Citrus Sinensis ID: 040772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MNLCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
ccccccHHHHHHHccccHHcccccccccccccEEEEcHHHHHHHHHHHccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccEEEccccccEEEEEEEHHHHHHccccccccHHHHHHHHc
ccccccHHHHHHHcccccccccccccccccccEEEccHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHcccccccccccccEEEEEcccccccccccEEEEEcccccEEEEEEcHHHHHccccccccccccEEEcc
mnlcasiggifnnlslpfnkvkansatYMAADLVSVGDSWLSFAIKErlieptagaedqdwfkcLSHKWKSFYLFVYLLLFALTKSQVYLrrndageidprceiwaapyrwGTMVIAYQKSKFRKHNLALIEFDgkryrili
MNLCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIeptagaedqDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKskfrkhnlaliefdgkryrili
MNLCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSfylfvylllfalTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
**LCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRI**
*****SIGGIFNN*******************LVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQV**********DPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
MNLCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
**LCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLCASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFRKHNLALIEFDGKRYRILI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
224074577 424 predicted protein [Populus trichocarpa] 0.781 0.261 0.562 1e-32
12322546 526 hypothetical protein [Arabidopsis thalia 0.760 0.205 0.577 3e-31
255557729 507 transporter, putative [Ricinus communis] 0.795 0.222 0.536 6e-31
356559069 552 PREDICTED: uncharacterized protein LOC10 0.781 0.201 0.515 2e-30
449455671 549 PREDICTED: uncharacterized protein LOC10 0.781 0.202 0.531 3e-30
225427562 553 PREDICTED: uncharacterized protein LOC10 0.802 0.206 0.519 5e-30
30692516 524 putrescine-binding periplasmic protein-l 0.746 0.202 0.560 7e-30
28393765 524 unknown protein [Arabidopsis thaliana] 0.746 0.202 0.560 7e-30
147822062 875 hypothetical protein VITISV_021806 [Viti 0.901 0.146 0.503 2e-29
356560607 508 PREDICTED: uncharacterized protein LOC10 0.781 0.218 0.507 2e-29
>gi|224074577|ref|XP_002304393.1| predicted protein [Populus trichocarpa] gi|222841825|gb|EEE79372.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 86/128 (67%), Gaps = 17/128 (13%)

Query: 5   ASIGGIFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKC 64
            S+  IF+++S  FNK      + +A+D+VSVGDSWLSFAIK  +IEP  G E+QDWFK 
Sbjct: 59  GSLENIFSDISASFNKRNIGPMSTVASDIVSVGDSWLSFAIKNAIIEPVRGVEEQDWFKG 118

Query: 65  LSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKFR 124
           LS KWK                 VYLRRN  GEIDP  EIWAAPYRWG+MVIAY+KSKF+
Sbjct: 119 LSDKWK-----------------VYLRRNHEGEIDPEGEIWAAPYRWGSMVIAYKKSKFQ 161

Query: 125 KHNLALIE 132
           +H LA IE
Sbjct: 162 EHKLAPIE 169

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|12322546|gb|AAG51275.1|AC027135_16 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255557729|ref|XP_002519894.1| transporter, putative [Ricinus communis] gi|223540940|gb|EEF42498.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356559069|ref|XP_003547824.1| PREDICTED: uncharacterized protein LOC100781794 [Glycine max] Back     alignment and taxonomy information
>gi|449455671|ref|XP_004145575.1| PREDICTED: uncharacterized protein LOC101211357 [Cucumis sativus] gi|449485058|ref|XP_004157059.1| PREDICTED: uncharacterized protein LOC101230567 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225427562|ref|XP_002266662.1| PREDICTED: uncharacterized protein LOC100242504 [Vitis vinifera] gi|296085502|emb|CBI29234.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30692516|ref|NP_174426.2| putrescine-binding periplasmic protein-like protein [Arabidopsis thaliana] gi|51536594|gb|AAU05535.1| At1g31410 [Arabidopsis thaliana] gi|332193231|gb|AEE31352.1| putrescine-binding periplasmic protein-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|28393765|gb|AAO42292.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|147822062|emb|CAN68081.1| hypothetical protein VITISV_021806 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356560607|ref|XP_003548582.1| PREDICTED: uncharacterized protein LOC100809061 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
TAIR|locus:2206194 524 AT1G31410 [Arabidopsis thalian 0.429 0.116 0.622 6.2e-30
TAIR|locus:2206194 AT1G31410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 6.2e-30, Sum P(2) = 6.2e-30
 Identities = 38/61 (62%), Positives = 46/61 (75%)

Query:    10 IFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKW 69
             IF +LS P    K  +A+  AAD++S+GDSWLSFAIKE+LIEP  G EDQDW+K LS KW
Sbjct:   157 IFFDLSKPSKNGKKGAASTAAADMISIGDSWLSFAIKEKLIEPMKGIEDQDWYKGLSDKW 216

Query:    70 K 70
             K
Sbjct:   217 K 217
GO:0005215 "transporter activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.III.2099.1
hypothetical protein (412 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
COG0687 363 COG0687, PotD, Spermidine/putrescine-binding perip 5e-04
>gnl|CDD|223759 COG0687, PotD, Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
 Score = 38.6 bits (90), Expect = 5e-04
 Identities = 29/114 (25%), Positives = 44/114 (38%), Gaps = 28/114 (24%)

Query: 10  IFNNLSLPFNKVKANSATYMAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKW 69
            F++      K+KA    Y   D+V     +++  IKE L++P       D  K L + W
Sbjct: 63  TFDSNEEMLAKLKAGGGGY---DVVVPSGYFVARLIKEGLLQPL------DKSK-LPN-W 111

Query: 70  KSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPYRWGTMVIAYQKSKF 123
           K+           L    +   + D G        ++ PY WGT  IAY   K 
Sbjct: 112 KN-----------LDPEFLNPPKFDPGNK------YSVPYFWGTTGIAYNTDKV 148

Length = 363

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
COG0687 363 PotD Spermidine/putrescine-binding periplasmic pro 99.83
PRK09501 348 potD spermidine/putrescine ABC transporter peripla 99.64
PRK10682 370 putrescine transporter subunit: periplasmic-bindin 99.64
TIGR03227 367 PhnS 2-aminoethylphosphonate ABC transporter, peri 99.13
PF13343 242 SBP_bac_6: Bacterial extracellular solute-binding 99.11
TIGR01276 309 thiB thiamine ABC transporter, periplasmic binding 99.04
PF13416 281 SBP_bac_8: Bacterial extracellular solute-binding 99.03
PRK11622 401 hypothetical protein; Provisional 99.0
TIGR03850 437 bind_CPR_0540 carbohydrate ABC transporter substra 98.95
PRK15046 349 2-aminoethylphosphonate ABC transporter substrate- 98.94
TIGR03261 334 phnS2 putative 2-aminoethylphosphonate ABC transpo 98.92
TIGR01254 304 sfuA ABC transporter periplasmic binding protein, 98.92
PRK09474 396 malE maltose ABC transporter periplasmic protein; 98.88
PRK11205 330 tbpA thiamine transporter substrate binding subuni 98.86
TIGR03851 450 chitin_NgcE carbohydrate ABC transporter, N-acetyl 98.76
PRK10974 438 glycerol-3-phosphate transporter periplasmic bindi 98.68
PF01547 315 SBP_bac_1: Bacterial extracellular solute-binding 98.61
COG1653 433 UgpB ABC-type sugar transport system, periplasmic 98.51
COG2182 420 MalE Maltose-binding periplasmic proteins/domains 98.33
PF02030 493 Lipoprotein_8: Hypothetical lipoprotein (MG045 fam 98.22
COG4143 336 TbpA ABC-type thiamine transport system, periplasm 97.37
COG1840 299 AfuA ABC-type Fe3+ transport system, periplasmic c 97.01
COG4134 384 ABC-type uncharacterized transport system, peripla 95.14
TIGR00971 315 3a0106s03 sulfate/thiosulfate-binding protein. Thi 95.05
PRK10852 338 thiosulfate transporter subunit; Provisional 93.81
PRK10752 329 sulfate transporter subunit; Provisional 90.28
PF13531 230 SBP_bac_11: Bacterial extracellular solute-binding 90.17
PRK10677 257 modA molybdate transporter periplasmic protein; Pr 82.74
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.83  E-value=9.4e-21  Score=159.79  Aligned_cols=84  Identities=25%  Similarity=0.412  Sum_probs=74.4

Q ss_pred             cceEEEeChHHHHHHHHccccccCCCCcccchhhhcChhHHHHHHHHHHHHHHhhhhHHHHhhcCCCCcCCCCCeeeeee
Q 040772           30 AADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAPY  109 (142)
Q Consensus        30 ~~DvV~~sd~~l~~~i~~gLlepLD~s~l~n~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dp~g~~yavPY  109 (142)
                      +||||++++.++.+++++||++|||.++|+|| ++|++.++                 ..     . ..|+ |+.|+|||
T Consensus        80 ~~Dvv~~s~~~~~~~~~~gll~~lD~skl~n~-~~l~~~~~-----------------~~-----~-~~d~-g~~y~vPy  134 (363)
T COG0687          80 GYDVVVPSGYFVARLIKEGLLQPLDKSKLPNW-KNLDPEFL-----------------NP-----P-KFDP-GNKYSVPY  134 (363)
T ss_pred             CceEEEeCHHHHHHHHHcCCcccCChhhCcCc-cccCHHHh-----------------cc-----c-cCCC-CCEeeeeE
Confidence            49999999999999999999999999999999 99999988                 21     1 2454 89999999


Q ss_pred             eeeeeEEEEechhhhhcCCCCCCcHHHHhhh
Q 040772          110 RWGTMVIAYQKSKFRKHNLALIEFDGKRYRI  140 (142)
Q Consensus       110 ~wGt~gIaYnkd~~~~~g~~pp~SW~dL~~~  140 (142)
                      +||++||+||+++++.  -.+|+||+++|++
T Consensus       135 ~~g~t~i~Yn~~~~~~--~~~~~sW~~l~d~  163 (363)
T COG0687         135 FWGTTGIAYNTDKVKD--APPPTSWADLFDP  163 (363)
T ss_pred             EeeeeEEEEeccccCC--CCCCccHHHHhCc
Confidence            9999999999999981  1368999999986

>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>PF13343 SBP_bac_6: Bacterial extracellular solute-binding protein; PDB: 2QRY_D 1XVX_A 1SI1_A 1SI0_A 1Q35_A 1Y9U_A 2OWS_A 2OWT_A 2VP1_A 2VOZ_A Back     alignment and domain information
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PF13416 SBP_bac_8: Bacterial extracellular solute-binding protein; PDB: 2FNC_A 1ELJ_A 3TTM_B 3TTK_C 2W7Y_A 3RPW_A 2GHB_C 2GHA_A 1POY_3 1POT_A Back     alignment and domain information
>PRK11622 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03850 bind_CPR_0540 carbohydrate ABC transporter substrate-binding protein, CPR_0540 family Back     alignment and domain information
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>TIGR03851 chitin_NgcE carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>PF01547 SBP_bac_1: Bacterial extracellular solute-binding protein; InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02030 Lipoprotein_8: Hypothetical lipoprotein (MG045 family) Back     alignment and domain information
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Back     alignment and domain information
>COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR00971 3a0106s03 sulfate/thiosulfate-binding protein Back     alignment and domain information
>PRK10852 thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK10752 sulfate transporter subunit; Provisional Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
4gl0_A 333 LMO0810 protein; structural genomics, IDP05673, sp 99.72
3ttm_A 346 Polyamine transport protein; polyamine binding, pu 99.67
3ttn_A 340 Polyamine transport protein; polyamine binding pro 99.66
4eqb_A 330 Spermidine/putrescine ABC superfamily ATP binding 99.63
1a99_A 344 POTF, putrescine-binding protein; transport, perip 99.51
1pot_A 325 POTD, spermidine/putrescine-binding protein; polya 99.5
4i1d_A 324 ABC transporter substrate-binding protein; structu 99.46
4euo_A 320 ABC transporter, substrate binding protein (polya; 99.41
3pu5_A 333 Extracellular solute-binding protein; structural g 99.38
2v84_A 343 Spermidine/putrescine ABC transporter, periplasmi 99.35
3k01_A 412 Acarbose/maltose binding protein GACH; ABC transpo 99.32
3quf_A 414 Extracellular solute-binding protein, family 1; st 99.27
3oo8_A 415 ABC transporter binding protein ACBH; class 2 SBP 99.24
2heu_A 401 Sugar ABC transporter, sugar-binding protein; peri 99.2
3rpw_A 365 ABC transporter; structural genomics, PSI-biology, 99.2
2z8f_A 412 Galacto-N-biose/lacto-N-biose I transporter subst 99.18
3uor_A 458 ABC transporter sugar binding protein; ALFA/beta p 99.18
3thi_A 371 Protein (thiaminase I); thiamin degradation, trans 99.16
2uvj_A 408 TOGB, ABC type periplasmic sugar-binding protein; 99.15
4edp_A 351 ABC transporter, substrate-binding protein; clostr 99.14
1elj_A 381 Maltodextrin-binding protein; protein-carbohydrate 99.13
1eu8_A 409 Trehalose/maltose binding protein; protein-carbohy 99.09
3i3v_A 405 Probable secreted solute-binding lipoprotein; tran 99.09
4gqo_A 433 LMO0859 protein; virulence, pathogenesis, vaccine 99.07
2gha_A 382 Maltose ABC transporter, periplasmic maltose-BIND 99.07
2b3f_A 400 Glucose-binding protein; protein-carbohydrate comp 99.03
1xvx_A 312 YFUA; periplasmic iron binding protein, iron bindi 99.03
1mh3_A 421 Maltose binding-A1 homeodomain protein chimera; MA 99.01
4g68_A 456 ABC transporter; transport protein; HET: XYS; 1.80 99.01
2xd3_A 416 MALX, maltose/maltodextrin-binding protein; solute 99.0
3iot_A 449 Maltose-binding protein, huntingtin fusion protei; 98.98
1urs_A 402 Maltose-binding protein; maltodextrin-binding prot 98.98
2pt1_A 334 Iron transport protein; C-clamp, iron-binding prot 98.97
2gh9_A 386 Maltose/maltodextrin-binding protein; MBP, maltose 98.97
4aq4_A 419 SN-glycerol-3-phosphate-binding periplasmic prote; 98.97
4hw8_A 420 Bacterial extracellular solute-binding protein, P; 98.96
2zyo_A 397 Solute-binding protein; open form, sugar binding p 98.96
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 98.95
3csg_A 461 MBP, maltose-binding protein monobody YS1 fusion, 98.94
3oai_A 507 Maltose-binding periplasmic protein, myelin prote; 98.92
3mq9_A 471 Bone marrow stromal antigen 2 fused to maltose-BI 98.92
3ob4_A 500 Conglutin, maltose ABC transporter periplasmic pro 98.92
4hs7_A 420 Bacterial extracellular solute-binding protein, P; 98.92
1q35_A 320 Iron binding protein FBPA; metal binding protein; 98.91
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 98.9
3n94_A 475 Fusion protein of maltose-binding periplasmic Pro 98.89
2xz3_A 463 Maltose ABC transporter periplasmic protein, ENVE 98.89
1y4c_A 494 Maltose binding protein fused with designed helica 98.89
4dxb_A 637 RG13, maltose-binding periplasmic protein, beta-la 98.89
2zxt_A 465 Maltose-binding periplasmic protein, linker, MITO 98.88
3omb_A 535 Extracellular solute-binding protein, family 1; PS 98.88
2vgq_A 477 Maltose-binding periplasmic protein, mitochondrial 98.88
2qry_A 330 Thiamine-binding periplasmic protein; thiamin bind 98.87
1hsj_A 487 Fusion protein consisting of staphylococcus access 98.86
2voz_A 346 FUTA2, periplasmic iron-binding protein; ferric bi 98.85
1r6z_P 509 Chimera of maltose-binding periplasmic protein AN 98.85
3a09_A 490 ALGQ1; sugar binding protein, alginate; HET: MAW B 98.84
3py7_A 523 Maltose-binding periplasmic protein,paxillin LD1, 98.83
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 98.83
1nnf_A 309 Iron-utilization periplasmic protein; iron-binding 98.83
4exk_A 487 Maltose-binding periplasmic protein, uncharacteri 98.81
3h3g_A 539 Fusion protein of maltose-binding periplasmic DOM 98.81
4b3n_A 602 Maltose-binding periplasmic protein, tripartite mo 98.81
3mp6_A 522 MBP, SGF29, maltose-binding periplasmic protein, l 98.81
2w7y_A 430 FCSSBP, probable sugar ABC transporter, sugar-bind 98.8
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfa 98.79
3vlv_A 502 ALGQ1; sugar binding protein, alginate; HET: MAW L 98.79
3h4z_A 568 Maltose-binding periplasmic protein fused with Al 98.75
3osr_A 653 Maltose-binding periplasmic protein, green fluore 98.75
3e13_X 322 Putative iron-uptake ABC transport system, peripla 98.75
3osq_A 661 Maltose-binding periplasmic protein, green fluore 98.73
1y9u_A 323 Putative iron binding protein; periplasmic binding 98.68
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 98.68
3c9h_A 355 ABC transporter, substrate binding protein; struct 98.67
1sbp_A 310 Sulfate-binding protein; 1.70A {Salmonella typhimu 98.01
3cg1_A 296 UPF0100 protein PF0080; ABC transporter, binding p 96.11
2hxw_A 237 Major antigenic peptide PEB3; periplasmic binding 95.44
3cfx_A 296 UPF0100 protein MA_0280; ABC transporter, binding 95.44
3cij_A 295 UPF0100 protein AF_0094; archaeal periplasmic bind 94.69
3cfz_A 292 UPF0100 protein MJ1186; ABC transporter, binding p 94.63
3r26_A 237 Molybdate-binding periplasmic protein; protein bin 92.8
3gzg_A 253 Molybdate-binding periplasmic protein; permease; m 85.79
1atg_A 231 MODA, periplasmic molybdate-binding protein; tungs 83.51
>4gl0_A LMO0810 protein; structural genomics, IDP05673, spermidine, putrescine, ABC transporter, niaid; HET: MSE PGE PG4; 1.92A {Listeria monocytogenes} Back     alignment and structure
Probab=99.72  E-value=3.7e-18  Score=136.52  Aligned_cols=83  Identities=22%  Similarity=0.275  Sum_probs=74.0

Q ss_pred             CcceEEEeChHHHHHHHHccccccCCCCcccchhhhcChhHHHHHHHHHHHHHHhhhhHHHHhhcCCCCcCCCCCeeeee
Q 040772           29 MAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAP  108 (142)
Q Consensus        29 ~~~DvV~~sd~~l~~~i~~gLlepLD~s~l~n~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dp~g~~yavP  108 (142)
                      .++|||++++.++.+++++|+|+|+|.++++|+ +++++.+.                 .       ..+|+ |+.|++|
T Consensus        58 ~~~DVv~~~~~~~~~~~~~gll~~ld~~~~~n~-~~~~~~~~-----------------~-------~~~~~-~~~y~vp  111 (333)
T 4gl0_A           58 TTFDIAVPSDYAISKMKEENLLIPLDHSKLPNE-KYLDPRFM-----------------D-------LSFDD-DNKYSMP  111 (333)
T ss_dssp             SCCSEECCBHHHHHHHHHTTCBCCCCGGGCGGG-GGBCGGGS-----------------S-------CGGGG-GGSSEEE
T ss_pred             CCCeEEEeCHHHHHHHHHcCCcccccccccccc-ccCCHHHh-----------------h-------hccCC-CCceEec
Confidence            589999999999999999999999999999999 99998866                 1       22344 7889999


Q ss_pred             eeeeeeEEEEechhhhhcCCCCCCcHHHHhhh
Q 040772          109 YRWGTMVIAYQKSKFRKHNLALIEFDGKRYRI  140 (142)
Q Consensus       109 Y~wGt~gIaYnkd~~~~~g~~pp~SW~dL~~~  140 (142)
                      |.||++||+||+++|++   .+|+||++||+|
T Consensus       112 ~~~~~~~i~yn~~~~~~---~~~~sw~dl~dp  140 (333)
T 4gl0_A          112 YFWGTLGIIYNKEMFPD---KNFDTWNALFDP  140 (333)
T ss_dssp             EEEEEEEEEEETTTCTT---CCTTSGGGGGCG
T ss_pred             eeeeeeeeeechhhccc---CCcccHHhhcCH
Confidence            99999999999999986   468999999987
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Back     alignment and structure
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>3quf_A Extracellular solute-binding protein, family 1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Bifidobacterium longum subsp} Back     alignment and structure
>3oo8_A ABC transporter binding protein ACBH; class 2 SBP fold, ABC transporter extracellular solute bindi protein, D-galactose binding; 1.60A {Actinoplanes} PDB: 3oo6_A* 3oo7_A 3oo9_A 3ooa_A Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter subst binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>3uor_A ABC transporter sugar binding protein; ALFA/beta protein, periplasmic-binding protein, maltose, SUG binding protein; 2.20A {Xanthomonas axonopodis PV} Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A 3u1o_A Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>4gqo_A LMO0859 protein; virulence, pathogenesis, vaccine candidate, center for struc genomics of infectious diseases, csgid, niaid; HET: MSE PGE; 2.10A {Listeria monocytogenes} Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose-BIND protein; periplasmic binding protein, MBP, maltotriose; HET: MLR; 1.60A {Thermotoga maritima} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein, iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>4g68_A ABC transporter; transport protein; HET: XYS; 1.80A {Caldanaerobius} PDB: 4g68_B* Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, perip binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermoph protein, periplasmic binding protein, sugar binding protein; HET: MLR; 1.95A {Thermus thermophilus} Back     alignment and structure
>4aq4_A SN-glycerol-3-phosphate-binding periplasmic prote; diester-binding protein; HET: G3P; 1.80A {Escherichia coli} Back     alignment and structure
>4hw8_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MAL; 2.25A {Staphylococcus aureus subsp} PDB: 4hs7_A* Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3ob4_A Conglutin, maltose ABC transporter periplasmic protein, ARAH; alpha-amylase inhibitors (AAI), lipid transfer (LT) and SEED (SS) protein family; HET: MLR; 2.71A {Escherichia coli} Back     alignment and structure
>4hs7_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: P33; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>2xz3_A Maltose ABC transporter periplasmic protein, ENVE glycoprotein; viral protein, viral membrane fusion, hairpin, chimera; HET: MAL; 1.95A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, MITO intermembrane space import AND...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein AN argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 Back     alignment and structure
>3a09_A ALGQ1; sugar binding protein, alginate; HET: MAW BEM MAV; 1.40A {Sphingomonas} PDB: 1y3p_A* 1y3q_A 1y3n_A* 3vlv_A* 3vlu_A* 3vlw_A* 1j1n_A* 1kwh_A Back     alignment and structure
>3py7_A Maltose-binding periplasmic protein,paxillin LD1, chimera; viral protein; HET: MLR; 2.29A {Escherichia coli} Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 3od7_A 3odb_A 1qvs_A 2o6a_A 2o68_A 3kn8_A 3kn7_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>4exk_A Maltose-binding periplasmic protein, uncharacteri protein chimera; MCSG, pcsep, MBP-fused target, structural genomics; HET: MTT; 1.28A {Escherichia coli} PDB: 3g7v_A* 3g7w_A* 3sev_A* 3ser_A* 3sew_A* 3set_A* 3ses_A* 3seu_A* 3sex_A* 3sey_A* 3q27_A* 3q28_A* 3q26_A* 3q25_A* 3q29_A* 1nmu_A* 2ok2_A* 3pgf_A* 1t0k_A* 3rum_A* ... Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>4b3n_A Maltose-binding periplasmic protein, tripartite motif-containing protein 5; sugar binding protein-ligase complex; HET: MAL MES; 3.30A {Escherichia coli} PDB: 2lm3_A Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>3vlv_A ALGQ1; sugar binding protein, alginate; HET: MAW LGU; 1.50A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 3vlu_A* 3vlw_A* 1y3n_A* 1y3p_A* 1y3q_A 1j1n_A* 1kwh_A Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} Back     alignment and structure
>3osr_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 2.00A {Escherichia coli} Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} SCOP: c.94.1.1 PDB: 1y4t_A Back     alignment and structure
>3osq_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 1.90A {Escherichia coli} Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genom MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>2hxw_A Major antigenic peptide PEB3; periplasmic binding protein, N-glycosylation, structural genomics; HET: FLC; 1.60A {Campylobacter jejuni} PDB: 3fjm_A 3fjg_A 3fir_A* 3fj7_A* Back     alignment and structure
>3cfx_A UPF0100 protein MA_0280; ABC transporter, binding protein, molybdate, tungstate, LIGA unknown function, transport protein; 1.60A {Methanosarcina acetivorans} Back     alignment and structure
>3cij_A UPF0100 protein AF_0094; archaeal periplasmic binding protein, unknown function, metal binding protein, transport protein; 1.07A {Archaeoglobus fulgidus} PDB: 2ons_A 2onk_E 2onr_A Back     alignment and structure
>3cfz_A UPF0100 protein MJ1186; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>1atg_A MODA, periplasmic molybdate-binding protein; tungstate, ABC transporter; 1.20A {Azotobacter vinelandii} SCOP: c.94.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1pota_ 322 Spermidine/putrescine-binding protein PotD {Escher 99.43
d1a99a_ 341 Putrescine receptor (PotF) {Escherichia coli [TaxI 99.12
d3thia_ 362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 99.05
d1eu8a_ 407 D-maltodextrin-binding protein, MBP {Archaeon Ther 99.01
d1elja_ 380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 98.97
d1ursa_ 367 D-maltodextrin-binding protein, MBP {Alicyclobacil 98.92
d1laxa_ 369 D-maltodextrin-binding protein, MBP {Escherichia c 98.9
d1j1na_ 492 Alginate-binding periplasmic protein AlgQ2 {Sphing 98.79
d1xvxa_ 311 Ferric-binding protein FbpA {Yersinia enterocoliti 98.64
d1q35a_ 318 Ferric-binding protein FbpA {Mannheimia haemolytic 98.62
d1y4ta_ 317 Ferric-binding protein FbpA {Campylobacter jejuni 98.22
d1nnfa_ 308 Ferric-binding protein FbpA {Haemophilus influenza 97.96
d1y9ua_ 318 Ferric-binding protein FbpA {Bordetella pertussis 97.38
d1sbpa_ 309 Sulphate-binding protein {Salmonella typhimurium [ 93.88
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Spermidine/putrescine-binding protein PotD
species: Escherichia coli [TaxId: 562]

Probab=99.43  E-value=7.6e-14  Score=108.00  Aligned_cols=83  Identities=17%  Similarity=0.210  Sum_probs=71.7

Q ss_pred             CcceEEEeChHHHHHHHHccccccCCCCcccchhhhcChhHHHHHHHHHHHHHHhhhhHHHHhhcCCCCcCCCCCeeeee
Q 040772           29 MAADLVSVGDSWLSFAIKERLIEPTAGAEDQDWFKCLSHKWKSFYLFVYLLLFALTKSQVYLRRNDAGEIDPRCEIWAAP  108 (142)
Q Consensus        29 ~~~DvV~~sd~~l~~~i~~gLlepLD~s~l~n~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dp~g~~yavP  108 (142)
                      .++|||.+++.++.+++++|+++|||....+++ +.+.+.+.                 .       ...+ +|+.|++|
T Consensus        50 ~~~Dvv~~~~~~~~~~~~~g~~~~ld~~~~~~~-~~~~~~~~-----------------~-------~~~~-~g~~~~~P  103 (322)
T d1pota_          50 GAYDLVVPSTYYVDKMRKEGMIQKIDKSKLTNF-SNLDPDML-----------------N-------KPFD-PNNDYSIP  103 (322)
T ss_dssp             SCSSBBCCBGGGHHHHHHHTCBCCCCTTSCTTG-GGBCGGGS-----------------C-------CTTS-TTCSSCEE
T ss_pred             CCCeEEEeChHHHHHHHhCCcccccchhhcchh-hccChhhh-----------------c-------cccC-CCCceEee
Confidence            568999999999999999999999999988888 88887766                 1       1123 38889999


Q ss_pred             eeeeeeEEEEechhhhhcCCCCCCcHHHHhhh
Q 040772          109 YRWGTMVIAYQKSKFRKHNLALIEFDGKRYRI  140 (142)
Q Consensus       109 Y~wGt~gIaYnkd~~~~~g~~pp~SW~dL~~~  140 (142)
                      |..++.+++||++++++   .+|+||++||++
T Consensus       104 ~~~~~~~l~Yn~~~~~~---~~p~sw~dl~~~  132 (322)
T d1pota_         104 YIWGATAIGVNGDAVDP---KSVTSWADLWKP  132 (322)
T ss_dssp             EEEEEEEEEEETTTSCT---TTCCSSGGGGSG
T ss_pred             eeeeeeeeEehhhhcCc---cccCcHHHHhCh
Confidence            99999999999999976   468999999985
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nnfa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure
>d1sbpa_ c.94.1.1 (A:) Sulphate-binding protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure