Citrus Sinensis ID: 040998


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPENGDGEEPQDENGKKT
ccccccEEEEEEEEcccccccccccHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEccEEEEEEccccccccccccccccccccccccccccccccccccc
ccHHccEEEEEEEEcccccHcccHHHHHHHHHHcccEEEEEccccccccccEEEEEEEEEccccccEEEEEcccEEEEEEcccccHHHccccccccccccccccccccccHcccccc
TSDKIDSMVAWIKlsnmphyyyhkkvlpMVGQVMGEVIhidfntrsasRRKFVRIAVKIALDKPLCLQFLldgriqkveyeslpincfncgkyghvsigcpengdgeepqdengkkt
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIdfntrsasrrKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCpengdgeepqdengkkt
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPENGDGEEPQDENGKKT
******SMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGC*****************
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGC*****************
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPEN**************
*SDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSI*C*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPENGDGEEPQDENGKKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
332322109 678 hypothetical protein [Beta vulgaris subs 0.820 0.141 0.375 6e-14
87116463 1898 unnamed protein product [Ipomoea batatas 0.837 0.051 0.367 2e-13
25555597387 hypothetical protein RCOM_0935160 [Ricin 0.743 1.0 0.425 3e-13
15226168 515 zinc ion binding / nucleic acid binding 0.863 0.196 0.356 4e-13
158828302 496 gag non-LTR retrotransposase [Arabidopsi 0.854 0.201 0.35 2e-12
87116458 532 unnamed protein product [Ipomoea batatas 0.837 0.184 0.346 2e-12
357477937 484 hypothetical protein MTR_4g113700 [Medic 0.974 0.235 0.333 3e-12
357445233 504 hypothetical protein MTR_2g005460 [Medic 0.940 0.218 0.336 4e-12
3327393 409 putative Ta11-like non-LTR retroelement 0.888 0.254 0.307 5e-12
356562050 470 PREDICTED: uncharacterized protein LOC10 0.837 0.208 0.377 7e-12
>gi|332322109|emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Back     alignment and taxonomy information
 Score = 81.6 bits (200), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 58/96 (60%)

Query: 5   IDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKP 64
           I  + AW+++ ++   Y+ K+ L  +G  +G+VI ID NT S  R ++VR  +++ L KP
Sbjct: 220 IKKLTAWVRIPHLSVEYFDKQFLHSIGSKIGKVIKIDRNTESMDRGQYVRFCIEVDLSKP 279

Query: 65  LCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGC 100
           L  +F L+G++  V+YE L + CF CG  GH    C
Sbjct: 280 LLSKFRLNGKVWIVQYEGLRLICFKCGHLGHKEDTC 315




Source: Beta vulgaris subsp. vulgaris

Species: Beta vulgaris

Genus: Beta

Family: Amaranthaceae

Order: Caryophyllales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|87116463|dbj|BAE79384.1| unnamed protein product [Ipomoea batatas] Back     alignment and taxonomy information
>gi|255555973|ref|XP_002519021.1| hypothetical protein RCOM_0935160 [Ricinus communis] gi|223541684|gb|EEF43232.1| hypothetical protein RCOM_0935160 [Ricinus communis] Back     alignment and taxonomy information
>gi|15226168|ref|NP_178215.1| zinc ion binding / nucleic acid binding [Arabidopsis thaliana] gi|6598620|gb|AAF18653.1| hypothetical protein [Arabidopsis thaliana] gi|330250297|gb|AEC05391.1| zinc ion binding / nucleic acid binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|158828302|gb|ABW81177.1| gag non-LTR retrotransposase [Arabidopsis cebennensis] Back     alignment and taxonomy information
>gi|87116458|dbj|BAE79381.1| unnamed protein product [Ipomoea batatas] Back     alignment and taxonomy information
>gi|357477937|ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula] gi|355510309|gb|AES91451.1| hypothetical protein MTR_4g113700 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357445233|ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula] gi|92893902|gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula] gi|355481942|gb|AES63145.1| hypothetical protein MTR_2g005460 [Medicago truncatula] Back     alignment and taxonomy information
>gi|3327393|gb|AAC26675.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356562050|ref|XP_003549288.1| PREDICTED: uncharacterized protein LOC100791212 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query117
TAIR|locus:2045756 515 AT2G01050 [Arabidopsis thalian 0.863 0.196 0.356 2e-14
TAIR|locus:1009023409 361 AT5G36228 [Arabidopsis thalian 0.957 0.310 0.273 5.3e-08
TAIR|locus:2099826336 AT3G31430 "AT3G31430" [Arabido 0.880 0.306 0.259 1.6e-06
TAIR|locus:1006230619 367 AT5G18636 "AT5G18636" [Arabido 0.777 0.247 0.239 4.8e-05
TAIR|locus:2146990 367 AT5G25200 "AT5G25200" [Arabido 0.777 0.247 0.239 4.8e-05
TAIR|locus:2827815307 AT2G17920 [Arabidopsis thalian 0.777 0.296 0.218 5.8e-05
TAIR|locus:4515102790 403 AT2G02103 "AT2G02103" [Arabido 0.777 0.225 0.229 0.00019
TAIR|locus:2076106 262 AT3G24070 [Arabidopsis thalian 0.760 0.339 0.247 0.00042
UNIPROTKB|F8VXY6133 ZCRB1 "Zinc finger CCHC-type a 0.572 0.503 0.324 0.00045
TAIR|locus:2062652 367 AT2G41590 "AT2G41590" [Arabido 0.777 0.247 0.218 0.00045
TAIR|locus:2045756 AT2G01050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 193 (73.0 bits), Expect = 2.0e-14, P = 2.0e-14
 Identities = 36/101 (35%), Positives = 59/101 (58%)

Query:     3 DKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALD 62
             D I +   W++LSN+P+ YYH+ +L  + + +G  + +D NT +  + +F R+ +++ L 
Sbjct:   159 DDIVTTPVWVRLSNIPYNYYHRCLLMEIARGLGRPLKVDMNTINFDKGRFARVCIEVNLA 218

Query:    63 KPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPEN 103
             KPL    L++G    V YE L   C +CG YGH+   CP N
Sbjct:   219 KPLKGTVLINGDRYFVAYEGLSKICSSCGIYGHLVHSCPRN 259




GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:1009023409 AT5G36228 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099826 AT3G31430 "AT3G31430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1006230619 AT5G18636 "AT5G18636" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146990 AT5G25200 "AT5G25200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827815 AT2G17920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102790 AT2G02103 "AT2G02103" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076106 AT3G24070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F8VXY6 ZCRB1 "Zinc finger CCHC-type and RNA-binding motif-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2062652 AT2G41590 "AT2G41590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT3G45253
transposable element gene; non-LTR retrotransposon family (LINE), has a 3.0e-48 P-value blast match to GB-AAA67727 reverse transcriptase (LINE-element) (Mus musculus) (1751 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query117
pfam14111153 pfam14111, DUF4283, Domain of unknown function (DU 4e-11
pfam1439249 pfam14392, zf-CCHC_4, Zinc knuckle 3e-06
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 0.004
>gnl|CDD|222549 pfam14111, DUF4283, Domain of unknown function (DUF4283) Back     alignment and domain information
 Score = 56.1 bits (136), Expect = 4e-11
 Identities = 13/58 (22%), Positives = 32/58 (55%)

Query: 1   TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVK 58
           + +++  +  W+++  +P + + +++L  +G   G  + +D +T    R +F RI VK
Sbjct: 96  SEEELKRIPVWVRIYGLPLHLWSEEILKRIGSACGGFVAVDEDTEGRERLQFARILVK 153


This domain family is found in plants, and is approximately 100 amino acids in length. Considering the very diverse range of other domains it is associated with it is possible that this domain is a binding/guiding region. There are two highly conserved tryptophan residues. Length = 153

>gnl|CDD|222730 pfam14392, zf-CCHC_4, Zinc knuckle Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 117
PF1439249 zf-CCHC_4: Zinc knuckle 99.63
PF14111153 DUF4283: Domain of unknown function (DUF4283) 99.58
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 97.54
PF1369632 zf-CCHC_2: Zinc knuckle 96.57
smart0034326 ZnF_C2HC zinc finger. 94.65
PF1528840 zf-CCHC_6: Zinc knuckle 94.15
PF1391742 zf-CCHC_3: Zinc knuckle 92.67
COG5082190 AIR1 Arginine methyltransferase-interacting protei 90.51
COG5082190 AIR1 Arginine methyltransferase-interacting protei 89.94
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 89.7
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 89.62
PTZ00368148 universal minicircle sequence binding protein (UMS 88.39
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 87.86
KOG2044 931 consensus 5'-3' exonuclease HKE1/RAT1 [Replication 84.5
COG5222 427 Uncharacterized conserved protein, contains RING Z 83.77
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
Probab=99.63  E-value=1.8e-16  Score=91.83  Aligned_cols=44  Identities=43%  Similarity=0.889  Sum_probs=40.0

Q ss_pred             EccCCCceeEEEEe---ce--EEEEeeccCCcccccccccccCCCCCCC
Q 040998           59 IALDKPLCLQFLLD---GR--IQKVEYESLPINCFNCGKYGHVSIGCPE  102 (117)
Q Consensus        59 idl~kPL~~~v~v~---g~--~~~v~YE~lp~~C~~Cg~~GH~~~~C~~  102 (117)
                      +|+++||...+.+.   |.  ++.|+|||||.||++||.+||..++|++
T Consensus         1 id~~kPL~~~i~v~~~~g~~~~~~v~YE~lp~~C~~C~~~gH~~~~C~k   49 (49)
T PF14392_consen    1 IDVSKPLRREIKVKFPEGESFWVKVKYERLPRFCFHCGRIGHSDKECPK   49 (49)
T ss_pred             CCCCCcccceEEEEeCCCcEEEEEEEECCcChhhcCCCCcCcCHhHcCC
Confidence            58999999998885   43  6899999999999999999999999985



>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 97.32
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 97.21
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 96.93
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 96.89
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 96.61
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 96.06
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 95.96
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 95.82
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 95.73
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 95.55
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 95.55
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 95.54
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 95.54
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 95.5
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 95.43
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 95.41
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 95.22
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 94.95
2hqh_E26 Restin; beta/BETA structure, zinc finger motif, st 94.9
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 94.46
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 94.36
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 94.15
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 93.49
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 92.99
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 92.84
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 92.08
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 91.97
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 90.41
2pzo_E42 CAP-Gly domain-containing linker protein 1; struct 88.19
4ayb_H84 DNA-directed RNA polymerase; transferase, multi-su 81.41
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hqh_E Restin; beta/BETA structure, zinc finger motif, structural protein, binding; 1.80A {Homo sapiens} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4ayb_H DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2wb1_H 2y0s_H 2waq_H 4b1o_H 4b1p_Z 2pmz_H 3hkz_H Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 117
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 0.001
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure

class: Small proteins
fold: Retrovirus zinc finger-like domains
superfamily: Retrovirus zinc finger-like domains
family: Retrovirus zinc finger-like domains
domain: HIV nucleocapsid
species: Human immunodeficiency virus type 1, different isolates [TaxId: 11676]
 Score = 32.1 bits (73), Expect = 0.001
 Identities = 9/18 (50%), Positives = 11/18 (61%)

Query: 85  INCFNCGKYGHVSIGCPE 102
           + CFNCGK GH +  C  
Sbjct: 2   VKCFNCGKEGHTARNCRA 19


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query117
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 97.42
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.38
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 96.67
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 96.09
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 93.97
d1hmja_68 RNA polymerase subunit RBP5 (RNA polymerase subuni 91.23
d1dzfa272 Eukaryotic RPB5 C-terminal domain {Baker's yeast ( 89.78
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 88.89
d1eika_77 RNA polymerase subunit RBP5 (RNA polymerase subuni 86.05
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
class: Small proteins
fold: Retrovirus zinc finger-like domains
superfamily: Retrovirus zinc finger-like domains
family: Retrovirus zinc finger-like domains
domain: HIV nucleocapsid
species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=97.42  E-value=3.4e-05  Score=37.09  Aligned_cols=24  Identities=38%  Similarity=0.769  Sum_probs=19.9

Q ss_pred             cCCcccccccccccCCCCCCCCCC
Q 040998           82 SLPINCFNCGKYGHVSIGCPENGD  105 (117)
Q Consensus        82 ~lp~~C~~Cg~~GH~~~~C~~~~~  105 (117)
                      +-+..||+||+.||..++|.-+..
T Consensus         4 r~~ikCfNCGkeGH~ar~CrAPRk   27 (29)
T d1nc8a_           4 RKVIRCWNCGKEGHSARQCRAPRR   27 (29)
T ss_dssp             CCCCBCTTTSCBSSCGGGCCSSSS
T ss_pred             cceeEeecCCccchhhhhccCccc
Confidence            345789999999999999986643



>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1hmja_ d.78.1.1 (A:) RNA polymerase subunit RBP5 (RNA polymerase subunit H) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dzfa2 d.78.1.1 (A:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1eika_ d.78.1.1 (A:) RNA polymerase subunit RBP5 (RNA polymerase subunit H) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure