Citrus Sinensis ID: 040736

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MLINFSISPPSSYSLIKISNSKLPISEFPLKPKTHLSKSHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
cccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccEEEEEEcccccEEEEEEcccEEEEEEEEEccccEEcccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcccccccEEEEEccEEccccccccHHHHHHHHHcccccEEEEEEEEccEEEEEEEEcEEccccccEEEEEEcccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcc
ccEEEccccccccccEEEcccccccccccccccccccccccccccccccccEcccccEEEccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHcccccccEEEEEEEccccEEcccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccHHHHHccccccEEEEEcccEcccccHHHHHHHHHHHHHcccccEEEEEEEccEEEEEEEEEcccccccEEEEEEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
mlinfsisppssyslikisnsklpisefplkpkthlskshfscacsssslsfycknqlfyekskypfrkrlhfrtcavsgfdlgSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFsannveyslrafplggfvgfpdndpesgipvddenllknrpildRVIVISAGVVANIVFAFVIIFTQVLsvglpvqdafpgvlVPEVRALsaasrdglfpgdvilsvngnefpktgpNVVSELVNAIKKSPKRNVLLKVARGEqqfeigvtpdenydgtgkigvqlspnvkiskvlpKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSqtaskvsgpVAIIAVGAEVARSNIDGLYQFAAVLNINLAVinllplpaldggsLALILIEAArggrklplEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
mlinfsisppssySLIKISNSKLPISEFPLKPKTHLSKSHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAikkspkrnvllkvargeqqfeigvtpdenydGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
MLINFSISPPSSYSLIKISNSKLPISEFPLKPKTHlskshfscacsssslsfYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISagvvanivfafviifTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFaavlninlavinllplpalDGGSLALILIEAARGGRKLPLEVEQQImssgimlvlllglflivRDTLNLDIIKDML
**************************************SHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPD******IPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDII****
********PPSSYSLIKISNSKLP*********************************LFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDND************LKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
MLINFSISPPSSYSLIKISNSKLPISEFPLKPKTHLSKSHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
*LINFSISPPSSYSLIKISNSKLPISEFPLKPKTHLSKSHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLINFSISPPSSYSLIKISNSKLPISEFPLKPKTHLSKSHFSCACSSSSLSFYCKNQLFYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query448 2.2.26 [Sep-21-2011]
P73714366 Putative zinc metalloprot N/A no 0.792 0.969 0.484 1e-87
Q8YQ64364 Putative zinc metalloprot yes no 0.774 0.953 0.494 2e-76
Q8XJR2335 Putative zinc metalloprot yes no 0.716 0.958 0.300 2e-32
P58819339 Putative zinc metalloprot yes no 0.734 0.970 0.307 8e-29
Q92Q49374 Putative zinc metalloprot yes no 0.720 0.863 0.276 9e-27
O31754422 Zinc metalloprotease RasP yes no 0.549 0.582 0.320 4e-26
Q8UFL7377 Putative zinc metalloprot yes no 0.738 0.877 0.280 5e-26
Q97I57339 Putative zinc metalloprot yes no 0.718 0.949 0.273 5e-25
Q9RU85377 Putative zinc metalloprot yes no 0.736 0.875 0.279 1e-22
Q9ZE02359 Putative zinc metalloprot yes no 0.656 0.818 0.301 9e-22
>sp|P73714|Y1821_SYNY3 Putative zinc metalloprotease slr1821 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1821 PE=3 SV=1 Back     alignment and function desciption
 Score =  323 bits (829), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 175/361 (48%), Positives = 248/361 (68%), Gaps = 6/361 (1%)

Query: 88  SVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLG 147
           + L A GVL  +I VHE GHF AA LQGIHV++FA+GFGP L K+     EYS+RA PLG
Sbjct: 5   AALAAIGVLAVLIAVHELGHFAAARLQGIHVTRFALGFGPPLLKYQGAETEYSIRAIPLG 64

Query: 148 GFVGFPDNDPESGIPVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPV 207
           G+V FPD+DP+S IP DD NLLKNRPILDR IVISAGV+AN+VFA+ ++  QV ++G   
Sbjct: 65  GYVAFPDDDPDSEIPADDPNLLKNRPILDRAIVISAGVIANLVFAYFLLIGQVSTIGF-- 122

Query: 208 QDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNV 267
           Q+  PG+++P+V + SAA   G+ PGD++LS+ GN  P   P+  ++ ++ +++SP   +
Sbjct: 123 QNIQPGLVIPQVDSASAAQVAGMEPGDIVLSLQGNTLPGF-PDATTQFIDIVRRSPSVPI 181

Query: 268 LLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLS 327
            ++V RGE+   + +TP  + +G GKIGV L PNV+  +    N LEA  ++A+ F  + 
Sbjct: 182 TVEVQRGEETKTLTITPTPDAEGKGKIGVALLPNVETKRA--SNPLEALTYSAEAFERIV 239

Query: 328 CNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLP 387
                   Q   NF+  AS+V+GPV I+  GA +ARS+   L+QF A+++INLAVIN+LP
Sbjct: 240 KLTTQGFWQLISNFADNASQVAGPVKIVEYGANIARSDASNLFQFGALISINLAVINILP 299

Query: 388 LPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNLDIIKDM 447
           LPALDGG L  +LIE    G+ LP + +  +M +G++L+L LG+FLIVRDTLNL  +++ 
Sbjct: 300 LPALDGGQLVFLLIEGLL-GKPLPEKFQMGVMQTGLVLLLSLGVFLIVRDTLNLTFVQEF 358

Query: 448 L 448
           L
Sbjct: 359 L 359

Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 3EC: .EC: 4EC: .EC: 2EC: 4EC: .EC: -
>sp|Q8YQ64|Y3971_NOSS1 Putative zinc metalloprotease all3971 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all3971 PE=3 SV=1 Back     alignment and function description
>sp|Q8XJR2|Y1693_CLOPE Putative zinc metalloprotease CPE1693 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1693 PE=3 SV=1 Back     alignment and function description
>sp|P58819|Y1322_FUSNN Putative zinc metalloprotease FN1322 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=FN1322 PE=3 SV=1 Back     alignment and function description
>sp|Q92Q49|Y1501_RHIME Putative zinc metalloprotease R01501 OS=Rhizobium meliloti (strain 1021) GN=R01501 PE=3 SV=1 Back     alignment and function description
>sp|O31754|RASP_BACSU Zinc metalloprotease RasP OS=Bacillus subtilis (strain 168) GN=rasP PE=1 SV=1 Back     alignment and function description
>sp|Q8UFL7|Y1380_AGRT5 Putative zinc metalloprotease Atu1380 OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=Atu1380 PE=3 SV=1 Back     alignment and function description
>sp|Q97I57|Y1796_CLOAB Putative zinc metalloprotease CA_C1796 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1796 PE=3 SV=1 Back     alignment and function description
>sp|Q9RU85|Y1507_DEIRA Putative zinc metalloprotease DR_1507 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1507 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZE02|Y161_RICPR Putative zinc metalloprotease RP161 OS=Rickettsia prowazekii (strain Madrid E) GN=RP161 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
224131594447 predicted protein [Populus trichocarpa] 0.993 0.995 0.806 0.0
224064978449 predicted protein [Populus trichocarpa] 0.957 0.955 0.790 0.0
255577577447 Protease ecfE, putative [Ricinus communi 0.959 0.961 0.781 0.0
449468448450 PREDICTED: putative zinc metalloprotease 0.993 0.988 0.739 0.0
449522404456 PREDICTED: putative zinc metalloprotease 0.993 0.975 0.736 0.0
18402981447 serine protease [Arabidopsis thaliana] g 0.991 0.993 0.713 0.0
225447027426 PREDICTED: putative zinc metalloprotease 0.901 0.948 0.755 0.0
297826691444 hypothetical protein ARALYDRAFT_482175 [ 0.984 0.993 0.707 1e-178
18390484441 peptidase M50-like protein [Arabidopsis 0.984 1.0 0.703 1e-171
22655054441 unknown protein [Arabidopsis thaliana] 0.984 1.0 0.700 1e-171
>gi|224131594|ref|XP_002321129.1| predicted protein [Populus trichocarpa] gi|222861902|gb|EEE99444.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/450 (80%), Positives = 392/450 (87%), Gaps = 5/450 (1%)

Query: 1   MLINFSISPPSSYSLI-KISNSKLPISEFP-LKPKTHLSKSHFSCACSSSSLSFYCKNQL 58
           MLINFS SP    S + + SNSK P+ E P LK KT+  K   S  C SS+LSF+ K  L
Sbjct: 1   MLINFSSSPLPPSSSLPRFSNSKSPVLEPPSLKSKTNFLKPLPSSPCYSSNLSFHPKTHL 60

Query: 59  FYEKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHV 118
           F   S+ P  KRL  R+CAVSGFDLG+FESVLEAAGVLTAII+VHESGHFLAAYLQGIHV
Sbjct: 61  F---SRCPHGKRLDLRSCAVSGFDLGNFESVLEAAGVLTAIIVVHESGHFLAAYLQGIHV 117

Query: 119 SKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRV 178
           SKFAVGFGP+LAKFSA NVEYSLRAFPLGGFVGFPDNDPES IPVDDENLLKNRPILDR 
Sbjct: 118 SKFAVGFGPVLAKFSAKNVEYSLRAFPLGGFVGFPDNDPESDIPVDDENLLKNRPILDRT 177

Query: 179 IVISAGVVANIVFAFVIIFTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILS 238
           IVISAGV+ANI+FA+ IIF QVLSVGLPVQ+AFPGVLVPEVRA SAASRDGL PGDVIL+
Sbjct: 178 IVISAGVIANIIFAYAIIFVQVLSVGLPVQEAFPGVLVPEVRAFSAASRDGLLPGDVILA 237

Query: 239 VNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQL 298
           VNG   PK GPN VSE+V  IK SPK+NVLLKV RG+Q FEIGVTPDE++DGTGKIGVQL
Sbjct: 238 VNGTNLPKIGPNAVSEVVGVIKSSPKKNVLLKVGRGKQDFEIGVTPDESFDGTGKIGVQL 297

Query: 299 SPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVG 358
           SPNVKI+KV+ KN+LEAF F  KEF GLS NV+DSLKQTF NFSQ+ASKVSGPVAIIAVG
Sbjct: 298 SPNVKITKVVAKNILEAFNFAGKEFLGLSSNVVDSLKQTFLNFSQSASKVSGPVAIIAVG 357

Query: 359 AEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQI 418
           AEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLA ILIEAARGGRKLPLE+EQ+I
Sbjct: 358 AEVARSNIDGLYQFAAVLNINLAVINLLPLPALDGGSLAFILIEAARGGRKLPLEIEQRI 417

Query: 419 MSSGIMLVLLLGLFLIVRDTLNLDIIKDML 448
           MSSGIMLV+LLGLFLIVRDTLNLD IKDML
Sbjct: 418 MSSGIMLVILLGLFLIVRDTLNLDFIKDML 447

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224064978|ref|XP_002301619.1| predicted protein [Populus trichocarpa] gi|222843345|gb|EEE80892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255577577|ref|XP_002529666.1| Protease ecfE, putative [Ricinus communis] gi|223530846|gb|EEF32708.1| Protease ecfE, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449468448|ref|XP_004151933.1| PREDICTED: putative zinc metalloprotease slr1821-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449522404|ref|XP_004168216.1| PREDICTED: putative zinc metalloprotease slr1821-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18402981|ref|NP_565745.1| serine protease [Arabidopsis thaliana] gi|14423492|gb|AAK62428.1|AF386983_1 Unknown protein [Arabidopsis thaliana] gi|3298536|gb|AAC25930.1| expressed protein [Arabidopsis thaliana] gi|21553979|gb|AAM63060.1| unknown [Arabidopsis thaliana] gi|30387545|gb|AAP31938.1| At2g32480 [Arabidopsis thaliana] gi|330253597|gb|AEC08691.1| serine protease [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225447027|ref|XP_002269218.1| PREDICTED: putative zinc metalloprotease slr1821-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297826691|ref|XP_002881228.1| hypothetical protein ARALYDRAFT_482175 [Arabidopsis lyrata subsp. lyrata] gi|297327067|gb|EFH57487.1| hypothetical protein ARALYDRAFT_482175 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18390484|ref|NP_563729.1| peptidase M50-like protein [Arabidopsis thaliana] gi|2388583|gb|AAB71464.1| Similar to Synechocystis hypothetical protein (gb|D90908) [Arabidopsis thaliana] gi|17065222|gb|AAL32765.1| Unknown protein [Arabidopsis thaliana] gi|332189673|gb|AEE27794.1| peptidase M50-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|22655054|gb|AAM98118.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
TAIR|locus:2060295447 ARASP "ARABIDOPSIS SERIN PROTE 0.997 1.0 0.604 1.4e-135
TAIR|locus:2207145441 AT1G05140 [Arabidopsis thalian 0.984 1.0 0.591 1e-130
TIGR_CMR|CHY_1777343 CHY_1777 "putative membrane-as 0.649 0.848 0.287 2e-24
UNIPROTKB|Q9KPV9452 VC_2253 "Putative zinc metallo 0.345 0.342 0.298 1.8e-15
TIGR_CMR|VC_2253452 VC_2253 "conserved hypothetica 0.345 0.342 0.298 1.8e-15
TIGR_CMR|DET_0370345 DET_0370 "membrane-associated 0.680 0.884 0.256 3e-15
TIGR_CMR|BA_3958420 BA_3958 "membrane-associated z 0.410 0.438 0.265 1.1e-14
UNIPROTKB|P0AEH1450 rseP [Escherichia coli K-12 (t 0.343 0.342 0.307 3.4e-13
TIGR_CMR|GSU_1914355 GSU_1914 "membrane-associated 0.426 0.538 0.301 8.6e-13
TIGR_CMR|SO_1636456 SO_1636 "membrane-associated z 0.212 0.208 0.336 9.9e-12
TAIR|locus:2060295 ARASP "ARABIDOPSIS SERIN PROTEASE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1328 (472.5 bits), Expect = 1.4e-135, P = 1.4e-135
 Identities = 271/448 (60%), Positives = 318/448 (70%)

Query:     1 MLINFSISPPSSYSLIKISNSKLPISEFPLKPKTHXXXXXXXXXXXXXXXXXYCKNQLFY 60
             ML+N S SP S  +   +SN   PIS FP + KTH                   KN++ +
Sbjct:     1 MLLNISSSPISHRNPHFLSNFNNPISYFPRRSKTHLSKSHFFPKFTPLSNQSL-KNRVLF 59

Query:    61 EKSKYPFRKRLHFRTCAVSGFDLGSFESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSK 120
                +YP  +R  FR+ A+SG DLGSFESVLEA  VLT II+VHESGHFLAA LQGIHVSK
Sbjct:    60 GNKRYPDGERFDFRSRAISGIDLGSFESVLEAIAVLTTIIVVHESGHFLAASLQGIHVSK 119

Query:   121 FAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNRPILDRVIV 180
             FA+GFGPILAKF  NNVEYSLRAFPLGGFVGFPDNDP+S IP+DDENLLKNRP LDR IV
Sbjct:   120 FAIGFGPILAKFDYNNVEYSLRAFPLGGFVGFPDNDPDSEIPIDDENLLKNRPTLDRSIV 179

Query:   181 ISXXXXXXXXXXXXXXXTQVLSVGLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVN 240
             +S                QVLSVGLPVQ+AFPGVLVPEV+  SAASRDGL  GDVIL+V+
Sbjct:   180 VSAGIIANVIFAYAIIFVQVLSVGLPVQEAFPGVLVPEVKTFSAASRDGLLSGDVILAVD 239

Query:   241 GNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSP 300
             G E  KTGP+ VS++V+ +K++PK NV+ ++ RG + F+I VTPD+N+DGTGKIGVQLSP
Sbjct:   240 GTELSKTGPDAVSKIVDIVKRNPKSNVVFRIERGGEDFDIRVTPDKNFDGTGKIGVQLSP 299

Query:   301 NVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAE 360
             NV+I+KV P+N+ E FRF  +EF GLS NVLD LKQTFFNFSQTASKV+GPVAIIAVGAE
Sbjct:   300 NVRITKVRPRNIPETFRFVGREFMGLSSNVLDGLKQTFFNFSQTASKVAGPVAIIAVGAE 359

Query:   361 VARSNIDGLYQFXXXXXXXXXXXXXXXXXXXDGGSLALILIEAARGGRKLPLEVEQQIXX 420
             VARSNIDGLYQF                   DGG+LALIL+EA RGG+KLP+EVEQ I  
Sbjct:   360 VARSNIDGLYQFAALLNINLAVINLLPLPALDGGTLALILLEAVRGGKKLPVEVEQGIMS 419

Query:   421 XXXXXXXXXXXXXXXRDTLNLDIIKDML 448
                            +DTL+LD IK+ML
Sbjct:   420 SGIMLVIFLGLFLIVKDTLSLDFIKEML 447
GO:0004222 "metalloendopeptidase activity" evidence=IEA;ISS;TAS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0009536 "plastid" evidence=ISS
GO:0009658 "chloroplast organization" evidence=IMP
GO:0009706 "chloroplast inner membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0010207 "photosystem II assembly" evidence=RCA
TAIR|locus:2207145 AT1G05140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1777 CHY_1777 "putative membrane-associated zinc metalloprotease" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPV9 VC_2253 "Putative zinc metalloprotease VC_2253" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2253 VC_2253 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0370 DET_0370 "membrane-associated zinc metalloprotease, putative" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3958 BA_3958 "membrane-associated zinc metalloprotease, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P0AEH1 rseP [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1914 GSU_1914 "membrane-associated zinc metalloprotease, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1636 SO_1636 "membrane-associated zinc metalloprotease, putative" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.24.85LOW CONFIDENCE prediction!
3rd Layer3.4.24LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.XIV.3339.1
hypothetical protein (396 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_XV1514
1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC-1.1.1.267) (471 aa)
•  •    0.747
DXR
SubName- Full=Putative chloroplast 1-deoxy-D-xylulose 5-phosphate reductoisomerase; EC=1.1.1.26 [...] (471 aa)
•  •    0.745
estExt_Genewise1_v1.C_LG_II0778
hypothetical protein (286 aa)
•  •    0.621
fgenesh4_pm.C_LG_XIV000511
hypothetical protein; Associates with the EF-Tu.GDP complex and induces the exchange of GDP to [...] (323 aa)
•       0.590
gw1.I.2958.1
hypothetical protein (209 aa)
•       0.552
fgenesh4_pm.C_LG_IX000553
hypothetical protein (234 aa)
•       0.507
gw1.I.925.1
hypothetical protein (242 aa)
•       0.487
gw1.I.3568.1
hypothetical protein (241 aa)
•       0.480
estExt_fgenesh4_pg.C_700026
hypothetical protein (250 aa)
•       0.444
eugene3.178100001
Predicted protein (191 aa)
•       0.420

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
COG0750375 COG0750, COG0750, Predicted membrane-associated Zn 7e-47
TIGR00054419 TIGR00054, TIGR00054, RIP metalloprotease RseP 2e-37
TIGR00054419 TIGR00054, TIGR00054, RIP metalloprotease RseP 6e-35
cd06163182 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 p 9e-35
cd06163182 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 p 1e-19
pfam02163206 pfam02163, Peptidase_M50, Peptidase family M50 5e-19
cd05709180 cd05709, S2P-M50, Site-2 protease (S2P) class of z 5e-18
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Pr 2e-15
pfam02163206 pfam02163, Peptidase_M50, Peptidase family M50 3e-15
PRK10779449 PRK10779, PRK10779, zinc metallopeptidase RseP; Pr 7e-14
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 1e-11
cd05709180 cd05709, S2P-M50, Site-2 protease (S2P) class of z 3e-09
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 2e-08
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 4e-07
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 1e-06
pfam1318081 pfam13180, PDZ_2, PDZ domain 1e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 2e-05
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 3e-05
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 7e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 4e-04
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 9e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.001
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 0.003
>gnl|CDD|223821 COG0750, COG0750, Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information 
 Score =  165 bits (419), Expect = 7e-47
 Identities = 114/377 (30%), Positives = 167/377 (44%), Gaps = 30/377 (7%)

Query: 88  SVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANN-VEYSLRAFPL 146
           +++     L  ++ VHE GHF  A   G+ V +F++GFGP L         EY L A PL
Sbjct: 4   TIIAFIIALGVLVFVHELGHFWVARRCGVKVERFSIGFGPKLFSRKDKGGTEYVLSAIPL 63

Query: 147 GGFVGFPDNDPESGI---PVDDENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSV 203
           GG+V     D E  +   P         + +  R+ ++ AG + N + A V+       +
Sbjct: 64  GGYVKMLGEDAEEVVLKGPEPRPRAFNAKSVWQRIAIVFAGPLFNFILAIVLFVVLFFVI 123

Query: 204 GLPVQDAFPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSP 263
           GL V  A P  +V EV   SAA+  GL PGD I++V+G +      + V  L+ A     
Sbjct: 124 GL-VPVASP--VVGEVAPKSAAALAGLRPGDRIVAVDGEKVAS--WDDVRRLLVAAAGDV 178

Query: 264 KRNVLLKVAR---------GEQQFEIGVTPDENYDGTGKIGVQ-------LSPNVKISK- 306
              + + V R          E    +G+TP       G   V        LSPN +    
Sbjct: 179 FNLLTILVIRLDGEAHAVAAEIIKSLGLTPVVIPLKPGDKIVAVDVGAIGLSPNGEPDVG 238

Query: 307 --VLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARS 364
             ++    LEA     ++   L    L  LK+       +   +SGP+ I  +    A  
Sbjct: 239 KVLVKYGPLEAVGLAVEKTGRLVKLTLKMLKK-LITGDLSLKNLSGPIGIAKIAGAAASL 297

Query: 365 NIDGLYQFAAVLNINLAVINLLPLPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIM 424
            +  L  F A+L+INL ++NLLP+P LDGG L   L+EA R G+ L   VE  +   G+ 
Sbjct: 298 GLINLLFFLALLSINLGILNLLPIPPLDGGHLLFYLLEALR-GKPLSERVEAALYRIGLA 356

Query: 425 LVLLLGLFLIVRDTLNL 441
           L+LLL L     D L L
Sbjct: 357 LLLLLMLLATFNDLLRL 373

Length = 375
>gnl|CDD|232801 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|232801 TIGR00054, TIGR00054, RIP metalloprotease RseP Back     alignment and domain information
>gnl|CDD|100084 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|100084 cd06163, S2P-M50_PDZ_RseP-like, RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|216910 pfam02163, Peptidase_M50, Peptidase family M50 Back     alignment and domain information
>gnl|CDD|100078 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|216910 pfam02163, Peptidase_M50, Peptidase family M50 Back     alignment and domain information
>gnl|CDD|182723 PRK10779, PRK10779, zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|100078 cd05709, S2P-M50, Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 448
PRK10779449 zinc metallopeptidase RseP; Provisional 100.0
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 100.0
COG0750375 Predicted membrane-associated Zn-dependent proteas 100.0
cd06163182 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases ( 100.0
PF02163192 Peptidase_M50: Peptidase family M50; InterPro: IPR 99.96
cd06159263 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs 99.95
cd05709180 S2P-M50 Site-2 protease (S2P) class of zinc metall 99.94
cd06162277 S2P-M50_PDZ_SREBP Sterol regulatory element-bindin 99.94
KOG2921484 consensus Intramembrane metalloprotease (sterol-re 99.78
cd06164227 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), 99.75
cd06161208 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a z 99.74
cd06160183 S2P-M50_like_2 Uncharacterized homologs of Site-2 99.71
cd06158181 S2P-M50_like_1 Uncharacterized homologs of Site-2 99.58
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.37
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.21
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 99.18
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 99.08
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 99.07
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 99.05
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.96
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.87
PRK10779449 zinc metallopeptidase RseP; Provisional 98.78
PRK10139455 serine endoprotease; Provisional 98.78
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.77
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.75
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.74
PRK10898353 serine endoprotease; Provisional 98.73
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.66
PRK10942473 serine endoprotease; Provisional 98.65
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.61
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.59
PRK10139455 serine endoprotease; Provisional 98.58
PLN00049389 carboxyl-terminal processing protease; Provisional 98.56
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 98.52
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.51
PRK10942473 serine endoprotease; Provisional 98.46
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.46
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.45
KOG3129231 consensus 26S proteasome regulatory complex, subun 98.41
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.4
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 98.38
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 98.26
COG3480342 SdrC Predicted secreted protein containing a PDZ d 98.19
COG0265347 DegQ Trypsin-like serine proteases, typically peri 98.18
COG1994230 SpoIVFB Zn-dependent proteases [General function p 98.05
PRK11186 667 carboxy-terminal protease; Provisional 98.03
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.76
PRK09681276 putative type II secretion protein GspC; Provision 97.74
KOG1421 955 consensus Predicted signaling-associated protein ( 97.47
PF13398200 Peptidase_M50B: Peptidase M50B-like 97.4
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 97.28
KOG1320473 consensus Serine protease [Posttranslational modif 96.98
COG3975558 Predicted protease with the C-terminal PDZ domain 96.96
COG3031275 PulC Type II secretory pathway, component PulC [In 96.81
PF1281278 PDZ_1: PDZ-like domain 95.61
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 95.51
KOG3209984 consensus WW domain-containing protein [General fu 95.5
KOG3580 1027 consensus Tight junction proteins [Signal transduc 95.45
KOG3834 462 consensus Golgi reassembly stacking protein GRASP6 94.92
KOG3532 1051 consensus Predicted protein kinase [General functi 94.74
KOG3552 1298 consensus FERM domain protein FRM-8 [General funct 94.43
COG1994230 SpoIVFB Zn-dependent proteases [General function p 93.85
KOG3209984 consensus WW domain-containing protein [General fu 93.39
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 93.02
KOG3580 1027 consensus Tight junction proteins [Signal transduc 92.97
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 92.79
KOG3651 429 consensus Protein kinase C, alpha binding protein 91.39
KOG3605829 consensus Beta amyloid precursor-binding protein [ 91.15
KOG0606 1205 consensus Microtubule-associated serine/threonine 90.0
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 89.79
KOG3549 505 consensus Syntrophins (type gamma) [Extracellular 88.92
PF01434213 Peptidase_M41: Peptidase family M41 This is family 86.96
KOG3551 506 consensus Syntrophins (type beta) [Extracellular s 85.22
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 85.07
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 83.45
KOG1421955 consensus Predicted signaling-associated protein ( 81.4
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 80.52
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information 
Probab=100.00  E-value=9.9e-82  Score=661.41  Aligned_cols=348  Identities=27%  Similarity=0.427  Sum_probs=307.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhHHHHHHHHhCCccceEeeeccceeeeec-cCceeEEEeEEeccceeecCCCCCCCCCCCC
Q 040736           86 FESVLEAAGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFS-ANNVEYSLRAFPLGGFVGFPDNDPESGIPVD  164 (448)
Q Consensus        86 ~~~i~~~~~~l~~~i~vHE~gH~~~A~~~gv~V~~fsiGfGp~l~~~~-~~~t~y~i~~~plGg~v~~~~~~~~~~~~~~  164 (448)
                      +++++.++++++++|++||+|||++||+||++|++||+||||+||+|+ ++||||+++++|+||||+|.|+++++..++|
T Consensus         4 ~~~i~~fil~l~~li~vHElGHfl~Ar~~gv~V~~FsiGfGp~l~~~~~~~~Tey~i~~iPlGGyVk~~~e~~~~~~~~~   83 (449)
T PRK10779          4 LWNLAAFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDRQGTEYVIALIPLGGYVKMLDERVEPVAPEL   83 (449)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCeeeEEEeecChhHeeEecCCCcEEEEEEEcCCCeeecCCCCCCcCChhh
Confidence            567888999999999999999999999999999999999999999996 8999999999999999999998654433345


Q ss_pred             ChhhhhCCCccceeeeeecchhHHHHHHHHHHhhhhccccccccC-----------------------------------
Q 040736          165 DENLLKNRPILDRVIVISAGVVANIVFAFVIIFTQVLSVGLPVQD-----------------------------------  209 (448)
Q Consensus       165 ~~~~f~~~~~~~r~~v~~aGp~~N~l~a~v~~~~~~~~~G~p~~~-----------------------------------  209 (448)
                      +++.|+++|+|||++|++|||++|+++|++++++++ ..|.+...                                   
T Consensus        84 ~~~~f~~k~~~~R~~i~~AGp~~N~ila~~~~~~~~-~~G~~~~~~lV~~V~~~SpA~kAGLk~GDvI~~vnG~~V~~~~  162 (449)
T PRK10779         84 RHHAFNNKTVGQRAAIIAAGPIANFIFAIFAYWLVF-IIGVPGVRPVVGEIAPNSIAAQAQIAPGTELKAVDGIETPDWD  162 (449)
T ss_pred             hhhhhccCCHHHhhhhhhhhHHHHHHHHHHHHHHHH-hcCcccCCccccccCCCCHHHHcCCCCCCEEEEECCEEcCCHH
Confidence            567999999999999999999999999999987766 34653210                                   


Q ss_pred             --------------------------------------------------------CCCceeecccCCCChhhhCCCCCC
Q 040736          210 --------------------------------------------------------AFPGVLVPEVRALSAASRDGLFPG  233 (448)
Q Consensus       210 --------------------------------------------------------~~~gvvV~~V~~gSpA~~AGL~~G  233 (448)
                                                                              +..+++|.+|.++|||++|||++|
T Consensus       163 ~l~~~v~~~~~g~~v~v~v~R~gk~~~~~v~l~~~~~~~~~~~~~~~~~lGl~~~~~~~~~vV~~V~~~SpA~~AGL~~G  242 (449)
T PRK10779        163 AVRLALVSKIGDESTTITVAPFGSDQRRDKTLDLRHWAFEPDKQDPVSSLGIRPRGPQIEPVLAEVQPNSAASKAGLQAG  242 (449)
T ss_pred             HHHHHHHhhccCCceEEEEEeCCccceEEEEecccccccCccccchhhcccccccCCCcCcEEEeeCCCCHHHHcCCCCC
Confidence                                                                    000257889999999999999999


Q ss_pred             CEEEEECCeecCCCCCCCHHHHHHHHHcCCCCcEEEEEEeCCEEEEEEEeecccC-C--CCceEEEEecCC---cceeee
Q 040736          234 DVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENY-D--GTGKIGVQLSPN---VKISKV  307 (448)
Q Consensus       234 DvIlsInG~~V~~~~~~s~~dl~~~L~~~~g~~V~l~V~R~G~~~~l~v~p~~~~-~--~~~~lGV~~~~~---~~~~~~  307 (448)
                      |+|++|||+++     ++|+|+.+.++.+++++++++++|+|+..+++++++... +  ..+.+|+.....   ......
T Consensus       243 DvIl~Ing~~V-----~s~~dl~~~l~~~~~~~v~l~v~R~g~~~~~~v~~~~~~~~g~~~~~iGi~~~~~~~~~~~~~~  317 (449)
T PRK10779        243 DRIVKVDGQPL-----TQWQTFVTLVRDNPGKPLALEIERQGSPLSLTLTPDSKPGNGKAEGFAGVVPKVIPLPDEYKTV  317 (449)
T ss_pred             CEEEEECCEEc-----CCHHHHHHHHHhCCCCEEEEEEEECCEEEEEEEEeeeecCCCceeeEEEEeccccCCcccceeE
Confidence            99999999999     899999999988788899999999999999999886432 1  236689975421   111223


Q ss_pred             ecCCHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccCccccCCceEeeeccHHHHHhhHHHHHHHHHHHHHHHHHhcccc
Q 040736          308 LPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFAAVLNINLAVINLLP  387 (448)
Q Consensus       308 ~~~~~~~a~~~~~~~~~~~~~~~l~~l~~l~~g~~~~~~~l~GPV~I~~~~~~~a~~g~~~ll~fialISi~Lgi~NLLP  387 (448)
                      .++++.+|+.++++++++++..++++++++++| ..+.++++|||+|+++++++++.||..+++|+|+||+|||+|||||
T Consensus       318 ~~~~~~~ai~~a~~~~~~~~~~~~~~l~~l~~g-~~~~~~l~GPv~I~~~~~~~~~~g~~~~l~~~a~iSi~Lgi~NLlP  396 (449)
T PRK10779        318 RQYGPFSAIYEATDKTWQLMKLTVSMLGKLITG-DVKLNNLSGPISIAQGAGMSAEYGLVYYLMFLALISVNLGIINLFP  396 (449)
T ss_pred             EecCHHHHHHHHHHHHHHHHHHHHHHHHHHhcC-CccHhhcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCC
Confidence            458999999999999999999999999999999 4577899999999999999999999999999999999999999999


Q ss_pred             CCCCChhHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHhhhhH
Q 040736          388 LPALDGGSLALILIEAARGGRKLPLEVEQQIMSSGIMLVLLLGLFLIVRDTLNL  441 (448)
Q Consensus       388 IP~LDGG~Il~~liE~i~~gr~l~~~~~~~i~~~G~~lll~L~~~~~~nDi~~l  441 (448)
                      ||+|||||++|+++|++| |||+|+++|++++.+|++++++||+++++|||.|+
T Consensus       397 iP~LDGG~l~f~~~E~i~-~r~~~~~~~~~~~~~G~~ll~~lm~~~~~nDi~rl  449 (449)
T PRK10779        397 LPVLDGGHLLFLAIEKLK-GGPVSERVQDFSYRIGSILLVLLMGLALFNDFSRL  449 (449)
T ss_pred             CCccCchHHHHHHHHHHh-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            999999999999999999 99999999999999999999999999999999875

>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>PF02163 Peptidase_M50: Peptidase family M50; InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism Back     alignment and domain information
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation Back     alignment and domain information
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF13398 Peptidase_M50B: Peptidase M50B-like Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3834 consensus Golgi reassembly stacking protein GRASP65, contains PDZ domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>KOG3552 consensus FERM domain protein FRM-8 [General function prediction only] Back     alignment and domain information
>COG1994 SpoIVFB Zn-dependent proteases [General function prediction only] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3549 consensus Syntrophins (type gamma) [Extracellular structures] Back     alignment and domain information
>PF01434 Peptidase_M41: Peptidase family M41 This is family M41 in the peptidase classification Back     alignment and domain information
>KOG3551 consensus Syntrophins (type beta) [Extracellular structures] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
2hga_A125 Conserved protein MTH1368; GFT structural genomics 1e-10
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-10
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 3e-10
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 4e-10
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 1e-09
2kl1_A94 YLBL protein; structure genomics, structural genom 4e-09
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 4e-09
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 6e-09
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 9e-09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 1e-08
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 3e-05
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 2e-08
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 8e-08
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 5e-05
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 9e-08
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 1e-07
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 5e-05
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 1e-07
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 4e-07
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-07
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 6e-07
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 7e-07
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-07
2eaq_A90 LIM domain only protein 7; conserved hypothetical 8e-07
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 1e-06
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 1e-06
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 1e-06
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-06
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 1e-06
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-06
2eei_A106 PDZ domain-containing protein 1; regulatory factor 2e-06
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 2e-06
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 2e-06
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 2e-06
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 2e-06
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 2e-06
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 3e-06
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 3e-06
2ego_A96 General receptor for phosphoinositides 1- associat 3e-06
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 3e-06
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 3e-06
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 6e-06
2v90_A96 PDZ domain-containing protein 3; membrane, protein 6e-06
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 6e-06
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 8e-06
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 8e-06
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 8e-06
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 9e-06
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 1e-05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-05
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 1e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-05
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-05
2d90_A102 PDZ domain containing protein 1; structural genomi 2e-05
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-05
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 2e-05
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-05
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 2e-05
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 3e-05
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 3e-05
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 3e-05
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 8e-05
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 4e-05
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 4e-05
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-05
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 4e-05
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 4e-05
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 4e-05
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 4e-05
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 4e-05
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 4e-05
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-05
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 4e-05
3khf_A99 Microtubule-associated serine/threonine-protein ki 4e-05
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 5e-05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-05
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 2e-04
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 5e-05
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 5e-05
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 5e-05
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 6e-05
2opg_A98 Multiple PDZ domain protein; structural protein, s 6e-05
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 6e-05
2eeh_A100 PDZ domain-containing protein 7; structural genomi 6e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 6e-05
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 6e-05
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 7e-05
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 8e-05
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 8e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 8e-05
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 8e-05
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 8e-05
4fgm_A597 Aminopeptidase N family protein; structural genomi 9e-05
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 9e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 1e-04
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 1e-04
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 1e-04
3k1r_A192 Harmonin; protein-protein complex, alternative spl 1e-04
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-04
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-04
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 1e-04
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 1e-04
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-04
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-04
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-04
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 2e-04
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 2e-04
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-04
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 2e-04
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-04
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 2e-04
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-04
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-04
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 2e-04
2awx_A105 Synapse associated protein 97; membrane protein, s 2e-04
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 2e-04
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-04
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 2e-04
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-04
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-04
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-04
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-04
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 2e-04
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 2e-04
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-04
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 3e-04
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 3e-04
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 5e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 3e-04
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 3e-04
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-04
2djt_A104 Unnamed protein product; PDZ domain, structural ge 3e-04
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 3e-04
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 3e-04
2fne_A117 Multiple PDZ domain protein; structural protein, s 3e-04
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 3e-04
2byg_A117 Channel associated protein of synapse-110; DLG2, P 4e-04
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 5e-04
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 5e-04
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 5e-04
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 5e-04
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 5e-04
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 5e-04
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 5e-04
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 5e-04
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 7e-04
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 7e-04
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 7e-04
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 8e-04
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 8e-04
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
 Score = 57.9 bits (140), Expect = 1e-10
 Identities = 22/101 (21%), Positives = 41/101 (40%), Gaps = 9/101 (8%)

Query: 213 GVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAI-KKSPKRNVLLKV 271
           GV +  V   S AS+  L PG VI S+NG          ++    A+   S    + +  
Sbjct: 26  GVQIDSVVPGSPASK-VLTPGLVIESINGMPTSN-----LTTYSAALKTISVGEVINITT 79

Query: 272 ARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNL 312
            +G    + G  P+        +G++ S ++++   +   L
Sbjct: 80  DQGTFHLKTGRNPNN--SSRAYMGIRTSNHLRVRDSVASVL 118
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Length = 134 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
3b4r_A224 Putative zinc metalloprotease MJ0392; intramembran 99.71
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 99.41
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 99.34
2kl1_A94 YLBL protein; structure genomics, structural genom 99.31
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 99.31
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.22
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.21
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 99.19
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 99.17
2hga_A125 Conserved protein MTH1368; GFT structural genomics 99.16
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.16
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.1
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 99.1
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 99.1
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 99.08
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.07
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.07
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.06
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.06
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.06
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.05
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.03
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.01
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.01
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.99
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.98
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.97
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.97
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.96
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.96
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.95
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 98.95
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.95
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.94
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.93
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.93
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.93
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.92
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.92
2awx_A105 Synapse associated protein 97; membrane protein, s 98.92
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.91
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.91
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.91
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 98.91
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.9
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.9
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.9
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.89
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.88
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.88
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.88
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.88
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 98.87
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.87
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.86
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.86
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.86
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.85
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 98.85
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.85
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.84
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 98.84
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.84
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.84
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.84
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.84
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.83
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.83
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.83
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.83
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.83
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.82
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 98.82
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.82
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.81
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.81
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.81
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.81
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.8
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.8
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.8
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.8
2ego_A96 General receptor for phosphoinositides 1- associat 98.8
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.8
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.8
2d90_A102 PDZ domain containing protein 1; structural genomi 98.8
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.8
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.79
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.79
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.79
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.78
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.78
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.78
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.77
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.77
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.77
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.77
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.77
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.76
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.76
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.76
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.76
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.76
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.76
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.75
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.75
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.75
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.75
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.75
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.75
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.75
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.75
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 98.75
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.75
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.74
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 98.74
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.74
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.74
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 98.74
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.73
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.73
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.73
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.72
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.72
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.72
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.71
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.71
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.7
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.7
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.7
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.7
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.69
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.69
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.69
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.69
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.68
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.68
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.68
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.67
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.67
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.66
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.66
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.65
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.65
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.65
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.65
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.65
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.65
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.64
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.64
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.63
2eei_A106 PDZ domain-containing protein 1; regulatory factor 98.63
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.63
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.62
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.62
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.62
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.62
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.62
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.61
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 98.61
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.61
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 98.6
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.6
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.6
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.59
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 98.59
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.58
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.58
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 98.58
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.58
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.57
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.57
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 98.57
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 98.56
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.54
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 98.53
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.53
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.52
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.51
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.5
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.49
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.48
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 98.47
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.47
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.44
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.4
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.4
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 98.38
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.37
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.3
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.26
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 97.56
3k50_A403 Putative S41 protease; structural genomics, joint 98.24
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.23
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.22
1k32_A1045 Tricorn protease; protein degradation, substrate g 97.92
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.91
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 97.8
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.77
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.67
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.24
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.21
2di4_A238 Zinc protease, cell division protein FTSH homolog; 94.35
>3b4r_A Putative zinc metalloprotease MJ0392; intramembrane protease, CBS domain, hydrolase, metal-binding, transmembrane; 3.30A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=99.71  E-value=5.6e-17  Score=154.72  Aligned_cols=68  Identities=22%  Similarity=0.396  Sum_probs=56.5

Q ss_pred             HHHHHHHHHHHhhHHHHHHHHhCCccceEeeeccceeeeeccCceeEEEeEEeccceeecCCCCCCCCCCCCChhhhhCC
Q 040736           93 AGVLTAIIIVHESGHFLAAYLQGIHVSKFAVGFGPILAKFSANNVEYSLRAFPLGGFVGFPDNDPESGIPVDDENLLKNR  172 (448)
Q Consensus        93 ~~~l~~~i~vHE~gH~~~A~~~gv~V~~fsiGfGp~l~~~~~~~t~y~i~~~plGg~v~~~~~~~~~~~~~~~~~~f~~~  172 (448)
                      ++.+.+++++||+||+++||++|+++++                    +.++|+|||+++.+                 .
T Consensus        44 ~l~l~~~v~~HElgH~~~A~~~G~~~~~--------------------i~l~p~Gg~~~~~~-----------------~   86 (224)
T 3b4r_A           44 FILLFVSVVLHELGHSYVAKKYGVKIEK--------------------ILLLPIGGVAMMDK-----------------I   86 (224)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCCCCC--------------------EEECSSSCBCCCCC-----------------C
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCcccc--------------------EEEEEeeeEEEccc-----------------C
Confidence            4456777899999999999999999998                    56789999998621                 1


Q ss_pred             CccceeeeeecchhHHHHHHHHHHh
Q 040736          173 PILDRVIVISAGVVANIVFAFVIIF  197 (448)
Q Consensus       173 ~~~~r~~v~~aGp~~N~l~a~v~~~  197 (448)
                      ++++++.|++|||++|+++|++++.
T Consensus        87 ~~~~~~~ValAGPl~nl~la~~~~~  111 (224)
T 3b4r_A           87 PKEGELRIGIAGPLVSFIIGIVLLI  111 (224)
T ss_dssp             CSSSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CccceeeeeeeHHHHHHHHHHHHHH
Confidence            2378999999999999999987654
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2di4_A Zinc protease, cell division protein FTSH homolog; metalloproteinase, hexamer-ring, hydrolase; 2.79A {Aquifex aeolicus} SCOP: a.269.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 448
d2hgaa1103 b.36.1.6 (A:23-125) Uncharacterized protein MTH136 1e-11
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 1e-09
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 4e-08
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 6e-08
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 1e-06
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-06
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 5e-06
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 9e-06
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-05
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 3e-05
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 4e-05
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 9e-05
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 9e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-04
d1sota199 b.36.1.4 (A:255-353) Stress sensor protease DegS, 2e-04
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 2e-04
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 3e-04
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 3e-04
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 7e-04
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 8e-04
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 0.001
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 0.001
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 0.001
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 0.002
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.002
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 0.003
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 103 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: MTH1368 C-terminal domain-like
domain: Uncharacterized protein MTH1368
species: Methanobacterium thermoautotrophicum [TaxId: 145262]

 Score = 58.8 bits (142), Expect = 1e-11
 Identities = 22/101 (21%), Positives = 41/101 (40%), Gaps = 9/101 (8%)

Query: 213 GVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAI-KKSPKRNVLLKV 271
           GV +  V   S AS+  L PG VI S+NG          ++    A+   S    + +  
Sbjct: 4   GVQIDSVVPGSPASK-VLTPGLVIESINGMPTSN-----LTTYSAALKTISVGEVINITT 57

Query: 272 ARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNL 312
            +G    + G  P+        +G++ S ++++   +   L
Sbjct: 58  DQGTFHLKTGRNPNN--SSRAYMGIRTSNHLRVRDSVASVL 96
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.4
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 99.36
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.34
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.22
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 99.21
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 99.21
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.2
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.19
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 99.02
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.91
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.83
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.78
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.77
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.72
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.72
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.71
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.68
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.67
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.65
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.63
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.62
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.62
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.6
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.57
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.56
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.56
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.54
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.53
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.5
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.48
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.47
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 98.45
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.45
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.45
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.45
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.44
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.44
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.44
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.44
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.43
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.43
d1y7na179 Amyloid beta A4 precursor protein-binding family A 98.42
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.42
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.42
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.41
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.4
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.39
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.37
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.36
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.35
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.33
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.32
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.31
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.31
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.3
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 98.29
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.25
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.25
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.25
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.15
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.14
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.08
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.73
d2ce7a1193 Cell division protein FtsH, C-terminal domain {The 91.96
d2di4a1202 Cell division protein FtsH, C-terminal domain {Aqu 88.96
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: HtrA-like serine proteases
domain: Mitochondrial serine protease HtrA2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.40  E-value=4e-13  Score=109.86  Aligned_cols=69  Identities=30%  Similarity=0.515  Sum_probs=64.2

Q ss_pred             CCceeecccCCCChhhhCCCCCCCEEEEECCeecCCCCCCCHHHHHHHHHcCCCCcEEEEEEeCCEEEEEEEeecc
Q 040736          211 FPGVLVPEVRALSAASRDGLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDE  286 (448)
Q Consensus       211 ~~gvvV~~V~~gSpA~~AGL~~GDvIlsInG~~V~~~~~~s~~dl~~~L~~~~g~~V~l~V~R~G~~~~l~v~p~~  286 (448)
                      ..|++|.+|.++|||++|||++||+|++|||++|     ++++|+.+.++  +++++.++|.|+|+..+++++|+.
T Consensus        30 ~~Gv~V~~V~~~spA~~aGl~~GDiI~~ing~~V-----~s~~dl~~~l~--~g~~v~l~v~R~g~~~~~~v~pe~   98 (100)
T d1lcya1          30 QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMV-----QNAEDVYEAVR--TQSQLAVQIRRGRETLTLYVTPEV   98 (100)
T ss_dssp             SSCEEEEEECTTSHHHHHTCCTTCEEEEETTEEC-----CSHHHHHHHHT--TCSSEEEEEEETTEEEEEEECCEE
T ss_pred             CCcEEEEEECCCchHhhcCCCCCcEEEEECCEEc-----CCHHHHHHHhc--CCCEEEEEEEECCEEEEEEEEeec
Confidence            3589999999999999999999999999999999     89999999884  688999999999999999999874
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2di4a1 a.269.1.1 (A:406-607) Cell division protein FtsH, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure