++.|.||||+|+.+|+.+++++|+++|+.++.+|..|+||||-|+.-|..+++++
T Consensus        79 a~s~g~~evVk~Ll~r~~advn-a~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~  157 (226)
T KOG4412|consen   79 AASNGNDEVVKELLNRSGADVN-ATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEY  157 (226)
T ss_pred             hhhcCcHHHHHHHhcCCCCCcc-eecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHH
Confidence            9999999999999999 88866 789999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCcCcccccccCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccccCCCcHHHHHHH
Q 040611          168 LLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAV  227 (434)
Q Consensus       168 Ll~~~~g~~~~~~d~~G~TpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~  227 (434)
                      |+..  |+.+|.+|+.|+||||.|...|+.++..+|+++|++. ...|++| ||+..|+.
T Consensus       158 Li~~--~a~~n~qDk~G~TpL~~al~e~~~d~a~lLV~~gAd~-~~edke~-t~~~~a~~  213 (226)
T KOG4412|consen  158 LISQ--GAPLNTQDKYGFTPLHHALAEGHPDVAVLLVRAGADT-DREDKEG-TALRIACN  213 (226)
T ss_pred             HHhc--CCCCCcccccCccHHHHHHhccCchHHHHHHHhccce-eeccccC-chHHHHHH
Confidence            9999  7999999999999999999999999999999999887 5668988 99887753

>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-14
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-07
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-09
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-09
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-09
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-07
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-08
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 9e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-06
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-07
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-06
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-06
1uoh_A226 Human Gankyrin Length = 226 1e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 3e-04
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-06
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 6e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 1e-04
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-04
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-04
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-04
1ycs_B239 P53-53bp2 Complex Length = 239 5e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 7e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 76.6 bits (187), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 96/204 (47%), Gaps = 24/204 (11%)
Query: 29  ANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHE 88
           A T G T LHIA R GHV+ V  L+ +          +  +A     G T       LH 
Sbjct: 109 ATTAGHTPLHIAAREGHVETVLALLEK----------EASQACMTKKGFT------PLHV 152
Query: 89  AVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPM 148
           A +Y +V V +++ + D + P  A   G TPL++A      D+++ +     SP  H P 
Sbjct: 153 AAKYGKVRVAELLLERD-AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP--HSPA 209
Query: 149 --GRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKA 206
             G T LH  A +N  E+ + LL+   G   +    QG  PLHLAA  G+ ++V  LL +
Sbjct: 210 WNGYTPLHIAAKQNQVEVARSLLQ--YGGSANAESVQGVTPLHLAAQEGHAEMVA-LLLS 266
Query: 207 DKSAAYKADNEGKIPLHLAAVFGN 230
            ++     +  G  PLHL A  G+
Sbjct: 267 KQANGNLGNKSGLTPLHLVAQEGH 290
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query434
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-28
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-30
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-29
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-29
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-05
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-04
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-30
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-30
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-27
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-25
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-21
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-27
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-23
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-29
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-29
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-29
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-23
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-29
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-27
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 7e-21
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-28
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-28
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-27
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-28
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-26
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-21
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
2rfa_A232 Transient receptor potential cation channel subfa 5e-28
2rfa_A232 Transient receptor potential cation channel subfa 1e-20
2rfa_A232 Transient receptor potential cation channel subfa 5e-12
2rfa_A232 Transient receptor potential cation channel subfa 3e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-28
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-26
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-27
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-27
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-25
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-27
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-27
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-27
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 9e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-21
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
2pnn_A273 Transient receptor potential cation channel subfa 1e-25
2pnn_A273 Transient receptor potential cation channel subfa 1e-19
2pnn_A273 Transient receptor potential cation channel subfa 6e-17
2pnn_A273 Transient receptor potential cation channel subfa 5e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-23
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-12
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-24
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-24
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-21
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-18
2etb_A256 Transient receptor potential cation channel subfam 5e-24
2etb_A256 Transient receptor potential cation channel subfam 4e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-11
2etb_A256 Transient receptor potential cation channel subfam 1e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-22
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-15
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-21
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-20
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-21
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-18
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-20
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-20
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-09
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-07
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-06
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
 Score =  121 bits (305), Expect = 2e-31
 Identities = 53/253 (20%), Positives = 92/253 (36%), Gaps = 64/253 (25%)

Query: 29  ANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHE 88
           A  +   LL  A ++  VD+V+ L+         +    +       G T       LH 
Sbjct: 1   AAVEDNHLLIKAVQNEDVDLVQQLLE-----GGAN----VNFQEEEGGWT------PLHN 45

Query: 89  AVRYNRVEVVKMVTKEDPSLPYDAN-----NAGETPLYLAAERGYKDVMQDIFLTCKSPA 143
           AV+ +R ++V+++      L + A+       G TP  LAA  G   +++ +FL+     
Sbjct: 46  AVQMSREDIVELL------LRHGADPVLRKKNGATPFLLAAIAGSVKLLK-LFLS----- 93

Query: 144 GHGP-------MGRTALHAVAFRNDTEMTKVLLE--------SSIGTQTSKVDQQGWRPL 188
             G         G TA    A     +  K L +                ++ + G   L
Sbjct: 94  -KGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATAL 152

Query: 189 HLAAHLGYYDVVKELLK---ADKSAAYKADNEGKIPLHLAAVFGNGERNE--------QG 237
             AA  G+ +V+K LL    AD +A    DN G+  L  A +  +    E         G
Sbjct: 153 MDAAEKGHVEVLKILLDEMGADVNA---CDNMGRNALIHALLSSDDSDVEAITHLLLDHG 209

Query: 238 SNTSIEDKNNNDR 250
           ++  +  +    +
Sbjct: 210 AD--VNVRGERGK 220
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.89
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.89
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.87
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
Probab=100.00  E-value=5.1e-38  Score=290.13  Aligned_cols=209  Identities=23%  Similarity=0.319  Sum_probs=180.4

Q ss_pred             CcHHHHHHHHHhcCCccccCcCCCCChHHHHHHHcCCHHHHHHHHHhcCCCCCCChhhHHHHHHHhhccccCCCChHHHH
Q 040611            9 SSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKDKALHE   88 (434)
Q Consensus         9 ~~~~~~v~~ll~~~~~~l~~~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~l~~~~~~g~t~Lh~   88 (434)
                      .+..++++.|++.++++....|..|+||||+|+..|+.+++++|+++|++++                ..|..|.||||+
T Consensus        33 ~~~~~~v~~Ll~~g~~~~~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~----------------~~~~~g~t~L~~   96 (253)
T 1yyh_A           33 EDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADAN----------------IQDNMGRTPLHA   96 (253)
T ss_dssp             -------------------CCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT----------------CCCTTSCCHHHH
T ss_pred             CCChHHHHHHHHccCCcccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCC----------------CCCCCCCCHHHH
Confidence            4489999999999999888889999999999999999999999999998865                478899999999


Q ss_pred             HHHcCCHHHHHHHHhcCCCCCccCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCchHHHHHHhcCCHHHHHHH
Q 040611           89 AVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVL  168 (434)
Q Consensus        89 Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~Lh~A~~~g~~~~v~~L  168 (434)
                      |+..|+.+++++|++.++......|..|.||||+|+..|+.+++++|++.|++++..|..|+||||+|+..|+.+++++|
T Consensus        97 A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~d~~g~t~L~~A~~~~~~~~v~~L  176 (253)
T 1yyh_A           97 AVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVL  176 (253)
T ss_dssp             HHHHTCHHHHHHHHHSTTSCTTCCCTTCCCHHHHHHHHTCSSHHHHHHHTTCCTTCBCTTSCBHHHHHHHHTCHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHcCCCCccccCCCCCcHHHHHHHcChHHHHHHHHHcCCCCCCcCCCCCCHHHHHHHcCCHHHHHHH
Confidence            99999999999999999855557899999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCcCcccccccCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccccCCCcHHHHHHHhCCcccccc
Q 040611          169 LESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNEQ  236 (434)
Q Consensus       169 l~~~~g~~~~~~d~~G~TpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~~  236 (434)
                      +++  |++++.+|..|+||||+|+..|+.+++++|+++|++. +.+|..|+||+|+|+++|+.+++++
T Consensus       177 l~~--ga~~~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~ga~~-~~~d~~g~tpl~~A~~~g~~~i~~~  241 (253)
T 1yyh_A          177 LKN--GANKDMQNNREETPLFLAAREGSYETAKVLLDHFANR-DITDHMDRLPRDIAQERMHHDIVRL  241 (253)
T ss_dssp             HHT--TCCTTCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCT-TCCCTTCCCHHHHHHHTTCHHHHHH
T ss_pred             HHc--CCCCCCcCCCCCCHHHHHHHCCCHHHHHHHHHcCCCc-cccccCCCCHHHHHHHcCCHHHHHH
Confidence            999  8999999999999999999999999999999999987 5679999999999999999999876
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 434
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-21
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-20
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-13
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 4e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.004
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 6e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 93.1 bits (230), Expect = 3e-21
 Identities = 56/251 (22%), Positives = 90/251 (35%), Gaps = 32/251 (12%)

Query: 28  KANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEK-----------------VIEA 70
            A   G T LH+A  H ++DIVK L+     PH                        +  
Sbjct: 160 AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQ 219

Query: 71  ATLMLGMTNEAKDKALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKD 130
                   +      LH A +    E+V ++  +  +     N +G TPL+L A+ G+  
Sbjct: 220 YGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN-GNLGNKSGLTPLHLVAQEGHVP 278

Query: 131 VMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTEMTKVLLESSIGTQTSKVDQQGWRPLHL 190
           V   +            MG T LH  +   + ++  V          +   + G+ PLH 
Sbjct: 279 VADVLIKHGVMVDATTRMGYTPLHVASHYGNIKL--VKFLLQHQADVNAKTKLGYSPLHQ 336

Query: 191 AAHLGYYDVVKELLK--ADKSAAYKADNEGKIPLHLAAVFGNGE-------RNEQGSNTS 241
           AA  G+ D+V  LLK  A  +      ++G  PL +A   G            ++ S   
Sbjct: 337 AAQQGHTDIVTLLLKNGASPNEV---SSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVL 393

Query: 242 IEDKNNNDRKE 252
           + DK+     E
Sbjct: 394 VSDKHRMSFPE 404
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query434
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 26S proteasome non-ATPase regulatory subunit 10, gankyrin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.8e-36  Score=272.30  Aligned_cols=211  Identities=25%  Similarity=0.286  Sum_probs=195.6

Q ss_pred             ccccCCcHHHHHHHHHhcCCccccCcCCCCChHHHHHHHcCCHHHHHHHHHhcCCCCCCChhhHHHHHHHhhccccCCCC
Q 040611            4 FKKQSSSLEHFVTDILEMSPGLLLKANTKGETLLHIAGRHGHVDIVKDLIAECKKPHQNDPEKVIEAATLMLGMTNEAKD   83 (434)
Q Consensus         4 ~~a~~~~~~~~v~~ll~~~~~~l~~~~~~g~TpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~l~~~~~~g~   83 (434)
                      .+.+.+|+.+.++.+++..+..++.+|.+|+||||+||..|+.++++++++.+.....                .+..+.
T Consensus         8 ~~~a~~G~~~~v~~~l~~~~~~~~~~D~~G~TpLh~Aa~~g~~e~~~~l~~~~~~~~~----------------~~~~~~   71 (223)
T d1uoha_           8 CNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVND----------------KDDAGW   71 (223)
T ss_dssp             HHHHHTTCHHHHHHHHHHCGGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCSCC----------------CCTTCC
T ss_pred             HHHHHhCCHHHHHHHHHhCCCcCcCcCCCCCCHHHHHHHhhhhccccccccccccccc----------------cccccc
Confidence            4568899999999999999999999999999999999999999999999999876543                567789


Q ss_pred             hHHHHHHHcCCHHHHHHHHhcCCCCCccCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCchHHHHHHhcCCHH
Q 040611           84 KALHEAVRYNRVEVVKMVTKEDPSLPYDANNAGETPLYLAAERGYKDVMQDIFLTCKSPAGHGPMGRTALHAVAFRNDTE  163 (434)
Q Consensus        84 t~Lh~Aa~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~Lh~A~~~g~~~  163 (434)
                      ++++.|+..|+.+++++|++++++++ ..|..|.||||+|+.+|+.+++++|+++|.+++..+..|.||||.|+..++.+
T Consensus        72 ~~~~~~~~~~~~~i~~~Ll~~~~d~~-~~d~~g~tpL~~A~~~~~~e~~~~Ll~~g~d~~~~~~~~~t~L~~a~~~~~~~  150 (223)
T d1uoha_          72 SPLHIAASAGRDEIVKALLGKGAQVN-AVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLK  150 (223)
T ss_dssp             CHHHHHHHHTCHHHHHHHHHTTCCTT-CCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHH
T ss_pred             ccccccccccccchhHHHhccCceeE-eeCCCCCchhhHHHHcCCHHHHHHHHHCCCCCCCcCCCCCccchhhhhcCCcc
Confidence            99999999999999999999999865 78999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCcCcccccccCCCCcHHHHHHHcCCHHHHHHHHhcCcccccccccCCCcHHHHHHHhCCccccc
Q 040611          164 MTKVLLESSIGTQTSKVDQQGWRPLHLAAHLGYYDVVKELLKADKSAAYKADNEGKIPLHLAAVFGNGERNE  235 (434)
Q Consensus       164 ~v~~Ll~~~~g~~~~~~d~~G~TpLh~A~~~g~~~iv~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~~~~  235 (434)
                      ++++|++.  +.+++.+|.+|+||||+|++.|+.+++++|+++|+++ +.+|++|+||||+|. .|+.++++
T Consensus       151 ~~~~L~~~--~~~i~~~d~~g~TpL~~Aa~~g~~~~v~~LL~~Gad~-~~~d~~g~tpl~~A~-~~~~~i~~  218 (223)
T d1uoha_         151 MIHILLYY--KASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASI-YIENKEEKTPLQVAK-GGLGLILK  218 (223)
T ss_dssp             HHHHHHHT--TCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCS-CCCCTTSCCHHHHCC-TTHHHHHH
T ss_pred             hhhhhccc--cceeeeccCCCCceeccccccCcHHHHHHHHHCCCCC-CCCCCCCCCHHHHHH-CCCHHHHh
Confidence            99999998  7899999999999999999999999999999999987 677999999999984 57776654
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure