Citrus Sinensis ID: 040744

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MGSLSGIIQRPLIAAAAVAVASASADVSDKFQSFTSPGAEQTDSSVSVSNSIQEFTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAELAKASKPTKTTGSIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCCKSS
ccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccHHHHHHccccHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccccccccccEEEEccccccccccccccccHHHHHHccccccccccEEccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccccccccEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccc
cccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEHHHcccccEEEEEEcccccccccccccccccccccccccHcccHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccHHHHccHcccccHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHcccHHHHHccHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHccc
mgslsgiiQRPLIAAAAVAVASasadvsdkfqsftspgaeqtdssvsVSNSIQEFTSSWVSHISvsklsslnfvtrvqvpvpsisfgvpssghkfipsnlcssvasfpLLVNVYQSAElakaskptkttgsipasysdvlyrwhlpetdaidvsgtsdclamKSRTVVVLLGWLGAKQKHLRKYAEWytskgfhvitfTFPMAEIlsyqvggkaEQNIELLVNHLADCledegknlvfhtfsntgwlTYGAILEKfqnkdpslmgrirgcivdsapvaspdpqvwasgFSAAFLKknsvatkgivytneletdelvgsrasgepkpavTETALLVVLEKFFEVILHLPAVNRRLSDVLGLlssgqpacpqlyiyssadrvipaesVESFIEEQRKAGRevracnfvstphvdhfrndpklYTTQLSQFLEDYVVTCCKSS
MGSLSGIIQRPLIAAAAVAVASASADVSDKFQSFTspgaeqtdssvSVSNSIQEFTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAELakaskptkttgsipaSYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTneletdelvgsrasgepkpAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFvstphvdhfrndPKLYTTQLSQFLEDYVVTCCKSS
MGSLSGIIQRPLIaaaavavasasadvsdKFQSFTSPGAEQTDSSVSVSNSIQEFTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAELAKASKPTKTTGSIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCCKSS
******IIQRPLIAAAAVAVA*********************************FTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAEL************IPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETD**************VTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCC***
********QRPLIAAAAVAVASASADVS*******************************V*********SLNFVTRVQVPV***************************************************************L**********************VVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCC***
MGSLSGIIQRPLIAAA**********************************SIQEFTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAEL***********SIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCCKSS
****SGIIQRPLIAAAAVAVAS**********************************SSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAELAKASKPTKTTGSIPASYSDVLYRWHLPET***************SRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCCKS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLSGIIQRPLIAAAAVAVASASADVSDKFQSFTSPGAEQTDSSVSVSNSIQEFTSSWVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPSNLCSSVASFPLLVNVYQSAELAKASKPTKTTGSIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYVVTCCKSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
Q2TBP5294 Transmembrane protein 53 yes no 0.531 0.795 0.278 7e-18
Q9D0Z3276 Transmembrane protein 53 yes no 0.545 0.869 0.279 1e-17
Q6DHN0281 Transmembrane protein 53 yes no 0.531 0.832 0.266 3e-16
Q6DJC8285 Transmembrane protein 53- N/A no 0.534 0.824 0.267 9e-16
Q6P2H8277 Transmembrane protein 53 yes no 0.236 0.375 0.370 5e-10
Q5PPS7285 Transmembrane protein 53- N/A no 0.238 0.368 0.344 2e-08
>sp|Q2TBP5|TMM53_BOVIN Transmembrane protein 53 OS=Bos taurus GN=TMEM53 PE=2 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 108/273 (39%), Gaps = 39/273 (14%)

Query: 167 VVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGG------KAEQNIEL 220
           +V+LLGW G   K+L KY+  Y  +G  VI +T P   +   +  G       A++ +EL
Sbjct: 37  LVILLGWGGCSDKNLAKYSAIYHKRGCIVIRYTAPWHMVFFSETLGIPSLRVLAQKLLEL 96

Query: 221 LVNHLADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASP 280
           L ++     E E + L+FH FSN G + Y  +LE  Q        R+ G I DS P  S 
Sbjct: 97  LFDY-----EVEKEPLLFHVFSNAGVMLYRYVLELLQTHQRFCHLRVVGTIFDSGPGDS- 150

Query: 281 DPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKF 340
                                      N L     +       P        +   L  F
Sbjct: 151 ---------------------------NLLGALRALAVVLEHRPAALRLLLLVAFTLVAF 183

Query: 341 FEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREV 400
              +L  P      +     L       P+LY+YS AD V+ A  VE  +E +      V
Sbjct: 184 LFHVLLAPLTALFHTHFYDRLLDAASRWPELYLYSRADEVVLARDVERMVEARLAHQVLV 243

Query: 401 RACNFVSTPHVDHFRNDPKLYTTQLSQFLEDYV 433
           R+ +FVS+ HV H R+ P  YTT    F+   V
Sbjct: 244 RSVDFVSSAHVSHLRDYPTYYTTLCINFMHSCV 276

Bos taurus (taxid: 9913)
>sp|Q9D0Z3|TMM53_MOUSE Transmembrane protein 53 OS=Mus musculus GN=Tmem53 PE=2 SV=1 Back     alignment and function description
>sp|Q6DHN0|TMM53_DANRE Transmembrane protein 53 OS=Danio rerio GN=tmem53 PE=2 SV=1 Back     alignment and function description
>sp|Q6DJC8|TM53B_XENLA Transmembrane protein 53-B OS=Xenopus laevis GN=tmem53-b PE=2 SV=1 Back     alignment and function description
>sp|Q6P2H8|TMM53_HUMAN Transmembrane protein 53 OS=Homo sapiens GN=TMEM53 PE=2 SV=1 Back     alignment and function description
>sp|Q5PPS7|TM53A_XENLA Transmembrane protein 53-A OS=Xenopus laevis GN=tmem53-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
225463679442 PREDICTED: transmembrane protein 53 [Vit 0.997 0.993 0.726 1e-176
224081326443 predicted protein [Populus trichocarpa] 1.0 0.993 0.729 1e-173
255544117440 conserved hypothetical protein [Ricinus 0.988 0.988 0.718 1e-168
449464302442 PREDICTED: transmembrane protein 53-like 0.977 0.972 0.658 1e-164
18402437434 uncharacterized protein [Arabidopsis tha 0.975 0.988 0.653 1e-161
356536439435 PREDICTED: transmembrane protein 53-like 0.981 0.993 0.664 1e-157
297830672434 hypothetical protein ARALYDRAFT_479515 [ 0.975 0.988 0.657 1e-157
356574115438 PREDICTED: transmembrane protein 53-like 0.986 0.990 0.651 1e-156
224093978332 predicted protein [Populus trichocarpa] 0.693 0.918 0.790 1e-134
297742759376 unnamed protein product [Vitis vinifera] 0.625 0.731 0.804 1e-132
>gi|225463679|ref|XP_002276066.1| PREDICTED: transmembrane protein 53 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  624 bits (1610), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 321/442 (72%), Positives = 369/442 (83%), Gaps = 3/442 (0%)

Query: 1   MGSLSGIIQRPLIAAAAVAVASASADVSDKFQSFTSPGAEQTDSSVSVSNSIQEFTSSWV 60
           MGS+SGI+QRPLIAA AVAVAS S+D+SDK Q   S     T   +  S + QE  SSWV
Sbjct: 1   MGSMSGILQRPLIAATAVAVASVSSDLSDKLQPLKSSETSSTLKPICDSPA-QESKSSWV 59

Query: 61  SHISVSKLSSLNFVTRVQVPVPSISF-GVPSSGHKFIPSNLCSSVASFPLLVNVYQSAEL 119
           SHIS+SKLS+ +FV+RV+VPVP I++  VP+S   F P+ L SSV S P L+N+YQSAEL
Sbjct: 60  SHISLSKLSNFSFVSRVRVPVPHINYYPVPNSPSGFAPNLLSSSVVSSPTLINLYQSAEL 119

Query: 120 AKASKPTKTTGSIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAKQK 179
           AKA KPT    SIPA  SDVLYRWHLP+ +A DV   SDC ++KSRTVVVLLGWLGA+QK
Sbjct: 120 AKAPKPTTFKHSIPALASDVLYRWHLPDPNACDVLEDSDCSSVKSRTVVVLLGWLGARQK 179

Query: 180 HLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDE-GKNLVF 238
           HL++YAE YTS GFH ITFTFPMAE+LSY+VGGKAEQN++LLVNHLA+ LE+E GKNLVF
Sbjct: 180 HLKRYAELYTSMGFHAITFTFPMAEVLSYKVGGKAEQNVDLLVNHLAEWLEEEHGKNLVF 239

Query: 239 HTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNS 298
           HTFSNTGWL YGAILEKFQ +DPSLMGRI+GCIVDSAPVA+PDPQVWASGFSAAFLK  S
Sbjct: 240 HTFSNTGWLIYGAILEKFQKQDPSLMGRIKGCIVDSAPVAAPDPQVWASGFSAAFLKTRS 299

Query: 299 VATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVL 358
           VATKG +  +E   +E V  +A  EPKPA+TE ALLVVLEKFF+V+L+LP+VNRRLSDVL
Sbjct: 300 VATKGTIRYDESGMEEFVDRKAVAEPKPAITEAALLVVLEKFFQVVLNLPSVNRRLSDVL 359

Query: 359 GLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRNDP 418
           G LS GQP CPQLYIYSSADRVIPA SVE+FIEEQRKAGREVRACNF+STPHVDHFRNDP
Sbjct: 360 GQLSLGQPNCPQLYIYSSADRVIPAGSVETFIEEQRKAGREVRACNFISTPHVDHFRNDP 419

Query: 419 KLYTTQLSQFLEDYVVTCCKSS 440
           KLYT+QL+QFL+DYV+ CCK S
Sbjct: 420 KLYTSQLTQFLDDYVLNCCKCS 441

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224081326|ref|XP_002306371.1| predicted protein [Populus trichocarpa] gi|222855820|gb|EEE93367.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255544117|ref|XP_002513121.1| conserved hypothetical protein [Ricinus communis] gi|223548132|gb|EEF49624.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449464302|ref|XP_004149868.1| PREDICTED: transmembrane protein 53-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|18402437|ref|NP_566652.1| uncharacterized protein [Arabidopsis thaliana] gi|11994772|dbj|BAB03162.1| unnamed protein product [Arabidopsis thaliana] gi|14532502|gb|AAK63979.1| AT3g19970/MZE19_2 [Arabidopsis thaliana] gi|30102458|gb|AAP21147.1| At3g19970/MZE19_2 [Arabidopsis thaliana] gi|332642793|gb|AEE76314.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356536439|ref|XP_003536745.1| PREDICTED: transmembrane protein 53-like [Glycine max] Back     alignment and taxonomy information
>gi|297830672|ref|XP_002883218.1| hypothetical protein ARALYDRAFT_479515 [Arabidopsis lyrata subsp. lyrata] gi|297329058|gb|EFH59477.1| hypothetical protein ARALYDRAFT_479515 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356574115|ref|XP_003555197.1| PREDICTED: transmembrane protein 53-like [Glycine max] Back     alignment and taxonomy information
>gi|224093978|ref|XP_002310056.1| predicted protein [Populus trichocarpa] gi|222852959|gb|EEE90506.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297742759|emb|CBI35393.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
TAIR|locus:2095375434 AT3G19970 "AT3G19970" [Arabido 0.975 0.988 0.630 6.1e-142
TAIR|locus:505006253398 AT2G18245 "AT2G18245" [Arabido 0.593 0.655 0.450 2.7e-59
RGD|1307066276 Tmem53 "transmembrane protein 0.261 0.416 0.355 1.3e-18
MGI|MGI:1916027276 Tmem53 "transmembrane protein 0.261 0.416 0.364 6.7e-18
UNIPROTKB|Q6P2H8277 TMEM53 "Transmembrane protein 0.243 0.386 0.371 1.9e-17
UNIPROTKB|Q2TBP5294 TMEM53 "Transmembrane protein 0.245 0.367 0.345 2.4e-17
ZFIN|ZDB-GENE-040718-384281 tmem53 "transmembrane protein 0.247 0.387 0.339 3.5e-17
WB|WBGene00020402325 T10B11.6.2 [Caenorhabditis ele 0.136 0.184 0.483 2.5e-15
DICTYBASE|DDB_G0278115270 DDB_G0278115 "DUF829 family pr 0.263 0.429 0.264 2e-14
DICTYBASE|DDB_G0285447305 DDB_G0285447 "DUF829 family pr 0.286 0.413 0.294 3.7e-11
TAIR|locus:2095375 AT3G19970 "AT3G19970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1388 (493.7 bits), Expect = 6.1e-142, P = 6.1e-142
 Identities = 280/444 (63%), Positives = 339/444 (76%)

Query:     1 MGSLSGIIQRPLIXXXXXXXXXXXXXXXXKFQSFTS--PGAEQTDSSVSVSNSIQEFTSS 58
             MGSLSGIIQRPL+                +F S  S   G+E    + SVS  +QE  S 
Sbjct:     1 MGSLSGIIQRPLVAAAAVITASVSADVSERFSSLRSLVRGSESEQIAPSVSGLVQEERSL 60

Query:    59 WVSHISVSKLSSLNFVTRVQVPVPSISFGVPSSGHKFIPS-NLCSSVASFPLLVNVYQSA 117
             WVS +S SKL+ L+FV+R+ VPVP++   + S+     PS +L +SV S   L +VYQSA
Sbjct:    61 WVSQVSASKLADLSFVSRICVPVPNVDL-LASN-----PSCSLATSVTSLSALRSVYQSA 114

Query:   118 ELAKASKPTKTTGSIPASYSDVLYRWHLPETDAIDVSGTSDCLAMKSRTVVVLLGWLGAK 177
             ELAKASKP   T        D+ YRWHLPE  A+D+SG+S C++ K+RTVVVLLGWLG+K
Sbjct:   115 ELAKASKPVAFTIGASLVVPDISYRWHLPEPSAVDMSGSSSCVSEKNRTVVVLLGWLGSK 174

Query:   178 QKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDEGK-NL 236
             QKHL+KYA+WYTSKG+HVITFT PM EI+SYQVGGKAE+NIE LVNHLAD L++E K NL
Sbjct:   175 QKHLKKYADWYTSKGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWLDEEQKKNL 234

Query:   237 VFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKK 296
             VFHTFSNTGWLTYGAILEKFQ +D SLMGR++GCIVDSAPVA+ DP VWASGFSAAFLKK
Sbjct:   235 VFHTFSNTGWLTYGAILEKFQKQDSSLMGRVKGCIVDSAPVAAADPTVWASGFSAAFLKK 294

Query:   297 NSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSD 356
             +SVATKG   ++  E++   G   S +PKPA TETALL+VLEKFF VIL+LP VNRRL+D
Sbjct:   295 SSVATKGSA-SSSYESN---GINIS-QPKPAATETALLLVLEKFFAVILNLPKVNRRLAD 349

Query:   357 VLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACNFVSTPHVDHFRN 416
             VL  LS+ QP+CPQLYIYSSADRVIP E VESFI EQRKAG EVRACNF+S+PHVDHFR+
Sbjct:   350 VLDTLSTAQPSCPQLYIYSSADRVIPVEQVESFIVEQRKAGHEVRACNFISSPHVDHFRS 409

Query:   417 DPKLYTTQLSQFLEDYVVTCCKSS 440
             +P+LYT +L+ F+ ++V++CC  S
Sbjct:   410 NPELYTAELNHFMNNFVLSCCHHS 433
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009620 "response to fungus" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
TAIR|locus:505006253 AT2G18245 "AT2G18245" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1307066 Tmem53 "transmembrane protein 53" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916027 Tmem53 "transmembrane protein 53" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P2H8 TMEM53 "Transmembrane protein 53" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBP5 TMEM53 "Transmembrane protein 53" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-384 tmem53 "transmembrane protein 53" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00020402 T10B11.6.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278115 DDB_G0278115 "DUF829 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285447 DDB_G0285447 "DUF829 family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003135001
SubName- Full=Chromosome undetermined scaffold_139, whole genome shotgun sequence; (442 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
pfam05705240 pfam05705, DUF829, Eukaryotic protein of unknown f 1e-68
>gnl|CDD|218708 pfam05705, DUF829, Eukaryotic protein of unknown function (DUF829) Back     alignment and domain information 
 Score =  217 bits (556), Expect = 1e-68
 Identities = 82/270 (30%), Positives = 123/270 (45%), Gaps = 36/270 (13%)

Query: 166 TVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHL 225
            +V+LLGWLGA+ KHL KY++ YT  G  ++  T P  ++L         + +   ++ L
Sbjct: 1   PLVLLLGWLGARPKHLAKYSDLYTRPGPDILVITSPPRDLLWP------TKGLASGLDKL 54

Query: 226 ADCLED----EGKNLVFHTFSNTGWLTYGAILEKFQN--KDPSLMGRIRGCIVDSAPVAS 279
            + L +    E   ++FH FSN G + Y  +L   Q+  K   L+ R++G + DSAP   
Sbjct: 55  LELLSESQRSEYWPILFHVFSNGGPILYLCLLAALQDRYKFGKLLPRVKGQVWDSAP-GI 113

Query: 280 PDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEK 339
                    F+AA  K + VA+                              AL + +  
Sbjct: 114 GHYHGPVGAFAAALPKLSRVASHKTRALL-----------------------ALALRVTL 150

Query: 340 FFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGRE 399
              +IL LP+V       L  L++    CPQLY+YS AD VIP   VE  I+E R+ G  
Sbjct: 151 LALLILFLPSVASHSRRSLNDLANTPLPCPQLYLYSKADEVIPWRDVERHIDEARQRGVS 210

Query: 400 VRACNFVSTPHVDHFRNDPKLYTTQLSQFL 429
           V +  F  +PHV H R  P  Y  ++ +F 
Sbjct: 211 VTSVCFEDSPHVGHMRKHPDRYWPKVVEFW 240

This family consists of several uncharacterized eukaryotic proteins. Length = 240

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 100.0
KOG2521350 consensus Uncharacterized conserved protein [Funct 99.95
PRK13604307 luxD acyl transferase; Provisional 99.46
COG1647243 Esterase/lipase [General function prediction only] 99.27
PLN02652395 hydrolase; alpha/beta fold family protein 99.23
PLN02298330 hydrolase, alpha/beta fold family protein 99.22
PHA02857276 monoglyceride lipase; Provisional 99.21
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.21
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.2
PRK10566249 esterase; Provisional 99.19
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.16
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.16
PLN02385349 hydrolase; alpha/beta fold family protein 99.15
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.14
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.13
PRK10749330 lysophospholipase L2; Provisional 99.12
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.12
PLN02511388 hydrolase 99.1
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.07
PRK10985324 putative hydrolase; Provisional 99.05
PRK11460232 putative hydrolase; Provisional 99.04
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.01
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.01
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.01
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.99
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 98.97
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.96
PRK03592295 haloalkane dehalogenase; Provisional 98.95
PLN02824294 hydrolase, alpha/beta fold family protein 98.93
PLN02442283 S-formylglutathione hydrolase 98.92
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 98.91
PRK10673255 acyl-CoA esterase; Provisional 98.91
PRK10349256 carboxylesterase BioH; Provisional 98.9
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.88
PLN02965255 Probable pheophorbidase 98.87
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 98.86
PLN02679360 hydrolase, alpha/beta fold family protein 98.86
PLN02894402 hydrolase, alpha/beta fold family protein 98.84
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.84
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.82
PRK06489360 hypothetical protein; Provisional 98.8
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.79
COG2267298 PldB Lysophospholipase [Lipid metabolism] 98.79
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 98.79
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 98.79
PRK03204286 haloalkane dehalogenase; Provisional 98.75
PLN02578354 hydrolase 98.74
PLN02211273 methyl indole-3-acetate methyltransferase 98.74
PRK00870302 haloalkane dehalogenase; Provisional 98.71
PRK11071190 esterase YqiA; Provisional 98.7
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 98.7
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.69
PRK05855 582 short chain dehydrogenase; Validated 98.64
KOG1838409 consensus Alpha/beta hydrolase [General function p 98.63
PRK08775343 homoserine O-acetyltransferase; Provisional 98.61
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 98.6
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 98.56
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 98.56
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 98.52
COG0412236 Dienelactone hydrolase and related enzymes [Second 98.52
KOG1552258 consensus Predicted alpha/beta hydrolase [General 98.5
PRK00175379 metX homoserine O-acetyltransferase; Provisional 98.48
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.47
PRK10162318 acetyl esterase; Provisional 98.46
KOG1455313 consensus Lysophospholipase [Lipid transport and m 98.37
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.37
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.33
PRK07581339 hypothetical protein; Validated 98.28
COG0400207 Predicted esterase [General function prediction on 98.23
PLN02872395 triacylglycerol lipase 98.23
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 98.17
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 98.12
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 98.08
PRK10115686 protease 2; Provisional 98.07
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 98.05
PRK07868 994 acyl-CoA synthetase; Validated 98.04
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 97.92
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 97.84
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 97.8
KOG2521350 consensus Uncharacterized conserved protein [Funct 97.74
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 97.69
PF10503220 Esterase_phd: Esterase PHB depolymerase 97.56
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 97.55
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.54
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 97.53
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 97.47
PLN00021313 chlorophyllase 97.3
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 97.29
KOG4667269 consensus Predicted esterase [Lipid transport and 97.21
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 97.21
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 97.17
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 97.12
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 97.05
COG0657312 Aes Esterase/lipase [Lipid metabolism] 97.05
COG2945210 Predicted hydrolase of the alpha/beta superfamily 96.98
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 96.89
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 96.73
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 96.73
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 96.69
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 96.62
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.48
PRK06765389 homoserine O-acetyltransferase; Provisional 96.45
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 96.41
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 96.4
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 96.39
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.29
COG1073299 Hydrolases of the alpha/beta superfamily [General 96.01
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 95.68
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 95.57
COG4757281 Predicted alpha/beta hydrolase [General function p 95.46
KOG3043242 consensus Predicted hydrolase related to dienelact 95.21
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 95.08
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 95.06
COG3208244 GrsT Predicted thioesterase involved in non-riboso 95.05
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.91
KOG2112206 consensus Lysophospholipase [Lipid transport and m 94.86
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 94.83
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 94.64
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 94.38
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 94.37
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 94.12
COG4099387 Predicted peptidase [General function prediction o 93.72
KOG2984277 consensus Predicted hydrolase [General function pr 92.84
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 92.55
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 92.48
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 91.76
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 91.18
COG1505648 Serine proteases of the peptidase family S9A [Amin 90.83
KOG2564343 consensus Predicted acetyltransferases and hydrola 90.32
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 89.45
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 89.14
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 89.08
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 85.7
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 85.12
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 85.05
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 84.86
COG1075336 LipA Predicted acetyltransferases and hydrolases w 84.73
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 84.58
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 82.98
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 82.79
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 81.81
PF00135 535 COesterase: Carboxylesterase family The prints ent 81.81
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 81.64
PRK04940180 hypothetical protein; Provisional 81.61
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 81.52
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information 
Probab=100.00  E-value=6.6e-46  Score=357.61  Aligned_cols=234  Identities=35%  Similarity=0.580  Sum_probs=168.0

Q ss_pred             eEEEEeeecCCchhhHHHHHHHHHHCCCeEEEEecCCCceeecccchhhhHHHHHHHHHHHHHhhhc----CCcEEEEEe
Q 040744          166 TVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNHLADCLEDE----GKNLVFHTF  241 (440)
Q Consensus       166 plVVLlGW~GA~~khl~KYa~iY~~~G~nVL~~~~p~~~il~~~~g~k~~k~l~~l~~~i~~~l~~~----~~~Il~H~F  241 (440)
                      |||||+||+||++||++||+++|++.|+++|+++.|..+++...      +.++.+++.+.+.+.+.    ..+|+||+|
T Consensus         1 plvvl~gW~gA~~~hl~KY~~~Y~~~g~~il~~~~~~~~~~~~~------~~~~~~~~~l~~~l~~~~~~~~~~il~H~F   74 (240)
T PF05705_consen    1 PLVVLLGWMGAKPKHLAKYSDLYQDPGFDILLVTSPPADFFWPS------KRLAPAADKLLELLSDSQSASPPPILFHSF   74 (240)
T ss_pred             CEEEEEeCCCCCHHHHHHHHHHHHhcCCeEEEEeCCHHHHeeec------cchHHHHHHHHHHhhhhccCCCCCEEEEEE
Confidence            79999999999999999999999999999999999987776543      12233444444444433    249999999


Q ss_pred             cccHHHHHHHHHHHHhhcC--CCCccCceEEEecCCCCCCCChhhhhhhhhHHhhccccccccccccccccchhhhhccc
Q 040744          242 SNTGWLTYGAILEKFQNKD--PSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSR  319 (440)
Q Consensus       242 SnGG~~~~~~Ll~~l~~~~--~~l~~~VkG~I~DSaPg~~~~~~~~a~gfsaa~l~~~s~~~~~~~~~~~~~l~~~v~~~  319 (440)
                      ||||++.+.++++.+++.+  ..+.++|+|+||||||+.... .....++++++.+...              ..++.  
T Consensus        75 SnGG~~~~~~l~~~~~~~~~~~~~~~~i~g~I~DS~P~~~~~-~~~~~~~~~~~~~~~~--------------~~~~~--  137 (240)
T PF05705_consen   75 SNGGSFLYSQLLEAYQSRKKFGKLLPRIKGIIFDSCPGIPTY-SSSARAFSAALPKSSP--------------RWFVP--  137 (240)
T ss_pred             ECchHHHHHHHHHHHHhcccccccccccceeEEeCCCCcccc-ccHHHHHHHHcCccch--------------hhHHH--
Confidence            9999999999998887765  455677999999999998642 2233344433211100              00000  


Q ss_pred             cCCCCCchHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhhcccCCCCCCEEEEEcCCCCccCHHHHHHHHHHHHHcCCc
Q 040744          320 ASGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGRE  399 (440)
Q Consensus       320 ~~~~p~~~~~~~~ll~~l~~~f~~~~~~p~~~~rl~~~~~~l~~~~~~~P~LYIYS~aD~lIP~~dVE~~~e~~r~~G~~  399 (440)
                           ...+...++  .+..+.......+.......+.++.+...+.++|+|||||++|++|||++||+|++++|++|.+
T Consensus       138 -----~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~lylYS~~D~l~~~~~ve~~~~~~~~~G~~  210 (240)
T PF05705_consen  138 -----LWPLLQFLL--RLSIISYFIFGYPDVQEYYRRALNDFANSPSRCPRLYLYSKADPLIPWRDVEEHAEEARRKGWD  210 (240)
T ss_pred             -----HHHHHHHHH--HHHHHHHHHhcCCcHHHHHHHHHhhhhcCCCCCCeEEecCCCCcCcCHHHHHHHHHHHHHcCCe
Confidence                 000111000  1111222222333333333344555556777899999999999999999999999999999999


Q ss_pred             eEEEEeCCCccccccccChHHHHHHHHHHH
Q 040744          400 VRACNFVSTPHVDHFRNDPKLYTTQLSQFL  429 (440)
Q Consensus       400 V~~~~F~~S~HV~H~R~~PeeY~~aV~~FL  429 (440)
                      |+.++|++|+||+|+|.||+|||++|++||
T Consensus       211 V~~~~f~~S~HV~H~r~~p~~Y~~~v~~fw  240 (240)
T PF05705_consen  211 VRAEKFEDSPHVAHLRKHPDRYWRAVDEFW  240 (240)
T ss_pred             EEEecCCCCchhhhcccCHHHHHHHHHhhC
Confidence            999999999999999999999999999997

>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.64
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.54
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.46
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.43
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.42
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.41
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.4
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.4
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.39
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.39
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.39
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.39
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.38
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.38
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.38
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.38
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.38
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.38
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.37
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.36
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.36
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.36
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.35
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.35
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.35
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.34
3h04_A275 Uncharacterized protein; protein with unknown func 99.34
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.34
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.34
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.33
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.33
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.33
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.33
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.33
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.32
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.31
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.31
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.31
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.31
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.3
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.3
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.3
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.29
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.28
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.28
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.28
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.27
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.26
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.26
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.25
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.25
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.25
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.24
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.24
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.24
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.23
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.23
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.23
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.23
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.23
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.22
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.22
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.22
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.22
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.22
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.21
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.21
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.21
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.21
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.21
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.21
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.2
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.2
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.2
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.2
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.19
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.19
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.18
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.18
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.18
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.18
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.18
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.17
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.17
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.17
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.17
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.17
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.17
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.17
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.16
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.16
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.16
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.16
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.15
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.15
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.15
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.15
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.15
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.14
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.14
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.14
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.14
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.13
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.13
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.13
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.12
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.12
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.12
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.11
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.11
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.11
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.11
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.11
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.11
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.11
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.1
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.1
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.09
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.09
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.09
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.08
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.08
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.08
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.08
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.06
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.06
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.06
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.06
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.05
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.05
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.05
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.04
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.04
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.03
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.03
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.03
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.01
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.01
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.0
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.99
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.98
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 98.98
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.97
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.97
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.97
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.97
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.97
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.96
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 98.95
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.94
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.94
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.92
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 98.92
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 98.92
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 98.91
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.9
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.89
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 98.89
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 98.88
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 98.4
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.88
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.88
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.86
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.83
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.82
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.8
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.79
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.78
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 98.78
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 98.78
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.78
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 98.77
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.76
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 98.75
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 98.71
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.69
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.68
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.64
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.64
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 98.57
3lp5_A250 Putative cell surface hydrolase; structural genom 98.56
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 98.54
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.53
1kez_A300 Erythronolide synthase; polyketide synthase, modul 98.52
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.51
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.48
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 98.42
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.42
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.38
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.22
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 98.2
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 98.19
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.06
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 98.04
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 98.03
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 97.85
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 97.8
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 97.78
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.77
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 97.76
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.72
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 97.71
3nuz_A398 Putative acetyl xylan esterase; structural genomic 97.65
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 97.65
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 97.65
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 97.64
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 97.62
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 97.6
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 97.48
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.48
3tej_A329 Enterobactin synthase component F; nonribosomal pe 97.46
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 97.43
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 97.43
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 97.34
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 97.31
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 97.26
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 97.13
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 96.92
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 96.9
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 96.89
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 96.75
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 96.44
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 96.28
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 95.71
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 95.16
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 95.03
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 94.69
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 94.54
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 94.27
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 93.67
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 93.64
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 92.81
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 92.68
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 92.27
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 92.04
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 91.99
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 91.02
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 87.82
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 86.09
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 85.86
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 85.67
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 83.29
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 82.22
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 81.8
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
Probab=99.64  E-value=1.1e-14  Score=140.05  Aligned_cols=229  Identities=22%  Similarity=0.243  Sum_probs=132.7

Q ss_pred             CCCeEEEEeeecCCchhhHHHHHHHHHHCCCeEEEEecCCCceeecc--cchhhhHHHHHHHHHHHHHhhhcCCcEEEEE
Q 040744          163 KSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQ--VGGKAEQNIELLVNHLADCLEDEGKNLVFHT  240 (440)
Q Consensus       163 ~~~plVVLlGW~GA~~khl~KYa~iY~~~G~nVL~~~~p~~~il~~~--~g~k~~k~l~~l~~~i~~~l~~~~~~Il~H~  240 (440)
                      +...||++|||.|++ ......++.+.++||+|+.++.|-.. .+..  .....+..++++.+.+ +++++..+++++-|
T Consensus        50 ~~~~VlllHG~~~s~-~~~~~la~~La~~Gy~Via~Dl~GhG-~S~~~~~~~~~~~~~~d~~~~~-~~l~~~~~~v~lvG  126 (281)
T 4fbl_A           50 SRIGVLVSHGFTGSP-QSMRFLAEGFARAGYTVATPRLTGHG-TTPAEMAASTASDWTADIVAAM-RWLEERCDVLFMTG  126 (281)
T ss_dssp             SSEEEEEECCTTCCG-GGGHHHHHHHHHTTCEEEECCCTTSS-SCHHHHHTCCHHHHHHHHHHHH-HHHHHHCSEEEEEE
T ss_pred             CCceEEEECCCCCCH-HHHHHHHHHHHHCCCEEEEECCCCCC-CCCccccCCCHHHHHHHHHHHH-HHHHhCCCeEEEEE
Confidence            345699999999977 45777889999999999999987311 0100  0001112223333333 34444567999999


Q ss_pred             ecccHHHHHHHHHHHHhhcCCCCccCceEEEecCCCCCCCChhhhhhhhhHHhhccccccccccccccccchhhhhcccc
Q 040744          241 FSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSRA  320 (440)
Q Consensus       241 FSnGG~~~~~~Ll~~l~~~~~~l~~~VkG~I~DSaPg~~~~~~~~a~gfsaa~l~~~s~~~~~~~~~~~~~l~~~v~~~~  320 (440)
                      +||||.+++...    . .   .+++|+++|+-+++.....+......+.    ........+....    +.. .....
T Consensus       127 ~S~GG~ia~~~a----~-~---~p~~v~~lvl~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~----~~~-~~~~~  189 (281)
T 4fbl_A          127 LSMGGALTVWAA----G-Q---FPERFAGIMPINAALRMESPDLAALAFN----PDAPAELPGIGSD----IKA-EGVKE  189 (281)
T ss_dssp             ETHHHHHHHHHH----H-H---STTTCSEEEEESCCSCCCCHHHHHHHTC----TTCCSEEECCCCC----CSS-TTCCC
T ss_pred             ECcchHHHHHHH----H-h---CchhhhhhhcccchhcccchhhHHHHHh----HhhHHhhhcchhh----hhh-HHHHH
Confidence            999999874222    1 1   1368999999998776543322111111    0000000000000    000 00000


Q ss_pred             CCCCCchHHHHHHHHHHHHHHHHHhhhhhhhhhhhhhhhhcccCCCCCCEEEEEcCCCCccCHHHHHHHHHHHHHcCCce
Q 040744          321 SGEPKPAVTETALLVVLEKFFEVILHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREV  400 (440)
Q Consensus       321 ~~~p~~~~~~~~ll~~l~~~f~~~~~~p~~~~rl~~~~~~l~~~~~~~P~LYIYS~aD~lIP~~dVE~~~e~~r~~G~~V  400 (440)
                      ...+..+...  +. .+..+..      ...       ..+  ...++|.|+|+|+.|.++|.+..+++++...  +.++
T Consensus       190 ~~~~~~~~~~--~~-~~~~~~~------~~~-------~~l--~~i~~P~Lii~G~~D~~v~~~~~~~l~~~l~--~~~~  249 (281)
T 4fbl_A          190 LAYPVTPVPA--IK-HLITIGA------VAE-------MLL--PRVKCPALIIQSREDHVVPPHNGELIYNGIG--STEK  249 (281)
T ss_dssp             CCCSEEEGGG--HH-HHHHHHH------HHH-------HHG--GGCCSCEEEEEESSCSSSCTHHHHHHHHHCC--CSSE
T ss_pred             hhhccCchHH--HH-HHHHhhh------hcc-------ccc--cccCCCEEEEEeCCCCCcCHHHHHHHHHhCC--CCCc
Confidence            0001111100  00 0111100      000       112  2346899999999999999999999887542  3468


Q ss_pred             EEEEeCCCccccccccChHHHHHHHHHHHHH
Q 040744          401 RACNFVSTPHVDHFRNDPKLYTTQLSQFLED  431 (440)
Q Consensus       401 ~~~~F~~S~HV~H~R~~PeeY~~aV~~FL~~  431 (440)
                      +.+.++++.|.-++-.+|+++.+.|.+||++
T Consensus       250 ~l~~~~~~gH~~~~e~~~e~v~~~i~~FL~~  280 (281)
T 4fbl_A          250 ELLWLENSYHVATLDNDKELILERSLAFIRK  280 (281)
T ss_dssp             EEEEESSCCSCGGGSTTHHHHHHHHHHHHHT
T ss_pred             EEEEECCCCCcCccccCHHHHHHHHHHHHHh
Confidence            8899999999988888899999999999985
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 5e-05
d1va4a_271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 3e-04
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 6e-04
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 6e-04
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 0.003
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Haloperoxidase
domain: Gamma-lactamase
species: Aureobacterium sp. [TaxId: 51671]

 Score = 42.6 bits (98), Expect = 5e-05
 Identities = 44/268 (16%), Positives = 82/268 (30%), Gaps = 15/268 (5%)

Query: 165 RTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSYQVGGKAEQNIELLVNH 224
           + VV++ G+         +      ++G+ VIT+        S    G         ++ 
Sbjct: 24  QPVVLIHGYPLDGH-SWERQTRELLAQGYRVITYDRRGFGGSSKVNTGYDYDTFAADLHT 82

Query: 225 LADCLEDEGKNLVFHTFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQV 284
           + + L+     LV  +        Y A     +    + +  +   +V         PQ 
Sbjct: 83  VLETLDLRDVVLVGFSMGTGELARYVARYGHERVAKLAFLASLEPFLVQRDDNPEGVPQE 142

Query: 285 WASGFSAAFLKKNSVATKGIVYTNELETDELVGSRASGEPKPAVTETALLVVLEKFFEVI 344
              G  AA  K +  A     Y N    DE +GSR S +        A+       + V+
Sbjct: 143 VFDGIEAA-AKGDRFAWFTDFYKNFYNLDENLGSRISEQAVTGSWNVAIGSAPVAAYAVV 201

Query: 345 LHLPAVNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRKAGREVRACN 404
                  R   +            P L ++ + D ++P ++        R+  + V   +
Sbjct: 202 PAWIEDFRSDVEA-----VRAAGKPTLILHGTKDNILPIDAT------ARRFHQAVPEAD 250

Query: 405 FVSTPHVDHF--RNDPKLYTTQLSQFLE 430
           +V      H             L  FL 
Sbjct: 251 YVEVEGAPHGLLWTHADEVNAALKTFLA 278
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.58
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.47
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.43
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.4
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.39
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.37
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.37
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.36
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.34
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.33
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.31
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.3
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.29
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.28
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.27
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.27
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.27
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.26
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.25
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.25
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.23
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.23
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.23
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.22
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.16
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.13
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.13
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.12
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.09
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.09
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.08
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.08
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.08
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.07
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.07
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.06
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.05
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.03
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.02
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.0
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 98.9
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.89
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 98.88
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.73
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 98.69
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.66
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.63
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 98.61
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 98.56
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 98.53
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 98.48
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.32
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 98.26
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 98.22
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.04
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.0
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.93
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.85
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.69
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.64
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 97.59
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.19
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 97.14
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 96.93
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.89
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.74
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 96.68
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 96.49
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 96.42
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 95.8
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 95.72
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 95.72
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.67
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 95.63
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 94.44
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 94.05
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 93.32
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 91.97
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 91.36
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 89.76
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 88.96
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 87.41
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 86.54
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 85.97
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 84.75
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 82.11
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 80.56
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/lipase
domain: Carboxylesterase Est
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=99.58  E-value=4.4e-14  Score=123.78  Aligned_cols=226  Identities=15%  Similarity=0.184  Sum_probs=125.5

Q ss_pred             CCCCeEEEEeeecCCchhhHHHHHHHHHHCCCeEEEEecCCCceeec-ccchhhhHHHHHHHHHHHHHhhh-cCCcEEEE
Q 040744          162 MKSRTVVVLLGWLGAKQKHLRKYAEWYTSKGFHVITFTFPMAEILSY-QVGGKAEQNIELLVNHLADCLED-EGKNLVFH  239 (440)
Q Consensus       162 ~~~~plVVLlGW~GA~~khl~KYa~iY~~~G~nVL~~~~p~~~il~~-~~g~k~~k~l~~l~~~i~~~l~~-~~~~Il~H  239 (440)
                      ++.++||++|||.|+. ......++.+.++||+|++++.|-...-.. ..........++....+ ..++. ...++++.
T Consensus         9 ~~~~~vvliHG~~~~~-~~~~~l~~~L~~~G~~v~~~D~~G~G~s~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~   86 (242)
T d1tqha_           9 AGERAVLLLHGFTGNS-ADVRMLGRFLESKGYTCHAPIYKGHGVPPEELVHTGPDDWWQDVMNGY-EFLKNKGYEKIAVA   86 (242)
T ss_dssp             CSSCEEEEECCTTCCT-HHHHHHHHHHHHTTCEEEECCCTTSSSCHHHHTTCCHHHHHHHHHHHH-HHHHHHTCCCEEEE
T ss_pred             CCCCeEEEECCCCCCH-HHHHHHHHHHHHCCCEEEEEeCCCCccccccccccchhHHHHHHHHHH-hhhhhcccCceEEE
Confidence            3457999999999877 567778888889999999999874211000 00001111112222222 22222 36799999


Q ss_pred             EecccHHHHHHHHHHHHhhcCCCCccCceEEEecCCCCCCCChhhhhhhhhHHhhccccccccccccccccchhhhhccc
Q 040744          240 TFSNTGWLTYGAILEKFQNKDPSLMGRIRGCIVDSAPVASPDPQVWASGFSAAFLKKNSVATKGIVYTNELETDELVGSR  319 (440)
Q Consensus       240 ~FSnGG~~~~~~Ll~~l~~~~~~l~~~VkG~I~DSaPg~~~~~~~~a~gfsaa~l~~~s~~~~~~~~~~~~~l~~~v~~~  319 (440)
                      |+||||..++.     +....     +.+..++-+++............+... ...               ....... 
T Consensus        87 G~S~Gg~~~~~-----~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~---------------~~~~~~~-  139 (242)
T d1tqha_          87 GLSLGGVFSLK-----LGYTV-----PIEGIVTMCAPMYIKSEETMYEGVLEY-ARE---------------YKKREGK-  139 (242)
T ss_dssp             EETHHHHHHHH-----HHTTS-----CCSCEEEESCCSSCCCHHHHHHHHHHH-HHH---------------HHHHHTC-
T ss_pred             EcchHHHHhhh-----hcccC-----cccccccccccccccchhHHHHHHHHH-HHH---------------Hhhhccc-
Confidence            99999997632     22222     234455556565543222111111000 000               0000000 


Q ss_pred             cCCCCCchHHHHHHHHHHHHHHHHHhhhhh----hhhhhhhhhhhcccCCCCCCEEEEEcCCCCccCHHHHHHHHHHHHH
Q 040744          320 ASGEPKPAVTETALLVVLEKFFEVILHLPA----VNRRLSDVLGLLSSGQPACPQLYIYSSADRVIPAESVESFIEEQRK  395 (440)
Q Consensus       320 ~~~~p~~~~~~~~ll~~l~~~f~~~~~~p~----~~~rl~~~~~~l~~~~~~~P~LYIYS~aD~lIP~~dVE~~~e~~r~  395 (440)
                           ....       ..............    ...........+  ....+|.|+|+|+.|.++|.+..+++++..  
T Consensus       140 -----~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~p~lii~g~~D~~~~~~~~~~~~~~~--  203 (242)
T d1tqha_         140 -----SEEQ-------IEQEMEKFKQTPMKTLKALQELIADVRDHL--DLIYAPTFVVQARHDEMINPDSANIIYNEI--  203 (242)
T ss_dssp             -----CHHH-------HHHHHHHHTTSCCTTHHHHHHHHHHHHHTG--GGCCSCEEEEEETTCSSSCTTHHHHHHHHC--
T ss_pred             -----hhhh-------HHHHHhhhhhhccchhhccccccccccccc--ceeccccceeecccCCccCHHHHHHHHHHc--
Confidence                 0000       00000000000000    000000111112  334689999999999999999999998754  


Q ss_pred             cCCceEEEEeCCCccccccccChHHHHHHHHHHHHHH
Q 040744          396 AGREVRACNFVSTPHVDHFRNDPKLYTTQLSQFLEDY  432 (440)
Q Consensus       396 ~G~~V~~~~F~~S~HV~H~R~~PeeY~~aV~~FL~~~  432 (440)
                      ++.+++.+.++++.|.-|+-.+|+++.+.|.+|+++.
T Consensus       204 ~~~~~~~~~~~~~gH~~~~~~~~~~~~~~i~~Fl~~l  240 (242)
T d1tqha_         204 ESPVKQIKWYEQSGHVITLDQEKDQLHEDIYAFLESL  240 (242)
T ss_dssp             CCSSEEEEEETTCCSSGGGSTTHHHHHHHHHHHHHHS
T ss_pred             CCCCcEEEEECCCCCcCccccCHHHHHHHHHHHHHhC
Confidence            2346889999999999998888999999999999874
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure