Citrus Sinensis ID: 040977

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALIF
cccHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccc
cccHHHHHHHHHHHHHHHHHHccccccccEccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHcccccccccHHHccccccccccHHHHHHHHHHHHHHccccccHHHcc
MENVRILLLIVLMFMLHgrkisgegdgvLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESyggmvtekqagpnvnsvrgfEVIDEIKFILedacphtvscalif
MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTekqagpnvnsvRGFEVIDEIKFILEDACPHTVSCALIF
MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALIF
***VRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALI*
****RILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMV**KQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALIF
MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALIF
**NVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQA*PNVNSVRGFEVIDEIKFILEDACPHTVSCA*IF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
Q9SLH7 336 Peroxidase 20 OS=Arabidop yes no 0.953 0.363 0.560 3e-36
Q9SI16 338 Peroxidase 15 OS=Arabidop no no 0.804 0.304 0.572 1e-31
Q96512 346 Peroxidase 9 OS=Arabidops no no 0.773 0.286 0.616 1e-31
Q9FJZ9 336 Peroxidase 72 OS=Arabidop no no 0.835 0.318 0.574 4e-31
Q9SI17 337 Peroxidase 14 OS=Arabidop no no 0.757 0.287 0.587 4e-31
O23474 348 Peroxidase 40 OS=Arabidop no no 0.781 0.287 0.617 5e-30
Q42578 335 Peroxidase 53 OS=Arabidop no no 0.898 0.343 0.491 2e-29
Q9SD46 344 Peroxidase 36 OS=Arabidop no no 0.757 0.281 0.597 2e-29
O23237 331 Peroxidase 49 OS=Arabidop no no 0.773 0.299 0.565 8e-29
P22195 316 Cationic peroxidase 1 OS= N/A no 0.820 0.332 0.542 5e-28
>sp|Q9SLH7|PER20_ARATH Peroxidase 20 OS=Arabidopsis thaliana GN=PER20 PE=2 SV=1 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 100/123 (81%), Gaps = 1/123 (0%)

Query: 5   RILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLL 64
           ++ L +++++ +    + G+    L++ +YKE+CPLAEEI++  +E AV+KDPRMAASLL
Sbjct: 7   KVWLSLIVLYAI-TTSVLGDFGEPLLKGFYKESCPLAEEIVKHNIEVAVLKDPRMAASLL 65

Query: 65  RLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSC 124
           RL FHDCF++GCDA VLL+++G M++EKQA PN+NS+RGFEVID IK++LE+ACP TVSC
Sbjct: 66  RLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNLNSLRGFEVIDYIKYLLEEACPLTVSC 125

Query: 125 ALI 127
           + I
Sbjct: 126 SDI 128
May be implicated in the systemic acquired resistance response via the salicylic acid signal transduction pathway.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 7
>sp|Q9SI16|PER15_ARATH Peroxidase 15 OS=Arabidopsis thaliana GN=PER15 PE=2 SV=1 Back     alignment and function description
>sp|Q96512|PER9_ARATH Peroxidase 9 OS=Arabidopsis thaliana GN=PER9 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJZ9|PER72_ARATH Peroxidase 72 OS=Arabidopsis thaliana GN=PER72 PE=1 SV=1 Back     alignment and function description
>sp|Q9SI17|PER14_ARATH Peroxidase 14 OS=Arabidopsis thaliana GN=PER14 PE=3 SV=1 Back     alignment and function description
>sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 Back     alignment and function description
>sp|Q42578|PER53_ARATH Peroxidase 53 OS=Arabidopsis thaliana GN=PER53 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD46|PER36_ARATH Peroxidase 36 OS=Arabidopsis thaliana GN=PER36 PE=2 SV=2 Back     alignment and function description
>sp|O23237|PER49_ARATH Peroxidase 49 OS=Arabidopsis thaliana GN=PER49 PE=2 SV=2 Back     alignment and function description
>sp|P22195|PER1_ARAHY Cationic peroxidase 1 OS=Arachis hypogaea GN=PNC1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
225427322 332 PREDICTED: peroxidase 20 [Vitis vinifera 0.984 0.379 0.669 6e-41
449461575 332 PREDICTED: peroxidase 20-like [Cucumis s 0.960 0.370 0.624 8e-40
224138052 327 predicted protein [Populus trichocarpa] 0.781 0.305 0.76 2e-38
357482327 332 Peroxidase [Medicago truncatula] gi|3555 0.804 0.310 0.718 2e-36
356495553 332 PREDICTED: peroxidase 20-like [Glycine m 0.968 0.373 0.614 8e-36
15226975 336 peroxidase 20 [Arabidopsis thaliana] gi| 0.953 0.363 0.560 2e-34
14031051 329 peroxidase [Nicotiana tabacum] 0.984 0.382 0.519 3e-32
356540783 864 PREDICTED: uncharacterized protein LOC10 0.796 0.118 0.627 1e-31
356496705 331 PREDICTED: peroxidase 72-like [Glycine m 0.796 0.308 0.627 2e-31
224094875 333 predicted protein [Populus trichocarpa] 0.820 0.315 0.620 4e-31
>gi|225427322|ref|XP_002279208.1| PREDICTED: peroxidase 20 [Vitis vinifera] gi|297742163|emb|CBI33950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 85/127 (66%), Positives = 103/127 (81%), Gaps = 1/127 (0%)

Query: 1   MENVRILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMA 60
           ME +RILL I L+ + HG        GVLV DYYKE CPL EEI+RR VE AV++DPRMA
Sbjct: 1   MEFMRILLSI-LVLIFHGNTGVLSEAGVLVLDYYKEACPLVEEIVRRNVEIAVLRDPRMA 59

Query: 61  ASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPH 120
           ASLLRLHFHDCF+MGCDA +LL+++G M++EKQAGPN+NSVRGF VID IK ++E+ACP+
Sbjct: 60  ASLLRLHFHDCFVMGCDASILLDTFGDMISEKQAGPNLNSVRGFGVIDNIKHLVEEACPY 119

Query: 121 TVSCALI 127
           TVSCA I
Sbjct: 120 TVSCADI 126

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449461575|ref|XP_004148517.1| PREDICTED: peroxidase 20-like [Cucumis sativus] gi|449527339|ref|XP_004170669.1| PREDICTED: peroxidase 20-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224138052|ref|XP_002326506.1| predicted protein [Populus trichocarpa] gi|222833828|gb|EEE72305.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357482327|ref|XP_003611449.1| Peroxidase [Medicago truncatula] gi|355512784|gb|AES94407.1| Peroxidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356495553|ref|XP_003516641.1| PREDICTED: peroxidase 20-like [Glycine max] Back     alignment and taxonomy information
>gi|15226975|ref|NP_181081.1| peroxidase 20 [Arabidopsis thaliana] gi|25453219|sp|Q9SLH7.1|PER20_ARATH RecName: Full=Peroxidase 20; Short=Atperox P20; AltName: Full=ATP28a; Flags: Precursor gi|3608150|gb|AAC36183.1| putative peroxidase [Arabidopsis thaliana] gi|26450332|dbj|BAC42282.1| putative peroxidase [Arabidopsis thaliana] gi|28827328|gb|AAO50508.1| putative peroxidase [Arabidopsis thaliana] gi|330254007|gb|AEC09101.1| peroxidase 20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|14031051|gb|AAK52085.1| peroxidase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|356540783|ref|XP_003538864.1| PREDICTED: uncharacterized protein LOC100796901 [Glycine max] Back     alignment and taxonomy information
>gi|356496705|ref|XP_003517206.1| PREDICTED: peroxidase 72-like [Glycine max] Back     alignment and taxonomy information
>gi|224094875|ref|XP_002310274.1| predicted protein [Populus trichocarpa] gi|222853177|gb|EEE90724.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
TAIR|locus:2062420 336 AT2G35380 [Arabidopsis thalian 0.937 0.357 0.561 2.8e-34
TAIR|locus:2028280 346 AT1G44970 [Arabidopsis thalian 0.820 0.303 0.590 2.1e-29
TAIR|locus:2053129 338 AT2G18150 [Arabidopsis thalian 0.789 0.298 0.588 3.4e-29
TAIR|locus:2154925 336 AT5G66390 [Arabidopsis thalian 0.820 0.312 0.575 7.1e-29
TAIR|locus:2053139 337 AT2G18140 [Arabidopsis thalian 0.757 0.287 0.587 1.5e-28
TAIR|locus:2161283 316 AT5G58390 [Arabidopsis thalian 0.914 0.370 0.495 1.7e-27
TAIR|locus:2080928 344 AT3G50990 [Arabidopsis thalian 0.757 0.281 0.597 7.3e-27
TAIR|locus:2115335 331 AT4G36430 [Arabidopsis thalian 0.773 0.299 0.565 1.2e-26
TAIR|locus:2170204 335 PA2 "peroxidase 2" [Arabidopsi 0.914 0.349 0.478 2.5e-26
TAIR|locus:2064950 350 AT2G39040 [Arabidopsis thalian 0.945 0.345 0.491 1.4e-25
TAIR|locus:2062420 AT2G35380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 372 (136.0 bits), Expect = 2.8e-34, P = 2.8e-34
 Identities = 68/121 (56%), Positives = 99/121 (81%)

Query:     5 RILLLIVLMFMLHGRKISGEGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLL 64
             ++ L +++++ +    + G+    L++ +YKE+CPLAEEI++  +E AV+KDPRMAASLL
Sbjct:     7 KVWLSLIVLYAIT-TSVLGDFGEPLLKGFYKESCPLAEEIVKHNIEVAVLKDPRMAASLL 65

Query:    65 RLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSC 124
             RL FHDCF++GCDA VLL+++G M++EKQA PN+NS+RGFEVID IK++LE+ACP TVSC
Sbjct:    66 RLQFHDCFVLGCDASVLLDTHGDMLSEKQATPNLNSLRGFEVIDYIKYLLEEACPLTVSC 125

Query:   125 A 125
             +
Sbjct:   126 S 126
GO:0004601 "peroxidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2028280 AT1G44970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053129 AT2G18150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154925 AT5G66390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053139 AT2G18140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161283 AT5G58390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080928 AT3G50990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115335 AT4G36430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170204 PA2 "peroxidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064950 AT2G39040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.11.1.7LOW CONFIDENCE prediction!
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00015828001
SubName- Full=Chromosome chr2 scaffold_11, whole genome shotgun sequence; (332 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
cd00693 298 cd00693, secretory_peroxidase, Horseradish peroxid 2e-52
PLN03030 324 PLN03030, PLN03030, cationic peroxidase; Provision 3e-31
pfam00141180 pfam00141, peroxidase, Peroxidase 1e-28
cd00314 255 cd00314, plant_peroxidase_like, Heme-dependent per 8e-05
>gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information 
 Score =  166 bits (423), Expect = 2e-52
 Identities = 57/97 (58%), Positives = 70/97 (72%), Gaps = 1/97 (1%)

Query: 29  LVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGM 88
           L   +Y ++CP AE I+R +V  AV  DPR+AA+LLRLHFHDCF+ GCDA VLL+S    
Sbjct: 2   LSVGFYSKSCPNAESIVRSVVRAAVKADPRLAAALLRLHFHDCFVRGCDASVLLDSTANN 61

Query: 89  VTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCA 125
            +EK A PN  S+RGF+VID+IK  LE ACP  VSCA
Sbjct: 62  TSEKDAPPN-LSLRGFDVIDDIKAALEAACPGVVSCA 97

Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. Length = 298
>gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|215745 pfam00141, peroxidase, Peroxidase Back     alignment and domain information
>gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
PLN03030 324 cationic peroxidase; Provisional 100.0
cd00693 298 secretory_peroxidase Horseradish peroxidase and re 100.0
PF00141 230 peroxidase: Peroxidase; InterPro: IPR002016 Peroxi 99.95
cd00691 253 ascorbate_peroxidase Ascorbate peroxidases and cyt 99.87
PLN02608 289 L-ascorbate peroxidase 99.85
PLN02364 250 L-ascorbate peroxidase 1 99.83
cd00314 255 plant_peroxidase_like Heme-dependent peroxidases s 99.82
cd00692 328 ligninase Ligninase and other manganese-dependent 99.77
cd08201 264 plant_peroxidase_like_1 Uncharacterized family of 99.65
PLN02879 251 L-ascorbate peroxidase 99.41
TIGR00198 716 cat_per_HPI catalase/peroxidase HPI. Note that the 96.33
cd00649 409 catalase_peroxidase_1 N-terminal catalytic domain 90.5
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 81.06
>PLN03030 cationic peroxidase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.4e-48  Score=323.04  Aligned_cols=101  Identities=47%  Similarity=0.823  Sum_probs=96.2

Q ss_pred             CCCCCCCcCcccCCCccHHHHHHHHHHHHHHhccccccchhheeeccccccccCchhhhhcCCCCcccccCCCCCCccch
Q 040977           24 EGDGVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRG  103 (128)
Q Consensus        24 ~~~~~L~~~fY~~sCP~~E~iV~~~v~~~~~~d~~~aa~lLRL~FHDCFV~GCDaSiLLd~~~~~~~ek~a~~n~~~lrg  103 (128)
                      .+.++|+++||++|||++|+||+++|++++++||+++|++||||||||||+||||||||+++   .+||++.+|. ++||
T Consensus        20 ~~~~~L~~~fY~~sCP~aE~iV~~~v~~~~~~d~~~aa~llRL~FHDCfv~GCDaSvLl~~~---~~Ek~a~~N~-~l~G   95 (324)
T PLN03030         20 VQGQGTRVGFYSTTCPQAESIVRKTVQSHFQSNPAIAPGLLRMHFHDCFVRGCDASILIDGS---NTEKTALPNL-LLRG   95 (324)
T ss_pred             chhccCccchhhCcCCCHHHHHHHHHHHHHhhCcccchhhhhhhhhhheecCCceEEeeCCC---cccccCCCCc-Ccch
Confidence            45577999999999999999999999999999999999999999999999999999999964   3699999998 8999


Q ss_pred             HHHHHHHHHHHhhhCCCcccccccC
Q 040977          104 FEVIDEIKFILEDACPHTVSCALIF  128 (128)
Q Consensus       104 f~~Id~iKa~lE~~CPg~VSCADIl  128 (128)
                      ||+||+||++||++|||+|||||||
T Consensus        96 f~~i~~iK~~~e~~CPg~VSCADil  120 (324)
T PLN03030         96 YDVIDDAKTQLEAACPGVVSCADIL  120 (324)
T ss_pred             HHHHHHHHHHHHhhCCCcccHHHHH
Confidence            9999999999999999999999996

>cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information
>PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases Back     alignment and domain information
>PLN02608 L-ascorbate peroxidase Back     alignment and domain information
>PLN02364 L-ascorbate peroxidase 1 Back     alignment and domain information
>cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information
>cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases Back     alignment and domain information
>cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins Back     alignment and domain information
>PLN02879 L-ascorbate peroxidase Back     alignment and domain information
>TIGR00198 cat_per_HPI catalase/peroxidase HPI Back     alignment and domain information
>cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
4a5g_A 308 Raphanus Sativus Anionic Peroxidase. Length = 308 6e-31
1pa2_A 306 Arabidopsis Thaliana Peroxidase A2 Length = 306 7e-30
1sch_A 294 Peanut Peroxidase Length = 294 2e-28
1gx2_A 309 Recombinant Horseradish Peroxidase Phe209ser Comple 2e-26
3atj_A 309 Heme Ligand Mutant Of Recombinant Horseradish Perox 2e-26
1w4w_A 323 Ferric Horseradish Peroxidase C1a In Complex With F 2e-26
1gw2_A 308 Recombinant Horseradish Peroxidase C1a Thr171ser In 2e-26
1gwu_A 309 Recombinant Horseradish Peroxidase C1a Ala140gly Le 2e-26
1atj_A 306 Recombinant Horseradish Peroxidase C1a Length = 306 3e-26
1gwo_A 309 Recombinant Horseradish Peroxidase C1a Ala170gln Le 3e-26
6atj_A 308 Recombinant Horseradish Peroxidase C Complex With F 3e-26
2atj_A 308 Recombinant Horseradish Peroxidase Complex With Ben 3e-26
2ylj_A 306 Horse Radish Peroxidase, Mutant S167y Length = 306 3e-26
4atj_A 309 Distal Heme Pocket Mutant (H42e) Of Recombinant Hor 2e-25
1fhf_A 304 The Structure Of Soybean Peroxidase Length = 304 2e-25
1qgj_A 300 Arabidopsis Thaliana Peroxidase N Length = 300 8e-25
1kzm_A 308 Distal Heme Pocket Mutant (r38s/h42e) Of Recombinan 1e-24
3hdl_A 304 Crystal Structure Of Highly Glycosylated Peroxidase 6e-21
1bgp_A 309 Crystal Structure Of Barley Grain Peroxidase 1 Leng 6e-19
>pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 Back     alignment and structure 
Iteration: 1

 Score =  129 bits (323), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%)
Query: 27  GVLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYG 86
           G L   +Y  TCP A  ++R IV+ A   D R+ ASL+RLHFHDCF++GCDA +LL++ G
Sbjct: 2   GSLNATFYAGTCPNASAMVRTIVQQAFQSDSRIGASLIRLHFHDCFVLGCDASILLDNSG 61
Query: 87  GMVTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSC 124
            +++EK AGPN NS RGF V+D IK  LE+ACP  VSC
Sbjct: 62  SIISEKNAGPNANSARGFNVVDNIKTALENACPGVVSC 99
>pdb|1PA2|A Chain A, Arabidopsis Thaliana Peroxidase A2 Length = 306 Back     alignment and structure
>pdb|1SCH|A Chain A, Peanut Peroxidase Length = 294 Back     alignment and structure
>pdb|1GX2|A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|3ATJ|A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|1W4W|A Chain A, Ferric Horseradish Peroxidase C1a In Complex With Formate Length = 323 Back     alignment and structure
>pdb|1GW2|A Chain A, Recombinant Horseradish Peroxidase C1a Thr171ser In Complex With Ferulic Acid Length = 308 Back     alignment and structure
>pdb|1GWU|A Chain A, Recombinant Horseradish Peroxidase C1a Ala140gly Length = 309 Back     alignment and structure
>pdb|1ATJ|A Chain A, Recombinant Horseradish Peroxidase C1a Length = 306 Back     alignment and structure
>pdb|1GWO|A Chain A, Recombinant Horseradish Peroxidase C1a Ala170gln Length = 309 Back     alignment and structure
>pdb|6ATJ|A Chain A, Recombinant Horseradish Peroxidase C Complex With Ferulic Acid Length = 308 Back     alignment and structure
>pdb|2ATJ|A Chain A, Recombinant Horseradish Peroxidase Complex With Benzhydroxamic Acid Length = 308 Back     alignment and structure
>pdb|2YLJ|A Chain A, Horse Radish Peroxidase, Mutant S167y Length = 306 Back     alignment and structure
>pdb|4ATJ|A Chain A, Distal Heme Pocket Mutant (H42e) Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid Length = 309 Back     alignment and structure
>pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 Back     alignment and structure
>pdb|1QGJ|A Chain A, Arabidopsis Thaliana Peroxidase N Length = 300 Back     alignment and structure
>pdb|1KZM|A Chain A, Distal Heme Pocket Mutant (r38s/h42e) Of Recombinant Horseradish Peroxidase C (hrp C) Length = 308 Back     alignment and structure
>pdb|3HDL|A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree Length = 304 Back     alignment and structure
>pdb|1BGP|A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 3e-58
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 4e-58
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 4e-58
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 6e-58
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 2e-57
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 6e-55
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 5e-53
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 3e-25
2vcn_A 261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 9e-20
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 3e-14
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 4e-14
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 1e-13
2e39_A 344 Peroxidase; heme protein, coordination geometry of 4e-13
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 6e-13
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 Back     alignment and structure
 Score =  181 bits (461), Expect = 3e-58
 Identities = 53/97 (54%), Positives = 68/97 (70%)

Query: 29  LVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGM 88
           L   +Y  TCP A  I+R  ++ A+  D R+ ASL+RLHFHDCF+ GCDA +LL+  G +
Sbjct: 3   LNATFYSGTCPNASAIVRSTIQQALQSDTRIGASLIRLHFHDCFVNGCDASILLDDTGSI 62

Query: 89  VTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCA 125
            +EK AGPNVNS RGF V+D IK  LE+ACP  VSC+
Sbjct: 63  QSEKNAGPNVNSARGFNVVDNIKTALENACPGVVSCS 99
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 Back     alignment and structure
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 Back     alignment and structure
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 Back     alignment and structure
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 Back     alignment and structure
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 100.0
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 100.0
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 100.0
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 100.0
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 100.0
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 100.0
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 100.0
3rrw_A 268 Thylakoid lumenal 29 kDa protein, chloroplastic; c 99.94
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 99.88
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 99.87
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 99.86
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 99.86
2vcn_A 261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 99.86
2e39_A 344 Peroxidase; heme protein, coordination geometry of 99.86
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 99.83
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 99.8
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 99.8
3riv_A 271 Ascorbate peroxidase; alpha helical bundle, heme p 99.78
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 99.78
1u2k_A 309 Peroxidase/catalase HPI; KATG, catalase-peroxidase 99.72
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 99.71
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 99.71
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 99.68
3e2o_A 294 CCP, cytochrome C peroxidase; cytochrome C peroxid 99.56
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 99.54
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 99.5
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 99.46
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 99.35
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 99.22
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 99.2
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 Back     alignment and structure
Probab=100.00  E-value=1.2e-47  Score=316.03  Aligned_cols=100  Identities=48%  Similarity=0.837  Sum_probs=97.2

Q ss_pred             CCcCcccCCCccHHHHHHHHHHHHHHhccccccchhheeeccccccccCchhhhhcCCCCcccccCCCCCCccchHHHHH
Q 040977           29 LVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVID  108 (128)
Q Consensus        29 L~~~fY~~sCP~~E~iV~~~v~~~~~~d~~~aa~lLRL~FHDCFV~GCDaSiLLd~~~~~~~ek~a~~n~~~lrgf~~Id  108 (128)
                      |+++||++|||++|+|||+.|++++++||+++|++||||||||||+|||||||||+++++.+||++++|.++|||||+||
T Consensus         2 L~~~fY~~sCP~~e~iVr~~v~~~~~~d~~~aa~llRL~FHDCfv~GCDgSiLld~t~~~~~Ek~~~~N~~~lrgf~vid   81 (304)
T 3hdl_A            2 LQIGFYNTSCPTAESLVQQAVAAAFANNSGIAPGLIRMHFHDCFVRGCDASVLLDSTANNTAEKDAIPNNPSLRGFEVIT   81 (304)
T ss_dssp             CEETTTTTTCTTHHHHHHHHHHHHHHHCTTHHHHHHHHHHHHHTTTSSSSGGGCCCBTTBCCGGGSTTTTTTCCCHHHHH
T ss_pred             CccChhhCcCcCHHHHHHHHHHHHHHhCCcchHHHHHHheecccCCCCCeeeeecCCCCCcccccCCCcccchHHHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999988889999999986899999999


Q ss_pred             HHHHHHhhhCCCcccccccC
Q 040977          109 EIKFILEDACPHTVSCALIF  128 (128)
Q Consensus       109 ~iKa~lE~~CPg~VSCADIl  128 (128)
                      +||++||+.|||+|||||||
T Consensus        82 ~iK~~le~~Cp~~VScADil  101 (304)
T 3hdl_A           82 AAKSAVEAACPQTVSCADIL  101 (304)
T ss_dssp             HHHHHHHHHSTTTSCHHHHH
T ss_pred             HHHHHHHhhCCCCccHHHHH
Confidence            99999999999999999995
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Back     alignment and structure
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Back     alignment and structure
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Back     alignment and structure
>3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Back     alignment and structure
>3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* Back     alignment and structure
>1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1fhfa_ 304 a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m 4e-46
d1pa2a_ 306 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 2e-45
d1gwua_ 307 a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor 4e-45
d1scha_ 294 a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy 4e-45
d1qgja_ 300 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 4e-43
d1bgpa_ 309 a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu 1e-40
d1yyda1 357 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { 7e-18
d1llpa_ 343 a.93.1.1 (A:) Fungal peroxidase (ligninase) {White 8e-17
d2e39a1 336 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { 2e-15
d1oafa_ 250 a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci 1e-13
d1iyna_ 275 a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco 9e-13
d2euta1 291 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B 9e-06
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 Back     information, alignment and structure

class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Plant peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

 Score =  149 bits (376), Expect = 4e-46
 Identities = 48/99 (48%), Positives = 70/99 (70%)

Query: 29  LVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGM 88
           L   +Y+ETCP    I+  ++ +A   DPR+ ASL+RLHFHDCF+ GCD  VLL +   +
Sbjct: 2   LTPTFYRETCPNLFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTI 61

Query: 89  VTEKQAGPNVNSVRGFEVIDEIKFILEDACPHTVSCALI 127
            +E+ A PN+NS+RG +V+++IK  +E++CP TVSCA I
Sbjct: 62  ESEQDALPNINSIRGLDVVNDIKTAVENSCPDTVSCADI 100
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 Back     information, alignment and structure
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 Back     information, alignment and structure
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 Back     information, alignment and structure
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1fhfa_ 304 Plant peroxidase {Soybean (Glycine max) [TaxId: 38 100.0
d1pa2a_ 306 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1gwua_ 307 Plant peroxidase {Horseradish (Armoracia rusticana 100.0
d1bgpa_ 309 Plant peroxidase {Barley (Hordeum vulgare), peroxi 100.0
d1scha_ 294 Plant peroxidase {Peanut (Arachis hypogaea) [TaxId 100.0
d1qgja_ 300 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1oafa_ 250 Ascorbate peroxidase {Soybean (Glycine max) [TaxId 99.9
d1yyda1 357 Fungal peroxidase (ligninase) {Basidomycetos fungu 99.88
d1llpa_ 343 Fungal peroxidase (ligninase) {White rot basidiomy 99.86
d2e39a1 336 Fungal peroxidase (ligninase) {Arthromyces ramosus 99.84
d1iyna_ 275 Ascorbate peroxidase {Common tobacco (Nicotiana ta 99.78
d2euta1 291 Cytochrome c peroxidase, CCP {Baker's yeast (Sacch 99.5
d1u2ka_ 292 Catalase-peroxidase KatG {Burkholderia pseudomalle 81.56
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Plant peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

Probab=100.00  E-value=3.1e-47  Score=310.50  Aligned_cols=101  Identities=48%  Similarity=0.891  Sum_probs=98.2

Q ss_pred             CCCcCcccCCCccHHHHHHHHHHHHHHhccccccchhheeeccccccccCchhhhhcCCCCcccccCCCCCCccchHHHH
Q 040977           28 VLVQDYYKETCPLAEEIMRRIVENAVVKDPRMAASLLRLHFHDCFLMGCDALVLLESYGGMVTEKQAGPNVNSVRGFEVI  107 (128)
Q Consensus        28 ~L~~~fY~~sCP~~E~iV~~~v~~~~~~d~~~aa~lLRL~FHDCFV~GCDaSiLLd~~~~~~~ek~a~~n~~~lrgf~~I  107 (128)
                      ||+.+||++|||++|+||+++|++.+.+||+++|++||||||||||+||||||||+++++..+|+++.+|.++++||++|
T Consensus         1 qL~~~~Y~~sCp~~e~iV~~~v~~~~~~d~~~aa~llRL~FHDCfv~GCDgSill~~~~~~~~E~~~~~N~~~~~g~~~i   80 (304)
T d1fhfa_           1 QLTPTFYRETCPNLFPIVFGVIFDASFTDPRIGASLMRLHFHDCFVQGCDGSVLLNNTDTIESEQDALPNINSIRGLDVV   80 (304)
T ss_dssp             CCBTTTTTTTSTTHHHHHHHHHHHTTSSCTTHHHHHHHHHHHHHTTTCSSSGGGCCCCSSCCCGGGSTTTTTTCCCHHHH
T ss_pred             CCCCccccccCcCHHHHHHHHHHHHHHhCCchhHHHHHHHHHhhccCCCCeeEeecCCCCccccccCCcccccchhHHHH
Confidence            89999999999999999999999999999999999999999999999999999999988888999999998668999999


Q ss_pred             HHHHHHHhhhCCCcccccccC
Q 040977          108 DEIKFILEDACPHTVSCALIF  128 (128)
Q Consensus       108 d~iKa~lE~~CPg~VSCADIl  128 (128)
                      |.||++||..||++|||||||
T Consensus        81 d~iK~~le~~cp~~VScADIl  101 (304)
T d1fhfa_          81 NDIKTAVENSCPDTVSCADIL  101 (304)
T ss_dssp             HHHHHHHHTTSTTTSCHHHHH
T ss_pred             HHHHHHHHhhCCCccCHHHHH
Confidence            999999999999999999995
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Back     information, alignment and structure
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Back     information, alignment and structure
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure