Citrus Sinensis ID: 040616
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 208 | ||||||
| 224131488 | 343 | predicted protein [Populus trichocarpa] | 0.980 | 0.594 | 0.745 | 4e-88 | |
| 118487572 | 345 | unknown [Populus trichocarpa] | 0.980 | 0.591 | 0.740 | 1e-87 | |
| 449468806 | 342 | PREDICTED: probable aldo-keto reductase | 0.956 | 0.581 | 0.759 | 1e-86 | |
| 62526573 | 344 | aldo/keto reductase AKR [Manihot esculen | 0.951 | 0.575 | 0.763 | 2e-86 | |
| 449484655 | 342 | PREDICTED: probable aldo-keto reductase | 0.956 | 0.581 | 0.759 | 3e-86 | |
| 224069573 | 343 | predicted protein [Populus trichocarpa] | 0.951 | 0.577 | 0.740 | 1e-85 | |
| 357502825 | 339 | Aldo/keto reductase [Medicago truncatula | 0.956 | 0.587 | 0.730 | 2e-85 | |
| 225433674 | 341 | PREDICTED: auxin-induced protein PCNT115 | 0.956 | 0.583 | 0.764 | 2e-85 | |
| 217073738 | 339 | unknown [Medicago truncatula] gi|3885195 | 0.956 | 0.587 | 0.730 | 2e-85 | |
| 147767361 | 341 | hypothetical protein VITISV_040294 [Viti | 0.956 | 0.583 | 0.759 | 2e-85 |
| >gi|224131488|ref|XP_002321097.1| predicted protein [Populus trichocarpa] gi|222861870|gb|EEE99412.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 329 bits (843), Expect = 4e-88, Method: Compositional matrix adjust.
Identities = 161/216 (74%), Positives = 184/216 (85%), Gaps = 12/216 (5%)
Query: 1 LEVSGQGLRCMGMFAFYGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR-- 58
LEVS QGL CMGM AFYGPPKPES M++LIHHAI+SG+T+LDTS++YGPHTNEILL +
Sbjct: 14 LEVSAQGLGCMGMSAFYGPPKPESDMVSLIHHAINSGVTLLDTSDMYGPHTNEILLGKAL 73
Query: 59 ---------VKLTTKFGIRYEDGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDT 109
V+L TKFGI ++DGK GDPAY+RAACEASLK L +DC+DLYYQHRIDT
Sbjct: 74 KAGSGLREKVELATKFGINFQDGKREIRGDPAYVRAACEASLKRLQLDCVDLYYQHRIDT 133
Query: 110 KIPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIHPITVVRLEWSLRSRDVEEEI 169
K+PIEVT+GELK+LVEEGKIK+I LSEASASTIRRAH +HP+T V+LEWSL SRDVEEEI
Sbjct: 134 KVPIEVTMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPVTAVQLEWSLWSRDVEEEI 193
Query: 170 VPTCRELGIGIVAYSLLGRGFLSSGPKLIHLSATKG 205
VPTCRELGIGIVAYS LGRGFLSSGPKL+ S T+G
Sbjct: 194 VPTCRELGIGIVAYSPLGRGFLSSGPKLVE-SFTEG 228
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118487572|gb|ABK95612.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449468806|ref|XP_004152112.1| PREDICTED: probable aldo-keto reductase 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|62526573|gb|AAX84672.1| aldo/keto reductase AKR [Manihot esculenta] | Back alignment and taxonomy information |
|---|
| >gi|449484655|ref|XP_004156942.1| PREDICTED: probable aldo-keto reductase 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224069573|ref|XP_002303002.1| predicted protein [Populus trichocarpa] gi|222844728|gb|EEE82275.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357502825|ref|XP_003621701.1| Aldo/keto reductase [Medicago truncatula] gi|124360844|gb|ABN08816.1| Aldo/keto reductase [Medicago truncatula] gi|355496716|gb|AES77919.1| Aldo/keto reductase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225433674|ref|XP_002266027.1| PREDICTED: auxin-induced protein PCNT115 isoform 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|217073738|gb|ACJ85229.1| unknown [Medicago truncatula] gi|388519533|gb|AFK47828.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|147767361|emb|CAN68994.1| hypothetical protein VITISV_040294 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 208 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.951 | 0.573 | 0.710 | 3.9e-76 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.951 | 0.573 | 0.714 | 1.5e-74 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.951 | 0.575 | 0.690 | 4.8e-71 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.918 | 0.578 | 0.691 | 1.1e-69 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.947 | 0.569 | 0.671 | 2.4e-69 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.918 | 0.584 | 0.519 | 6.9e-47 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.923 | 0.574 | 0.478 | 6.6e-42 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.908 | 0.555 | 0.429 | 5.1e-35 | |
| ASPGD|ASPL0000072041 | 351 | AN8733 [Emericella nidulans (t | 0.908 | 0.538 | 0.396 | 9.5e-34 | |
| ASPGD|ASPL0000051701 | 339 | AN10217 [Emericella nidulans ( | 0.899 | 0.551 | 0.400 | 8.8e-31 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 767 (275.1 bits), Expect = 3.9e-76, P = 3.9e-76
Identities = 147/207 (71%), Positives = 173/207 (83%)
Query: 1 LEVSGQGLRCMGMFAFYGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR-- 58
LEVS QGL CMG+ AFYG PKPE+ IALIHHAI SG+T+LDTS++YGP TNE+LL +
Sbjct: 17 LEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPETNEVLLGKAL 76
Query: 59 -------VKLTTKFGIRYEDGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDTKI 111
V+L TKFGI Y +GK GDP Y+RAACEASLK LD+ CIDLYYQHR+DT++
Sbjct: 77 KDGVREKVELATKFGISYAEGKREVRGDPEYVRAACEASLKRLDIACIDLYYQHRVDTRV 136
Query: 112 PIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIHPITVVRLEWSLRSRDVEEEIVP 171
PIE+T+GELK+LVEEGKIK+I LSEASASTIRRAH +HPIT V++EWSL +RDVEEEI+P
Sbjct: 137 PIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWSLWTRDVEEEIIP 196
Query: 172 TCRELGIGIVAYSLLGRGFLSSGPKLI 198
TCRELGIGIVAYS LGRGF +SGPKL+
Sbjct: 197 TCRELGIGIVAYSPLGRGFFASGPKLV 223
|
|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000051701 AN10217 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 208 | |||
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 4e-58 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 6e-58 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 5e-54 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 7e-21 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 3e-18 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 8e-18 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 4e-10 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 6e-08 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 2e-06 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 2e-06 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 2e-05 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 185 bits (471), Expect = 4e-58
Identities = 79/209 (37%), Positives = 112/209 (53%), Gaps = 14/209 (6%)
Query: 1 LEVSGQGLRCMGMFAFYGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR-- 58
L+VS GL M + + E+ I ++ A+D+GI DT++VYG +E +L
Sbjct: 11 LKVSPLGLGTMTLGGDTDDEE-EAEAIEILDAALDAGINFFDTADVYGDGRSEEILGEAL 69
Query: 59 --------VKLTTKFGIRYEDGKYS--YCGDPAYLRAACEASLKCLDVDCIDLYYQHRID 108
V + TK G R D + + ++R A EASLK L D IDLY HR D
Sbjct: 70 KERGRRDKVVIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPD 129
Query: 109 TKIPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTI-HPITVVRLEWSLRSRDVEE 167
+ PIE T+ L LV EGKI++I +S SA I A + PI ++ E++L RD E+
Sbjct: 130 PETPIEETLEALDELVREGKIRYIGVSNYSAEQIAEALAVAAPIDSLQPEYNLLERDAEK 189
Query: 168 EIVPTCRELGIGIVAYSLLGRGFLSSGPK 196
E++P CRE GIG++AYS L G L+
Sbjct: 190 ELLPLCREEGIGLLAYSPLASGLLTGKYL 218
|
Length = 316 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 100.0 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.46 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 92.09 | |
| PRK14461 | 371 | ribosomal RNA large subunit methyltransferase N; P | 90.78 | |
| cd03319 | 316 | L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat | 90.77 | |
| cd03174 | 265 | DRE_TIM_metallolyase DRE-TIM metallolyase superfam | 89.66 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 89.37 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 89.37 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 88.81 | |
| COG2089 | 347 | SpsE Sialic acid synthase [Cell envelope biogenesi | 88.65 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 88.0 | |
| COG1140 | 513 | NarY Nitrate reductase beta subunit [Energy produc | 87.4 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 87.37 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 85.44 | |
| cd00308 | 229 | enolase_like Enolase-superfamily, characterized by | 83.76 | |
| PRK08392 | 215 | hypothetical protein; Provisional | 83.16 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 82.85 | |
| PRK00730 | 138 | rnpA ribonuclease P; Reviewed | 82.48 | |
| COG2069 | 403 | CdhD CO dehydrogenase/acetyl-CoA synthase delta su | 82.1 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 82.1 | |
| TIGR01502 | 408 | B_methylAsp_ase methylaspartate ammonia-lyase. Thi | 81.57 | |
| PRK13803 | 610 | bifunctional phosphoribosylanthranilate isomerase/ | 81.52 | |
| PRK14457 | 345 | ribosomal RNA large subunit methyltransferase N; P | 80.76 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 80.16 | |
| cd00739 | 257 | DHPS DHPS subgroup of Pterin binding enzymes. DHPS | 80.15 |
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-53 Score=339.82 Aligned_cols=187 Identities=29% Similarity=0.392 Sum_probs=170.6
Q ss_pred CcCcccccccccccCCCCCCCHHHHHHHHHHHHHCCCCeEeCCCCCCCCchhhhcce-----------EEEEeecceecC
Q 040616 2 EVSGQGLRCMGMFAFYGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR-----------VKLTTKFGIRYE 70 (208)
Q Consensus 2 ~v~~lg~G~~~~~~~~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~~e~~~g~-----------~~i~tK~~~~~~ 70 (208)
+||.||||||++++ .+.+.+.+.+|++.|||+||||..|| ||+.+|+ +||+||++..
T Consensus 13 ~iP~iGlGt~~~~~-------~~~~~~av~~Al~~Gyr~IDTA~~Yg---nE~~VG~aI~~s~v~ReelFittKvw~~-- 80 (280)
T COG0656 13 EIPAIGLGTWQIGD-------DEWAVRAVRAALELGYRLIDTAEIYG---NEEEVGEAIKESGVPREELFITTKVWPS-- 80 (280)
T ss_pred cccCcceEeeecCC-------chhHHHHHHHHHHhCcceEecHhHhc---CHHHHHHHHHhcCCCHHHeEEEeecCCc--
Confidence 58999999999842 22388999999999999999999999 9999997 9999999975
Q ss_pred CCCccCCCChHHHHHHHHHHHHHcCCCcccEEEeecCCCC--CCHHHHHHHHHHHHHcCCcceEeeCcccHHHHHHHhhc
Q 040616 71 DGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDTK--IPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTI 148 (208)
Q Consensus 71 ~~~~~~~~~~~~i~~~~~~sL~~L~~d~iDl~~lh~~~~~--~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~~l~~~~~~ 148 (208)
+.+++.+.+++++||++||+||+|||++|||.+. ..+.++|++|++++++|+||+||||||+.++++++++.
T Consensus 81 ------~~~~~~~~~a~e~Sl~rLg~dyvDLyLiHwP~~~~~~~~~etw~alE~l~~~G~ir~IGVSNF~~~~L~~l~~~ 154 (280)
T COG0656 81 ------DLGYDETLKALEASLKRLGLDYVDLYLIHWPVPNKYVVIEETWKALEELVDEGLIRAIGVSNFGVEHLEELLSL 154 (280)
T ss_pred ------cCCcchHHHHHHHHHHHhCCCceeEEEECCCCCccCccHHHHHHHHHHHHhcCCccEEEeeCCCHHHHHHHHHh
Confidence 4678999999999999999999999999999763 23689999999999999999999999999999999987
Q ss_pred --CCccEEeeccCcCCCCccccHHHHHHHhCCcEEEcccCcccc-cCCCCCcccchhhcCCCC
Q 040616 149 --HPITVVRLEWSLRSRDVEEEIVPTCRELGIGIVAYSLLGRGF-LSSGPKLIHLSATKGCIS 208 (208)
Q Consensus 149 --~~~~~~q~~~~~~~~~~~~~~l~~~~~~gi~v~a~~pl~~G~-l~~~~~~~~~a~~~~~~~ 208 (208)
..|.++|++|||+.+ +.+++++|+++||.++|||||+.|. +.+++.+.+||++||+|+
T Consensus 155 ~~~~p~~NQIe~hp~~~--q~el~~~~~~~gI~v~AysPL~~g~~l~~~~~l~~Ia~k~g~t~ 215 (280)
T COG0656 155 AKVKPAVNQIEYHPYLR--QPELLPFCQRHGIAVEAYSPLAKGGKLLDNPVLAEIAKKYGKTP 215 (280)
T ss_pred cCCCCceEEEEeccCCC--cHHHHHHHHHcCCEEEEECCcccccccccChHHHHHHHHhCCCH
Confidence 559999999999999 5569999999999999999999765 888999999999999974
|
|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional | Back alignment and domain information |
|---|
| >cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides | Back alignment and domain information |
|---|
| >cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
| >COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion | Back alignment and domain information |
|---|
| >PRK08392 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK00730 rnpA ribonuclease P; Reviewed | Back alignment and domain information |
|---|
| >COG2069 CdhD CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein) [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01502 B_methylAsp_ase methylaspartate ammonia-lyase | Back alignment and domain information |
|---|
| >PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00739 DHPS DHPS subgroup of Pterin binding enzymes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 208 | ||||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-53 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-53 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-53 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 5e-52 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 1e-17 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 1e-17 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 2e-17 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 5e-17 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 1e-15 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 2e-14 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 2e-14 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 1e-10 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 7e-09 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 8e-09 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 2e-08 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 3e-07 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 4e-07 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 4e-07 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 5e-07 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 5e-07 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 5e-07 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 5e-07 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 8e-07 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 1e-06 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 3e-06 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 8e-06 | ||
| 1ihi_A | 323 | Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy | 4e-05 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 4e-05 | ||
| 1j96_A | 323 | Human 3alpha-Hsd Type 3 In Ternary Complex With Nad | 4e-05 | ||
| 1xjb_A | 325 | Crystal Structure Of Human Type 3 3alpha-Hydroxyste | 4e-05 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 2e-04 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 2e-04 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 2e-04 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 2e-04 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 2e-04 | ||
| 2ipj_A | 321 | Crystal Structure Of H3alpha-Hydroxysteroid Dehydro | 2e-04 | ||
| 3c3u_A | 323 | Crystal Structure Of Akr1c1 In Complex With Nadp An | 2e-04 | ||
| 3gug_A | 323 | Crystal Structure Of Akr1c1 L308v Mutant In Complex | 2e-04 | ||
| 1mrq_A | 323 | Crystal Structure Of Human 20alpha-hsd In Ternary C | 2e-04 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 3e-04 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 4e-04 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 9e-04 |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 | Back alignment and structure |
| >pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 | Back alignment and structure |
| >pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 | Back alignment and structure |
| >pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 208 | |||
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 1e-107 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 1e-107 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 4e-93 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 3e-86 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 8e-78 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 1e-68 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 1e-44 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 2e-44 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 1e-38 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 5e-36 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 1e-35 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 8e-35 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 7e-24 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 9e-10 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 5e-09 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 6e-09 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 7e-09 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 2e-08 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 3e-08 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 8e-08 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 1e-07 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 2e-07 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 3e-07 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 3e-07 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 3e-07 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 7e-07 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 9e-07 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 2e-06 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 3e-06 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 4e-06 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 5e-06 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 7e-06 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 8e-06 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 8e-06 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 1e-05 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 3e-05 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 2e-04 |
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
Score = 309 bits (795), Expect = e-107
Identities = 55/205 (26%), Positives = 98/205 (47%), Gaps = 13/205 (6%)
Query: 1 LEVSGQGLRCMGMFAFYGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR-- 58
+S L + + + + IH A+D GI ++DT+ VYG +E ++ R
Sbjct: 29 TPLSRVALGTWAIGGWMWGGPDDDNGVRTIHAALDEGINLIDTAPVYGFGHSEEIVGRAL 88
Query: 59 ------VKLTTKFGIRY-----EDGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRI 107
+ TK G+ + ++ K PA +R E SL+ L V+ IDL H
Sbjct: 89 AEKPNKAHVATKLGLHWVGEDEKNMKVFRDSRPARIRKEVEDSLRRLRVETIDLEQIHWP 148
Query: 108 DTKIPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIHPITVVRLEWSLRSRDVEE 167
D K PI+ + EL++L ++GKI+ + +S S + + P+ ++ +L R +E+
Sbjct: 149 DDKTPIDESARELQKLHQDGKIRALGVSNFSPEQMDIFREVAPLATIQPPLNLFERTIEK 208
Query: 168 EIVPTCRELGIGIVAYSLLGRGFLS 192
+I+P + ++AY L RG L+
Sbjct: 209 DILPYAEKHNAVVLAYGALCRGLLT 233
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 98.04 | |
| 2rdx_A | 379 | Mandelate racemase/muconate lactonizing enzyme, P; | 90.19 | |
| 2o56_A | 407 | Putative mandelate racemase; dehydratase, structur | 90.03 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 89.37 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 89.35 | |
| 3qtp_A | 441 | Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Ent | 89.27 | |
| 2poz_A | 392 | Putative dehydratase; octamer, structural genomics | 89.12 | |
| 3jva_A | 354 | Dipeptide epimerase; enolase superfamily, isomeras | 88.82 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 88.32 | |
| 3q45_A | 368 | Mandelate racemase/muconate lactonizing enzyme FA | 88.31 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 87.67 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 87.5 | |
| 3mwc_A | 400 | Mandelate racemase/muconate lactonizing protein; e | 86.76 | |
| 3r0u_A | 379 | Enzyme of enolase superfamily; structural genomics | 86.3 | |
| 2ox4_A | 403 | Putative mandelate racemase; enolase, dehydratase, | 86.29 | |
| 3dg3_A | 367 | Muconate cycloisomerase; muconate lactonizing enzy | 86.27 | |
| 3ozy_A | 389 | Putative mandelate racemase; beta-alpha barrel, en | 85.97 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 85.96 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 85.64 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 85.58 | |
| 3eez_A | 378 | Putative mandelate racemase/muconate lactonizing e | 85.14 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 84.54 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 84.31 | |
| 1sjd_A | 368 | N-acylamino acid racemase; lyase, isomerase; HET: | 83.95 | |
| 1kko_A | 413 | 3-methylaspartate ammonia-lyase; enolase superfami | 83.73 | |
| 2gl5_A | 410 | Putative dehydratase protein; structural genomics, | 83.3 | |
| 2pp0_A | 398 | L-talarate/galactarate dehydratase; enolase superf | 83.29 | |
| 3otr_A | 452 | Enolase; structural genomics, center for structura | 83.27 | |
| 3ro6_B | 356 | Putative chloromuconate cycloisomerase; TIM barrel | 83.12 | |
| 3gd6_A | 391 | Muconate cycloisomerase; structural genomics, NYSG | 82.86 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 82.23 | |
| 2qq6_A | 410 | Mandelate racemase/muconate lactonizing enzyme- li | 82.22 | |
| 4dwd_A | 393 | Mandelate racemase/muconate lactonizing enzyme, C | 81.02 | |
| 4h1z_A | 412 | Enolase Q92ZS5; dehydratase, magnesium binding sit | 80.8 | |
| 3ik4_A | 365 | Mandelate racemase/muconate lactonizing protein; s | 80.58 | |
| 1ydn_A | 295 | Hydroxymethylglutaryl-COA lyase; TIM-barrel protei | 80.16 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-53 Score=352.06 Aligned_cols=193 Identities=29% Similarity=0.461 Sum_probs=173.8
Q ss_pred CCcCcccccccccccC--CCCCCCHHHHHHHHHHHHHCCCCeEeCCCCCCCCchhhhcce---------EEEEeecceec
Q 040616 1 LEVSGQGLRCMGMFAF--YGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR---------VKLTTKFGIRY 69 (208)
Q Consensus 1 ~~v~~lg~G~~~~~~~--~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~~e~~~g~---------~~i~tK~~~~~ 69 (208)
++||.||||||++|+. |+ ..+++++.++|+.|+++|||+||||+.||+|.||+.+|+ +||+||++.+.
T Consensus 11 ~~vs~lglGt~~~g~~~~~~-~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~G~sE~~lG~al~~~~R~~~~i~TK~g~~~ 89 (312)
T 1pyf_A 11 LQVFPIGLGTNAVGGHNLYP-NLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAHRK 89 (312)
T ss_dssp CEECSBCEECTTSSCTTTCS-SCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEEEEEECEEE
T ss_pred CcccCEeEeccccCCCCCCC-CCCHHHHHHHHHHHHHcCCCEEECccccCCCchHHHHHHHhhhcCCCeEEEEEEeCCCC
Confidence 4689999999999864 43 247788999999999999999999999999999999998 99999986332
Q ss_pred CCCCccCCCChHHHHHHHHHHHHHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCcceEeeCcccHHHHHHHhhcC
Q 040616 70 EDGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDTKIPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIH 149 (208)
Q Consensus 70 ~~~~~~~~~~~~~i~~~~~~sL~~L~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~~l~~~~~~~ 149 (208)
.++.+..+.+++.+++++++||++|||||||+|++|||++..+.+++|++|++|+++||||+||||||++++++++++..
T Consensus 90 ~~~~~~~~~~~~~i~~~~~~SL~rL~~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~~~l~~~~~~~ 169 (312)
T 1pyf_A 90 QGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDG 169 (312)
T ss_dssp ETTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHHHHHHTTTS
T ss_pred CCCCCCCCCCHHHHHHHHHHHHHHhCCCcEEEEEeCCCCCCCCHHHHHHHHHHHHHCCCcCEEEecCCCHHHHHHHHhhC
Confidence 12222236789999999999999999999999999999988899999999999999999999999999999999999998
Q ss_pred CccEEeeccCcCCCCccccHHHHHHHhCCcEEEcccCcccccCCC
Q 040616 150 PITVVRLEWSLRSRDVEEEIVPTCRELGIGIVAYSLLGRGFLSSG 194 (208)
Q Consensus 150 ~~~~~q~~~~~~~~~~~~~~l~~~~~~gi~v~a~~pl~~G~l~~~ 194 (208)
+|+++|++||++++..+.+++++|+++||++++|+||++|+|+++
T Consensus 170 ~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~~~ 214 (312)
T 1pyf_A 170 LVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGK 214 (312)
T ss_dssp CCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTC
T ss_pred CceEEeccCCccccchHHHHHHHHHHcCCeEEEecccccccccCC
Confidence 999999999999997766899999999999999999999998764
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} | Back alignment and structure |
|---|
| >2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >3qtp_A Enolase 1; glycolysis, lyase; HET: 2PG; 1.90A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} | Back alignment and structure |
|---|
| >3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* | Back alignment and structure |
|---|
| >2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* | Back alignment and structure |
|---|
| >3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* | Back alignment and structure |
|---|
| >1kko_A 3-methylaspartate ammonia-lyase; enolase superfamily, TIM barrel; 1.33A {Citrobacter amalonaticus} SCOP: c.1.11.2 d.54.1.1 PDB: 1kkr_A* | Back alignment and structure |
|---|
| >2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* | Back alignment and structure |
|---|
| >2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* | Back alignment and structure |
|---|
| >3otr_A Enolase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel, TIM barrel; 2.75A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A | Back alignment and structure |
|---|
| >3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} | Back alignment and structure |
|---|
| >4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* | Back alignment and structure |
|---|
| >4h1z_A Enolase Q92ZS5; dehydratase, magnesium binding site, enzyme function initiat isomerase; 2.01A {Sinorhizobium meliloti} PDB: 2ppg_A | Back alignment and structure |
|---|
| >3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} | Back alignment and structure |
|---|
| >1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 208 | ||||
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 9e-31 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 8e-30 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 6e-23 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 2e-21 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 3e-20 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 1e-18 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-18 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 7e-18 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 9e-18 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-17 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 1e-15 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 1e-15 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 4e-15 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 1e-14 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 4e-14 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 1e-13 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Score = 112 bits (281), Expect = 9e-31
Identities = 55/200 (27%), Positives = 94/200 (47%), Gaps = 10/200 (5%)
Query: 1 LEVSGQGLRCMGMFAF-YGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLARV 59
L+V GL + P E L+ AI +G+T+LDT+ +YG +E L+ V
Sbjct: 10 LQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEV 69
Query: 60 ---------KLTTKFGIRYEDGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDTK 110
+ TK R + + + P +L+ + + SLK L+ D IDL+Y H D
Sbjct: 70 LREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEH 129
Query: 111 IPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIHPITVVRLEWSLRSRDVEEEIV 170
P + + L + + GKI+ I +S S ++ A+ + V++ E++L +R+ E+
Sbjct: 130 TPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFF 189
Query: 171 PTCRELGIGIVAYSLLGRGF 190
P +E I + Y L G
Sbjct: 190 PYTKEHNISFIPYFPLVSGL 209
|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 208 | |||
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1kcza1 | 253 | beta-Methylaspartase {Clostridium tetanomorphum [T | 91.06 | |
| d1kkoa1 | 251 | beta-Methylaspartase {Citrobacter amalonaticus [Ta | 89.15 | |
| d1jpma1 | 234 | L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: | 85.49 | |
| d1nu5a1 | 243 | Chlormuconate cycloisomerase {Pseudomonas sp. p51 | 80.16 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=2.8e-48 Score=318.03 Aligned_cols=195 Identities=29% Similarity=0.447 Sum_probs=181.0
Q ss_pred CCcCcccccccccccC-CCCCCCHHHHHHHHHHHHHCCCCeEeCCCCCCCCchhhhcce---------EEEEeecceecC
Q 040616 1 LEVSGQGLRCMGMFAF-YGPPKPESCMIALIHHAIDSGITVLDTSNVYGPHTNEILLAR---------VKLTTKFGIRYE 70 (208)
Q Consensus 1 ~~v~~lg~G~~~~~~~-~~~~~~~~~~~~~l~~A~~~Gi~~~DtA~~Yg~g~~e~~~g~---------~~i~tK~~~~~~ 70 (208)
++||+||||||++|+. +....+++++.++|++|+++|||+||||+.||.|.+|+.+|+ ++|+||++....
T Consensus 10 l~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~g~sE~~lg~~l~~~~r~~~~i~tK~~~~~~ 89 (311)
T d1pyfa_ 10 LQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAHRKQ 89 (311)
T ss_dssp CEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTTTHHHHHHHHHHTTSCGGGCEEEEEECEEEE
T ss_pred CeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCCCccHHHHhhhhhcccccceecceeccCCCC
Confidence 5799999999999863 234557888999999999999999999999999999999998 999999988776
Q ss_pred CCCccCCCChHHHHHHHHHHHHHcCCCcccEEEeecCCCCCCHHHHHHHHHHHHHcCCcceEeeCcccHHHHHHHhhcCC
Q 040616 71 DGKYSYCGDPAYLRAACEASLKCLDVDCIDLYYQHRIDTKIPIEVTIGELKRLVEEGKIKHIDLSEASASTIRRAHTIHP 150 (208)
Q Consensus 71 ~~~~~~~~~~~~i~~~~~~sL~~L~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvs~~~~~~l~~~~~~~~ 150 (208)
.+....+.+++.+++++++||++|++||+|++++|+|++..+.+++|++|++|+++|+||+||+||++.+.+.++.+..+
T Consensus 90 ~~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~~~~~~~~~~~~ 169 (311)
T d1pyfa_ 90 GNDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGL 169 (311)
T ss_dssp TTEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCHHHHHHHTTTSC
T ss_pred CcccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcHHHHHHHhhcCC
Confidence 66666789999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccEEeeccCcCCCCccccHHHHHHHhCCcEEEcccCcccccCCCC
Q 040616 151 ITVVRLEWSLRSRDVEEEIVPTCRELGIGIVAYSLLGRGFLSSGP 195 (208)
Q Consensus 151 ~~~~q~~~~~~~~~~~~~~l~~~~~~gi~v~a~~pl~~G~l~~~~ 195 (208)
++++|++||++++..+.+++++|+++||++++|+||++|+|++++
T Consensus 170 ~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~l~~~~ 214 (311)
T d1pyfa_ 170 VDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKY 214 (311)
T ss_dssp CCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTGGGTCC
T ss_pred cceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCccCCCc
Confidence 999999999999987789999999999999999999999998653
|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} | Back information, alignment and structure |
|---|
| >d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} | Back information, alignment and structure |
|---|
| >d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} | Back information, alignment and structure |
|---|