Citrus Sinensis ID: 040907

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
RSDLGISSEKKRKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNKE
cccccccccHHHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccEEEEEcccccccHHHHHHHcccccccEEEEccccccccccccccEEEEEEcHHHHcccccccccccccccccccc
cccEEEcccccEEEEEEEEEcccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccHHHHHHHccccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccHHccccccccccc
RSDLGISSEKKRKLMAQsypmvsgdgahsyaknstLQRRVVDAAKELIYEAISDKLDLKLlkfdasntfqiadlgcsigpntFIAVQNIIEAVELkllqpdhqnisSIEFQVLFNdhydndfnTLFKslphsrkyfaagvpgsfhnrlfpkatlhfvhssyslhwlskvpkelvdqnsplwnke
rsdlgissekkrKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLhwlskvpkelvdqnsplwnke
RSDLGISSEKKRKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISdkldlkllkfdASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNKE
***********************************LQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPK*************
******************YPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKL***********EFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVP**********W***
**********KRKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNKE
**DLGISSEKKRKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSDLGISSEKKRKLMAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
Q9FKD0 362 Probable S-adenosylmethio no no 0.907 0.461 0.538 2e-45
Q9FKC8 362 Probable S-adenosylmethio no no 0.907 0.461 0.532 1e-44
Q9FKR0 361 Probable S-adenosylmethio no no 0.907 0.462 0.505 8e-43
Q9LS10 359 Probable S-adenosylmethio no no 0.885 0.454 0.494 2e-40
Q9SPV4 359 Salicylate O-methyltransf N/A no 0.777 0.398 0.464 5e-29
Q9FYZ9 364 Benzoate carboxyl methylt N/A no 0.853 0.431 0.404 5e-28
Q9FZN8 369 Caffeine synthase 1 OS=Ca N/A no 0.836 0.417 0.398 8e-28
Q68CM3 365 Probable caffeine synthas N/A no 0.842 0.424 0.381 1e-26
Q9AVK1 385 Probable caffeine synthas N/A no 0.869 0.415 0.365 1e-25
Q8H0G0 384 Theobromine synthase 2 OS N/A no 0.815 0.390 0.373 2e-25
>sp|Q9FKD0|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/171 (53%), Positives = 118/171 (69%), Gaps = 4/171 (2%)

Query: 17  QSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDAS-NTFQIADLG 75
           QS+PM  GDG HSY  NS+ Q+  +D  KE   EAI +KLDL+ L  ++  N  +I D G
Sbjct: 6   QSFPMNGGDGPHSYIHNSSYQKVAIDGVKERTSEAILEKLDLEFLNRNSEENILRIVDFG 65

Query: 76  CSIGPNTFIAVQNIIEAVELKLLQPDHQNISS-IEFQVLFNDHYDNDFNTLFKSLPH-SR 133
           CSIGPNTF  VQNII+ V+ K L+ +   I + +EFQV FND  +NDFNTLF++ P  SR
Sbjct: 66  CSIGPNTFDVVQNIIDTVKQKRLKENKTYIGAPLEFQVCFNDQPNNDFNTLFRTQPFFSR 125

Query: 134 K-YFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNK 183
           K YF+ GVPGSFH R+ PK +LH  H+SY+LHWLS VP+ + D+ SP  NK
Sbjct: 126 KEYFSVGVPGSFHGRVLPKNSLHIGHTSYTLHWLSNVPQHVCDKKSPALNK 176

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FKC8|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKR0|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1 Back     alignment and function description
>sp|Q9LS10|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SPV4|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FYZ9|BAMT_ANTMA Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1 Back     alignment and function description
>sp|Q9FZN8|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1 Back     alignment and function description
>sp|Q68CM3|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9AVK1|CS3_COFAR Probable caffeine synthase 3 OS=Coffea arabica GN=CS3 PE=2 SV=1 Back     alignment and function description
>sp|Q8H0G0|CTS2_COFAR Theobromine synthase 2 OS=Coffea arabica GN=CTS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
359488227 370 PREDICTED: probable S-adenosylmethionine 0.896 0.445 0.620 1e-55
147833899 521 hypothetical protein VITISV_030502 [Viti 0.875 0.309 0.641 3e-55
225424405 361 PREDICTED: probable S-adenosylmethionine 0.875 0.445 0.603 4e-55
296087219 806 unnamed protein product [Vitis vinifera] 0.875 0.199 0.641 2e-54
224069525 370 predicted protein [Populus trichocarpa] 0.923 0.459 0.620 2e-54
225424399 360 PREDICTED: probable S-adenosylmethionine 0.885 0.452 0.608 3e-54
225424403 353 PREDICTED: probable S-adenosylmethionine 0.885 0.461 0.590 1e-53
225462819 377 PREDICTED: probable S-adenosylmethionine 0.847 0.413 0.649 2e-53
296087220 357 unnamed protein product [Vitis vinifera] 0.880 0.453 0.613 2e-53
225466372 353 PREDICTED: probable S-adenosylmethionine 0.885 0.461 0.584 7e-53
>gi|359488227|ref|XP_002266288.2| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 128/166 (77%), Gaps = 1/166 (0%)

Query: 18  SYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCS 77
           SYPM  G G HSY KNS +QR ++ AAK++I EAI +K+D+    F++S T ++AD GCS
Sbjct: 11  SYPMNGGIGCHSYVKNSHIQRALLHAAKDVITEAIVEKVDITNPWFNSSRTLRVADFGCS 70

Query: 78  IGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKYFA 137
           +GPNTF+ VQNIIEA+EL L +    N    EF V FNDH  NDFNTLF+SLP S +YFA
Sbjct: 71  VGPNTFVVVQNIIEALEL-LYRSKRHNPEIPEFHVFFNDHVHNDFNTLFRSLPFSHRYFA 129

Query: 138 AGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNK 183
           AGVPGSFH+RLFPK+TLH +HSSY+LHWLS+VP +L D+NSP WNK
Sbjct: 130 AGVPGSFHDRLFPKSTLHIIHSSYALHWLSQVPTQLADRNSPAWNK 175

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147833899|emb|CAN73170.1| hypothetical protein VITISV_030502 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424405|ref|XP_002284898.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087219|emb|CBI33593.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224069525|ref|XP_002302990.1| predicted protein [Populus trichocarpa] gi|222844716|gb|EEE82263.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225424399|ref|XP_002281366.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi|297737618|emb|CBI26819.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424403|ref|XP_002281406.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi|297737615|emb|CBI26816.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462819|ref|XP_002266476.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087220|emb|CBI33594.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466372|ref|XP_002276659.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
TAIR|locus:2082112 348 FAMT "farnesoic acid carboxyl- 0.891 0.471 0.541 9.6e-41
TAIR|locus:2082117 379 AT3G44870 "AT3G44870" [Arabido 0.875 0.424 0.523 1.6e-40
TAIR|locus:2082157 348 AT3G44840 [Arabidopsis thalian 0.891 0.471 0.529 4.2e-40
TAIR|locus:2033414 353 AT1G66690 "AT1G66690" [Arabido 0.891 0.464 0.514 8.7e-40
TAIR|locus:2033409 353 PXMT1 [Arabidopsis thaliana (t 0.869 0.453 0.509 2.3e-39
TAIR|locus:2200186 363 AT1G68040 [Arabidopsis thalian 0.923 0.468 0.479 6.1e-39
TAIR|locus:2166640 361 AT5G38780 [Arabidopsis thalian 0.907 0.462 0.488 1.6e-38
TAIR|locus:2033389 352 AT1G66720 [Arabidopsis thalian 0.869 0.454 0.490 5.5e-38
TAIR|locus:2144461 359 AT5G38100 [Arabidopsis thalian 0.885 0.454 0.464 1.2e-35
TAIR|locus:504956193 351 AT1G15125 [Arabidopsis thalian 0.864 0.452 0.472 2.9e-32
TAIR|locus:2082112 FAMT "farnesoic acid carboxyl-O-methyltransferase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 433 (157.5 bits), Expect = 9.6e-41, P = 9.6e-41
 Identities = 92/170 (54%), Positives = 116/170 (68%)

Query:    15 MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISXXXXXXXXXXXASNTFQIADL 74
             M+ S+ M+ G+G +SY ++S  Q  +V AAKE I EAIS            SN   IAD 
Sbjct:     1 MSTSFTMIGGEGPNSYREHSKYQGALVIAAKEKINEAISTKLDIDFT----SNLVNIADF 56

Query:    75 GCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRK 134
             GCS GPNTF AVQ +I+AVE K  +    NI  IEFQV FND  +NDFNTLFK+LP +R 
Sbjct:    57 GCSSGPNTFTAVQTLIDAVENKYKK--ESNIEGIEFQVFFNDSSNNDFNTLFKTLPPARL 114

Query:   135 YFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNKE 184
             YFA+GVPGSF  R+ PK +LH   SSYSLH++SKVPKE+ D++S +WNK+
Sbjct:   115 YFASGVPGSFFGRVLPKNSLHVGVSSYSLHFVSKVPKEIKDRDSLVWNKD 164
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0019010 "farnesoic acid O-methyltransferase activity" evidence=IDA
TAIR|locus:2082117 AT3G44870 "AT3G44870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082157 AT3G44840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033414 AT1G66690 "AT1G66690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033409 PXMT1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033389 AT1G66720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
pfam03492 331 pfam03492, Methyltransf_7, SAM dependent carboxyl 1e-64
PLN02668 386 PLN02668, PLN02668, indole-3-acetate carboxyl meth 1e-36
>gnl|CDD|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase Back     alignment and domain information 
 Score =  201 bits (513), Expect = 1e-64
 Identities = 81/138 (58%), Positives = 95/138 (68%), Gaps = 10/138 (7%)

Query: 50  EAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIE 109
           EAIS+ L    L+    N+ +IADLGCS GPNTF+AV NII+ VE K  +     +   E
Sbjct: 3   EAISELL----LRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQK--ENILEPPE 56

Query: 110 FQVLFNDHYDNDFNTLFKSLPHS----RKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHW 165
           FQV FND   NDFNTLFK LP      R YF +GVPGSF+ RLFP+ +LHFVHSSYSLHW
Sbjct: 57  FQVFFNDLPSNDFNTLFKLLPPFQKKKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSLHW 116

Query: 166 LSKVPKELVDQNSPLWNK 183
           LS+VPK L D+ SP WNK
Sbjct: 117 LSQVPKGLEDKESPAWNK 134

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331
>gnl|CDD|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
PLN02668 386 indole-3-acetate carboxyl methyltransferase 100.0
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 100.0
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 97.34
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 96.28
PRK10258 251 biotin biosynthesis protein BioC; Provisional 95.93
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 95.49
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 95.46
PRK06202232 hypothetical protein; Provisional 95.45
KOG2940 325 consensus Predicted methyltransferase [General fun 95.18
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 95.04
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 94.73
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 94.64
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 93.77
PRK11207197 tellurite resistance protein TehB; Provisional 93.71
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 93.53
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 93.37
PRK12335287 tellurite resistance protein TehB; Provisional 92.54
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 92.49
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 92.46
PRK05785226 hypothetical protein; Provisional 91.93
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 91.39
TIGR00740239 methyltransferase, putative. A simple BLAST search 91.36
PRK06922 677 hypothetical protein; Provisional 90.95
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 90.49
PLN02244 340 tocopherol O-methyltransferase 90.48
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 90.3
PRK08317 241 hypothetical protein; Provisional 90.28
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 89.98
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 89.89
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 89.54
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 89.3
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 88.32
PLN02336 475 phosphoethanolamine N-methyltransferase 87.99
PLN02490 340 MPBQ/MSBQ methyltransferase 87.76
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 87.35
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 87.19
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 87.19
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 87.16
PLN02233261 ubiquinone biosynthesis methyltransferase 87.0
PLN02336 475 phosphoethanolamine N-methyltransferase 85.07
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 83.93
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 83.7
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 82.75
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 81.43
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 81.0
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 80.88
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 80.2
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information 
Probab=100.00  E-value=3e-60  Score=426.38  Aligned_cols=163  Identities=39%  Similarity=0.646  Sum_probs=148.8

Q ss_pred             hcccccccCCCCCchhHHhhHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCceEEEeeecCCCcccHHHHHHHHHHHH
Q 040907           15 MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVE   94 (184)
Q Consensus        15 ~~~~~~M~gG~G~~sY~~nS~~Q~~~i~~~~p~l~~ai~~~~~~~~~~~~~~~~~~IADlGCS~G~NSl~~v~~iI~~i~   94 (184)
                      ++++|||+||+|++||++||.+|++++..++|+|++||+++.. .  . ...++++|||||||+|+||+.+|++||++|+
T Consensus        15 ~~~~l~M~gG~g~~SYa~nS~~Q~~~~~~~k~~leeai~~~~~-~--~-~p~~~~~iaDlGcs~G~ntl~~vs~iI~~i~   90 (386)
T PLN02668         15 LEKLLCMKGGKGEGSYANNSQAQALHARSMLHLLEETLDNVHL-N--S-SPEVPFTAVDLGCSSGSNTIHIIDVIVKHMS   90 (386)
T ss_pred             eccccccCCCCccccHHHHHHHHHHHHHHHHHHHHHHHHHhcc-c--c-CCCcceeEEEecCCCCccHHHHHHHHHHHHH
Confidence            6789999999999999999999999999999999999988642 2  0 1136899999999999999999999999999


Q ss_pred             HHhcCCCCCCCCCcceEEEeCCCCCCchHHHhhhCCCC----------------CceEEeecCCcccccccCCCccceee
Q 040907           95 LKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHS----------------RKYFAAGVPGSFHNRLFPKATLHFVH  158 (184)
Q Consensus        95 ~~~~~~~~~~~~~pe~qv~~nDLP~NDFNtLF~~L~~~----------------~~~f~~gvpgSFY~rLfP~~Svh~~~  158 (184)
                      ++|++.+   ..+|||||||||||+||||+||++|+.+                ++||++|||||||+||||++||||+|
T Consensus        91 ~~~~~~~---~~~pe~qv~~nDLP~NDFNtlF~~L~~~~~~~~~~~~~~~~~~~~~~f~~gvpGSFY~RLfP~~Slh~~~  167 (386)
T PLN02668         91 KRYESAG---LDPPEFSAFFSDLPSNDFNTLFQLLPPLANYGGSMEECLAASGHRSYFAAGVPGSFYRRLFPARSIDVFH  167 (386)
T ss_pred             HHhhhcC---CCCCcceEEecCCCCCCHHHHHhhchhhhhhhcchhhhccccCCCceEEEecCccccccccCCCceEEEE
Confidence            9998744   3478999999999999999999999852                24999999999999999999999999


Q ss_pred             eccccccccCCCccccccCCCCCCCC
Q 040907          159 SSYSLHWLSKVPKELVDQNSPLWNKE  184 (184)
Q Consensus       159 Ss~aLHWLS~vP~~l~d~~~~~~nk~  184 (184)
                      |+||||||||+|+++.|+.+++||||
T Consensus       168 Ss~slHWLS~vP~~l~d~~s~~~Nkg  193 (386)
T PLN02668        168 SAFSLHWLSQVPESVTDKRSAAYNKG  193 (386)
T ss_pred             eeccceecccCchhhccCCcccccCC
Confidence            99999999999999999999999997

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
1m6e_X 359 Crystal Structure Of Salicylic Acid Carboxyl Methyl 1e-29
2efj_A 384 The Structure Of 1,7 Dimethylxanthine Methyltransfe 3e-25
2eg5_A 372 The Structure Of Xanthosine Methyltransferase Lengt 3e-25
3b5i_A 374 Crystal Structure Of Indole-3-Acetic Acid Methyltra 2e-24
>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359 Back     alignment and structure 
Iteration: 1

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 69/154 (44%), Positives = 88/154 (57%), Gaps = 10/154 (6%)
Query: 21  MVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISXXXXXXXXXXXASNTFQIADLGCSIGP 80
           M  G G +SYA NS +QR+V+   K +   AI+            +    IADLGCS GP
Sbjct: 9   MKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDT----VTTRLAIADLGCSSGP 64
Query: 81  NTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRKY----F 136
           N   AV  +I+ VE    +   +N  S E+Q+  ND   NDFN +F+SLP         F
Sbjct: 65  NALFAVTELIKTVEELRKKMGREN--SPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCF 122
Query: 137 AAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVP 170
             GVPGSF+ RLFP+ TLHF+HSSYSL WLS+VP
Sbjct: 123 INGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP 156
>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384 Back     alignment and structure
>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372 Back     alignment and structure
>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 5e-51
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 7e-50
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 1e-49
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374 Back     alignment and structure
 Score =  167 bits (423), Expect = 5e-51
 Identities = 66/184 (35%), Positives = 92/184 (50%), Gaps = 21/184 (11%)

Query: 15  MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADL 74
           + +   M  G G  SYA NS  Q     +   L+ E + +   + L    +   F   DL
Sbjct: 3   LERLLSMKGGKGQDSYANNSLAQAMHARSMLHLLEETLEN---VHLNSSASPPPFTAVDL 59

Query: 75  GCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPH--- 131
           GCS G NT   +  I++ +  +    D   I   EF   F+D   NDFNTLF+ LP    
Sbjct: 60  GCSSGANTVHIIDFIVKHISKR---FDAAGIDPPEFTAFFSDLPSNDFNTLFQLLPPLVS 116

Query: 132 ------------SRKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSP 179
                       +R YF AGVPGSF+ RLFP  T+ F HS++SLHWLS+VP+ + D+ S 
Sbjct: 117 NTCMEECLAADGNRSYFVAGVPGSFYRRLFPARTIDFFHSAFSLHWLSQVPESVTDRRSA 176

Query: 180 LWNK 183
            +N+
Sbjct: 177 AYNR 180
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 100.0
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 100.0
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 100.0
3dtn_A234 Putative methyltransferase MM_2633; structural gen 96.02
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 95.38
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 95.36
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 95.21
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 95.19
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 95.09
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 95.0
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 94.99
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 94.85
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 94.62
3dh0_A219 SAM dependent methyltransferase; cystal structure, 94.62
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 94.54
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 94.35
3ege_A 261 Putative methyltransferase from antibiotic biosyn 94.18
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 93.93
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 93.65
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 93.61
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 93.28
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 93.2
1xxl_A 239 YCGJ protein; structural genomics, protein structu 93.08
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 93.06
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 92.96
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 92.86
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 92.83
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 92.77
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 92.74
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 92.71
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 92.64
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 92.6
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 92.28
3f4k_A 257 Putative methyltransferase; structural genomics, P 92.14
3lcc_A235 Putative methyl chloride transferase; halide methy 92.11
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 91.98
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 91.98
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 91.92
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 91.66
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 91.64
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 91.59
3hnr_A220 Probable methyltransferase BT9727_4108; structural 91.54
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 91.49
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 91.26
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 91.24
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 91.16
2p7i_A 250 Hypothetical protein; putative methyltransferase, 91.13
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 91.08
1vlm_A219 SAM-dependent methyltransferase; possible histamin 91.06
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 90.86
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 90.43
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 90.38
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 90.24
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 90.21
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 89.88
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 89.84
3m70_A286 Tellurite resistance protein TEHB homolog; structu 89.8
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 89.76
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 89.7
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 89.62
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 89.52
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 89.47
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 89.47
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 89.35
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 89.33
3i9f_A170 Putative type 11 methyltransferase; structural gen 89.11
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 89.09
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 89.08
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 89.03
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 88.91
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 88.83
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 88.73
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 88.59
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 88.58
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 88.52
3dp7_A363 SAM-dependent methyltransferase; structural genomi 88.51
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 88.42
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 88.34
3cc8_A 230 Putative methyltransferase; structural genomics, j 88.1
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 87.96
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 87.88
3ocj_A305 Putative exported protein; structural genomics, PS 87.55
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 87.38
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 87.27
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 87.2
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 86.98
2r3s_A335 Uncharacterized protein; methyltransferase domain, 86.71
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 86.69
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 86.67
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 86.27
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 85.82
2i62_A265 Nicotinamide N-methyltransferase; structural genom 85.29
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 84.92
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 83.87
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 83.38
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 83.34
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 82.88
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 82.64
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 81.6
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 81.27
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 81.04
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 80.67
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-59  Score=421.12  Aligned_cols=163  Identities=37%  Similarity=0.680  Sum_probs=133.9

Q ss_pred             hcccccccCCCCCchhHHhhHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCC---ceEEEeeecCCCcccHHHHHHHHH
Q 040907           15 MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASN---TFQIADLGCSIGPNTFIAVQNIIE   91 (184)
Q Consensus        15 ~~~~~~M~gG~G~~sY~~nS~~Q~~~i~~~~p~l~~ai~~~~~~~~~~~~~~~---~~~IADlGCS~G~NSl~~v~~iI~   91 (184)
                      ++++|||+||+|++||++||. |++++..++|++++||++++...     .++   +++|||||||+|+||+.+++.||+
T Consensus         3 ~~~~~~M~gg~G~~sY~~nS~-Q~~~~~~~~~~~~~ai~~l~~~~-----~~~~~~~~~IaDlGCssG~NT~~~v~~ii~   76 (384)
T 2efj_A            3 LQEVLHMNGGEGDTSYAKNSS-YNLFLIRVKPVLEQCIQELLRAN-----LPNINKCFKVGDLGCASGPNTFSTVRDIVQ   76 (384)
T ss_dssp             CTTTCCCCC----CCHHHHCC-TTTTHHHHHHHHHHHHHHHHHTT-----CTTTTTEEEEEEETCCSSHHHHHHHHHHHH
T ss_pred             cccccccCCCCChhhHHHhHH-HHHHHHHHHHHHHHHHHHhhhcc-----cCCcCCceEEEecCCCCCchHHHHHHHHHH
Confidence            567999999999999999999 99999999999999999866421     244   899999999999999999999999


Q ss_pred             HHHHHhcCCCCCCCCCcceEEEeCCCCCCchHHHhhhCCC------------CCceEEeecCCcccccccCCCccceeee
Q 040907           92 AVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPH------------SRKYFAAGVPGSFHNRLFPKATLHFVHS  159 (184)
Q Consensus        92 ~i~~~~~~~~~~~~~~pe~qv~~nDLP~NDFNtLF~~L~~------------~~~~f~~gvpgSFY~rLfP~~Svh~~~S  159 (184)
                      +|+++|..+... ..+|||||||||||+||||+||++||.            .++||++|||||||+||||++|+||+||
T Consensus        77 ~i~~~~~~~~~~-~~~pe~~v~~nDLp~NDFN~lF~~L~~~~~~~~~~~g~~~~~~f~~gvpgSFy~rlfp~~S~d~v~S  155 (384)
T 2efj_A           77 SIDKVGQEKKNE-LERPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHS  155 (384)
T ss_dssp             HHTCC-----------CEEEEEEECCTTSCHHHHHHHHHHHHHHHHHHTCCCTTSEEEEECCSCTTSCCSCTTCEEEEEE
T ss_pred             HHHHHhhhcccC-CCCCceEEEecCCCccchHHHHhhhhhhHhhhhhhccCCCCceEEEecchhhhhccCCCCceEEEEe
Confidence            999988652111 247899999999999999999999985            3579999999999999999999999999


Q ss_pred             ccccccccCCCccccccCCCCCCCC
Q 040907          160 SYSLHWLSKVPKELVDQNSPLWNKE  184 (184)
Q Consensus       160 s~aLHWLS~vP~~l~d~~~~~~nk~  184 (184)
                      ++||||||++|+++.|+.+++||||
T Consensus       156 s~aLHWls~~p~~l~~~~s~~~nkg  180 (384)
T 2efj_A          156 CYCLHWLSQVPSGLVTELGISVNKG  180 (384)
T ss_dssp             ESCTTBCSSSCCC------CCCCTT
T ss_pred             cceeeecCCCchhhhccccccccCC
Confidence            9999999999999999999999997
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1m6ex_ 359 c.66.1.35 (X:) Salicylic acid carboxyl methyltrans 3e-61
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  192 bits (488), Expect = 3e-61
 Identities = 69/173 (39%), Positives = 93/173 (53%), Gaps = 10/173 (5%)

Query: 15  MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADL 74
           + Q   M  G G +SYA NS +QR+V+   K +   AI+       +    +    IADL
Sbjct: 3   VRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGDTV----TTRLAIADL 58

Query: 75  GCSIGPNTFIAVQNIIEAVELKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHSRK 134
           GCS GPN   AV  +I+ VE    +      +S E+Q+  ND   NDFN +F+SLP    
Sbjct: 59  GCSSGPNALFAVTELIKTVEELRKK--MGRENSPEYQIFLNDLPGNDFNAIFRSLPIEND 116

Query: 135 ----YFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVPKELVDQNSPLWNK 183
                F  GVPGSF+ RLFP+ TLHF+HSSYSL WLS+VP  +      ++  
Sbjct: 117 VDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIESNKGNIYMA 169

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 100.0
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 97.04
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.55
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.0
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 95.71
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.39
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.31
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.21
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 95.18
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.89
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 94.2
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 94.15
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 94.04
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 93.48
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 92.85
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 92.76
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 92.6
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 92.46
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 91.07
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 90.67
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 90.44
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 89.72
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 89.66
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 89.1
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 88.84
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 88.33
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 86.81
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 86.39
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 84.66
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 83.28
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 82.91
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 80.68
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=4.5e-65  Score=451.04  Aligned_cols=164  Identities=42%  Similarity=0.682  Sum_probs=150.9

Q ss_pred             hcccccccCCCCCchhHHhhHHHHHHHHHHHHHHHHHHHhhhhhhhccCCCCCceEEEeeecCCCcccHHHHHHHHHHHH
Q 040907           15 MAQSYPMVSGDGAHSYAKNSTLQRRVVDAAKELIYEAISDKLDLKLLKFDASNTFQIADLGCSIGPNTFIAVQNIIEAVE   94 (184)
Q Consensus        15 ~~~~~~M~gG~G~~sY~~nS~~Q~~~i~~~~p~l~~ai~~~~~~~~~~~~~~~~~~IADlGCS~G~NSl~~v~~iI~~i~   94 (184)
                      ++++|||+||+|++||++||.+|+++|.+++|+|++||+++++..    ..+++|+|||||||+|+|||.+|++||++|+
T Consensus         3 ~~~~l~M~gG~G~~SYa~NS~~Q~~~i~~~kp~leeai~~~~~~~----~~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~   78 (359)
T d1m6ex_           3 VRQVLHMKGGAGENSYAMNSFIQRQVISITKPITEAAITALYSGD----TVTTRLAIADLGCSSGPNALFAVTELIKTVE   78 (359)
T ss_dssp             CHHHHCCCCCTTSTTTTSSCHHHHHHHHHTHHHHHHHHHHHHSSS----SSSSEECCEEESCCSSTTTTTGGGTTHHHHH
T ss_pred             ccEeeccCCCCCcchHHHHHHHHHHHHHHHHHHHHHHHHhcccCC----CCCCceEEEEeCCCCCccHHHHHHHHHHHHH
Confidence            567999999999999999999999999999999999999976532    2477899999999999999999999999999


Q ss_pred             HHhcCCCCCCCCCcceEEEeCCCCCCchHHHhhhCCCC----CceEEeecCCcccccccCCCccceeeeccccccccCCC
Q 040907           95 LKLLQPDHQNISSIEFQVLFNDHYDNDFNTLFKSLPHS----RKYFAAGVPGSFHNRLFPKATLHFVHSSYSLHWLSKVP  170 (184)
Q Consensus        95 ~~~~~~~~~~~~~pe~qv~~nDLP~NDFNtLF~~L~~~----~~~f~~gvpgSFY~rLfP~~Svh~~~Ss~aLHWLS~vP  170 (184)
                      ++|++.+.  ..+|||||||||||+||||+||++||..    ++||++|||||||+||||++||||+||+||||||||+|
T Consensus        79 ~~~~~~~~--~~~pe~qvf~nDLP~NDFNtLF~~L~~~~~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP  156 (359)
T d1m6ex_          79 ELRKKMGR--ENSPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVP  156 (359)
T ss_dssp             HHHHSSSC--SSCCEEEEEEEECTTSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCC
T ss_pred             HHHHhcCC--CCCCeEEEEeCCCCcchHHHHHHhccccccCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCC
Confidence            99987653  2478999999999999999999999974    46999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCCC
Q 040907          171 KELVDQNSPLWNKE  184 (184)
Q Consensus       171 ~~l~d~~~~~~nk~  184 (184)
                      +++.++.++.|+++
T Consensus       157 ~~l~~n~~~i~~~~  170 (359)
T d1m6ex_         157 IGIESNKGNIYMAN  170 (359)
T ss_dssp             SCCCCCTTTTSSCS
T ss_pred             ccccCCCCcEEEcC
Confidence            99999999999863
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure