Citrus Sinensis ID: 040998
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| 332322109 | 678 | hypothetical protein [Beta vulgaris subs | 0.820 | 0.141 | 0.375 | 6e-14 | |
| 87116463 | 1898 | unnamed protein product [Ipomoea batatas | 0.837 | 0.051 | 0.367 | 2e-13 | |
| 255555973 | 87 | hypothetical protein RCOM_0935160 [Ricin | 0.743 | 1.0 | 0.425 | 3e-13 | |
| 15226168 | 515 | zinc ion binding / nucleic acid binding | 0.863 | 0.196 | 0.356 | 4e-13 | |
| 158828302 | 496 | gag non-LTR retrotransposase [Arabidopsi | 0.854 | 0.201 | 0.35 | 2e-12 | |
| 87116458 | 532 | unnamed protein product [Ipomoea batatas | 0.837 | 0.184 | 0.346 | 2e-12 | |
| 357477937 | 484 | hypothetical protein MTR_4g113700 [Medic | 0.974 | 0.235 | 0.333 | 3e-12 | |
| 357445233 | 504 | hypothetical protein MTR_2g005460 [Medic | 0.940 | 0.218 | 0.336 | 4e-12 | |
| 3327393 | 409 | putative Ta11-like non-LTR retroelement | 0.888 | 0.254 | 0.307 | 5e-12 | |
| 356562050 | 470 | PREDICTED: uncharacterized protein LOC10 | 0.837 | 0.208 | 0.377 | 7e-12 |
| >gi|332322109|emb|CCA66008.1| hypothetical protein [Beta vulgaris subsp. vulgaris] | Back alignment and taxonomy information |
|---|
Score = 81.6 bits (200), Expect = 6e-14, Method: Compositional matrix adjust.
Identities = 36/96 (37%), Positives = 58/96 (60%)
Query: 5 IDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALDKP 64
I + AW+++ ++ Y+ K+ L +G +G+VI ID NT S R ++VR +++ L KP
Sbjct: 220 IKKLTAWVRIPHLSVEYFDKQFLHSIGSKIGKVIKIDRNTESMDRGQYVRFCIEVDLSKP 279
Query: 65 LCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGC 100
L +F L+G++ V+YE L + CF CG GH C
Sbjct: 280 LLSKFRLNGKVWIVQYEGLRLICFKCGHLGHKEDTC 315
|
Source: Beta vulgaris subsp. vulgaris Species: Beta vulgaris Genus: Beta Family: Amaranthaceae Order: Caryophyllales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|87116463|dbj|BAE79384.1| unnamed protein product [Ipomoea batatas] | Back alignment and taxonomy information |
|---|
| >gi|255555973|ref|XP_002519021.1| hypothetical protein RCOM_0935160 [Ricinus communis] gi|223541684|gb|EEF43232.1| hypothetical protein RCOM_0935160 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|15226168|ref|NP_178215.1| zinc ion binding / nucleic acid binding [Arabidopsis thaliana] gi|6598620|gb|AAF18653.1| hypothetical protein [Arabidopsis thaliana] gi|330250297|gb|AEC05391.1| zinc ion binding / nucleic acid binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|158828302|gb|ABW81177.1| gag non-LTR retrotransposase [Arabidopsis cebennensis] | Back alignment and taxonomy information |
|---|
| >gi|87116458|dbj|BAE79381.1| unnamed protein product [Ipomoea batatas] | Back alignment and taxonomy information |
|---|
| >gi|357477937|ref|XP_003609254.1| hypothetical protein MTR_4g113700 [Medicago truncatula] gi|355510309|gb|AES91451.1| hypothetical protein MTR_4g113700 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357445233|ref|XP_003592894.1| hypothetical protein MTR_2g005460 [Medicago truncatula] gi|92893902|gb|ABE91952.1| Zinc finger, CCHC-type [Medicago truncatula] gi|355481942|gb|AES63145.1| hypothetical protein MTR_2g005460 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|3327393|gb|AAC26675.1| putative Ta11-like non-LTR retroelement protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356562050|ref|XP_003549288.1| PREDICTED: uncharacterized protein LOC100791212 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 117 | ||||||
| TAIR|locus:2045756 | 515 | AT2G01050 [Arabidopsis thalian | 0.863 | 0.196 | 0.356 | 2e-14 | |
| TAIR|locus:1009023409 | 361 | AT5G36228 [Arabidopsis thalian | 0.957 | 0.310 | 0.273 | 5.3e-08 | |
| TAIR|locus:2099826 | 336 | AT3G31430 "AT3G31430" [Arabido | 0.880 | 0.306 | 0.259 | 1.6e-06 | |
| TAIR|locus:1006230619 | 367 | AT5G18636 "AT5G18636" [Arabido | 0.777 | 0.247 | 0.239 | 4.8e-05 | |
| TAIR|locus:2146990 | 367 | AT5G25200 "AT5G25200" [Arabido | 0.777 | 0.247 | 0.239 | 4.8e-05 | |
| TAIR|locus:2827815 | 307 | AT2G17920 [Arabidopsis thalian | 0.777 | 0.296 | 0.218 | 5.8e-05 | |
| TAIR|locus:4515102790 | 403 | AT2G02103 "AT2G02103" [Arabido | 0.777 | 0.225 | 0.229 | 0.00019 | |
| TAIR|locus:2076106 | 262 | AT3G24070 [Arabidopsis thalian | 0.760 | 0.339 | 0.247 | 0.00042 | |
| UNIPROTKB|F8VXY6 | 133 | ZCRB1 "Zinc finger CCHC-type a | 0.572 | 0.503 | 0.324 | 0.00045 | |
| TAIR|locus:2062652 | 367 | AT2G41590 "AT2G41590" [Arabido | 0.777 | 0.247 | 0.218 | 0.00045 |
| TAIR|locus:2045756 AT2G01050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 193 (73.0 bits), Expect = 2.0e-14, P = 2.0e-14
Identities = 36/101 (35%), Positives = 59/101 (58%)
Query: 3 DKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVKIALD 62
D I + W++LSN+P+ YYH+ +L + + +G + +D NT + + +F R+ +++ L
Sbjct: 159 DDIVTTPVWVRLSNIPYNYYHRCLLMEIARGLGRPLKVDMNTINFDKGRFARVCIEVNLA 218
Query: 63 KPLCLQFLLDGRIQKVEYESLPINCFNCGKYGHVSIGCPEN 103
KPL L++G V YE L C +CG YGH+ CP N
Sbjct: 219 KPLKGTVLINGDRYFVAYEGLSKICSSCGIYGHLVHSCPRN 259
|
|
| TAIR|locus:1009023409 AT5G36228 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099826 AT3G31430 "AT3G31430" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1006230619 AT5G18636 "AT5G18636" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146990 AT5G25200 "AT5G25200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2827815 AT2G17920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:4515102790 AT2G02103 "AT2G02103" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2076106 AT3G24070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VXY6 ZCRB1 "Zinc finger CCHC-type and RNA-binding motif-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062652 AT2G41590 "AT2G41590" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| AT3G45253 | transposable element gene; non-LTR retrotransposon family (LINE), has a 3.0e-48 P-value blast match to GB-AAA67727 reverse transcriptase (LINE-element) (Mus musculus) (1751 aa) | |||||||
(Arabidopsis thaliana) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 117 | |||
| pfam14111 | 153 | pfam14111, DUF4283, Domain of unknown function (DU | 4e-11 | |
| pfam14392 | 49 | pfam14392, zf-CCHC_4, Zinc knuckle | 3e-06 | |
| pfam00098 | 18 | pfam00098, zf-CCHC, Zinc knuckle | 0.004 |
| >gnl|CDD|222549 pfam14111, DUF4283, Domain of unknown function (DUF4283) | Back alignment and domain information |
|---|
Score = 56.1 bits (136), Expect = 4e-11
Identities = 13/58 (22%), Positives = 32/58 (55%)
Query: 1 TSDKIDSMVAWIKLSNMPHYYYHKKVLPMVGQVMGEVIHIDFNTRSASRRKFVRIAVK 58
+ +++ + W+++ +P + + +++L +G G + +D +T R +F RI VK
Sbjct: 96 SEEELKRIPVWVRIYGLPLHLWSEEILKRIGSACGGFVAVDEDTEGRERLQFARILVK 153
|
This domain family is found in plants, and is approximately 100 amino acids in length. Considering the very diverse range of other domains it is associated with it is possible that this domain is a binding/guiding region. There are two highly conserved tryptophan residues. Length = 153 |
| >gnl|CDD|222730 pfam14392, zf-CCHC_4, Zinc knuckle | Back alignment and domain information |
|---|
| >gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| PF14392 | 49 | zf-CCHC_4: Zinc knuckle | 99.63 | |
| PF14111 | 153 | DUF4283: Domain of unknown function (DUF4283) | 99.58 | |
| PF00098 | 18 | zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi | 97.54 | |
| PF13696 | 32 | zf-CCHC_2: Zinc knuckle | 96.57 | |
| smart00343 | 26 | ZnF_C2HC zinc finger. | 94.65 | |
| PF15288 | 40 | zf-CCHC_6: Zinc knuckle | 94.15 | |
| PF13917 | 42 | zf-CCHC_3: Zinc knuckle | 92.67 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 90.51 | |
| COG5082 | 190 | AIR1 Arginine methyltransferase-interacting protei | 89.94 | |
| KOG0109 | 346 | consensus RNA-binding protein LARK, contains RRM a | 89.7 | |
| PF14787 | 36 | zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: | 89.62 | |
| PTZ00368 | 148 | universal minicircle sequence binding protein (UMS | 88.39 | |
| KOG4400 | 261 | consensus E3 ubiquitin ligase interacting with arg | 87.86 | |
| KOG2044 | 931 | consensus 5'-3' exonuclease HKE1/RAT1 [Replication | 84.5 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 83.77 |
| >PF14392 zf-CCHC_4: Zinc knuckle | Back alignment and domain information |
|---|
Probab=99.63 E-value=1.8e-16 Score=91.83 Aligned_cols=44 Identities=43% Similarity=0.889 Sum_probs=40.0
Q ss_pred EccCCCceeEEEEe---ce--EEEEeeccCCcccccccccccCCCCCCC
Q 040998 59 IALDKPLCLQFLLD---GR--IQKVEYESLPINCFNCGKYGHVSIGCPE 102 (117)
Q Consensus 59 idl~kPL~~~v~v~---g~--~~~v~YE~lp~~C~~Cg~~GH~~~~C~~ 102 (117)
+|+++||...+.+. |. ++.|+|||||.||++||.+||..++|++
T Consensus 1 id~~kPL~~~i~v~~~~g~~~~~~v~YE~lp~~C~~C~~~gH~~~~C~k 49 (49)
T PF14392_consen 1 IDVSKPLRREIKVKFPEGESFWVKVKYERLPRFCFHCGRIGHSDKECPK 49 (49)
T ss_pred CCCCCcccceEEEEeCCCcEEEEEEEECCcChhhcCCCCcCcCHhHcCC
Confidence 58999999998885 43 6899999999999999999999999985
|
|
| >PF14111 DUF4283: Domain of unknown function (DUF4283) | Back alignment and domain information |
|---|
| >PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13696 zf-CCHC_2: Zinc knuckle | Back alignment and domain information |
|---|
| >smart00343 ZnF_C2HC zinc finger | Back alignment and domain information |
|---|
| >PF15288 zf-CCHC_6: Zinc knuckle | Back alignment and domain information |
|---|
| >PF13917 zf-CCHC_3: Zinc knuckle | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A | Back alignment and domain information |
|---|
| >PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional | Back alignment and domain information |
|---|
| >KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| 1dsq_A | 26 | Nucleic acid binding protein P14; CCHC type zinc f | 97.32 | |
| 1a6b_B | 40 | Momulv, zinc finger protein NCP10; nucleocapsid pr | 97.21 | |
| 1nc8_A | 29 | Nucleocapsid protein; HIV-2, RNA recognition, zinc | 96.93 | |
| 1u6p_A | 56 | GAG polyprotein; MLV, A-minor K-turn, stem loop, b | 96.89 | |
| 2ysa_A | 55 | Retinoblastoma-binding protein 6; zinc finger, CCH | 96.61 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 96.06 | |
| 2ec7_A | 49 | GAG polyprotein (PR55GAG); nucleocapsid protein, H | 95.96 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 95.82 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 95.73 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 95.55 | |
| 2ihx_A | 61 | Nucleocapsid (NC) protein; protein-RNA complex, vi | 95.55 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 95.54 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 95.54 | |
| 2a51_A | 39 | Nucleocapsid protein; sivlhoest, structure, NCP8, | 95.5 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 95.43 | |
| 2bl6_A | 37 | Nucleocapsid protein P11; lentivirus, polyprotein, | 95.41 | |
| 1a1t_A | 55 | Nucleocapsid protein; stem-loop RNA, viral protein | 95.22 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 94.95 | |
| 2hqh_E | 26 | Restin; beta/BETA structure, zinc finger motif, st | 94.9 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 94.46 | |
| 2cqf_A | 63 | RNA-binding protein LIN-28; CCHC zinc-finger, stru | 94.36 | |
| 1cl4_A | 60 | Protein (GAG polyprotein); nucleocapsid protein, R | 94.15 | |
| 3nyb_B | 83 | Protein AIR2; polya RNA polymerase, zinc knuckle p | 93.49 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 92.99 | |
| 2li8_A | 74 | Protein LIN-28 homolog A; zinc finger, micro RNA, | 92.84 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 92.08 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 91.97 | |
| 2lli_A | 124 | Protein AIR2; RNA surveillance, RNA degradation, R | 90.41 | |
| 2pzo_E | 42 | CAP-Gly domain-containing linker protein 1; struct | 88.19 | |
| 4ayb_H | 84 | DNA-directed RNA polymerase; transferase, multi-su | 81.41 |
| >1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A | Back alignment and structure |
|---|
| >1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A | Back alignment and structure |
|---|
| >2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} | Back alignment and structure |
|---|
| >1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hqh_E Restin; beta/BETA structure, zinc finger motif, structural protein, binding; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A | Back alignment and structure |
|---|
| >3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ayb_H DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2wb1_H 2y0s_H 2waq_H 4b1o_H 4b1p_Z 2pmz_H 3hkz_H | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 117 | ||||
| d2exfa1 | 42 | g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod | 0.001 |
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 | Back information, alignment and structure |
|---|
class: Small proteins fold: Retrovirus zinc finger-like domains superfamily: Retrovirus zinc finger-like domains family: Retrovirus zinc finger-like domains domain: HIV nucleocapsid species: Human immunodeficiency virus type 1, different isolates [TaxId: 11676]
Score = 32.1 bits (73), Expect = 0.001
Identities = 9/18 (50%), Positives = 11/18 (61%)
Query: 85 INCFNCGKYGHVSIGCPE 102
+ CFNCGK GH + C
Sbjct: 2 VKCFNCGKEGHTARNCRA 19
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 117 | |||
| d1nc8a_ | 29 | HIV nucleocapsid {Human immunodeficiency virus typ | 97.42 | |
| d1dsqa_ | 26 | Nucleic acid binding protein p14 {Mouse mammary tu | 97.38 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 96.67 | |
| d2exfa1 | 42 | HIV nucleocapsid {Human immunodeficiency virus typ | 96.09 | |
| d1a6bb_ | 40 | Zinc finger protein ncp10 {Moloney murine leukemia | 93.97 | |
| d1hmja_ | 68 | RNA polymerase subunit RBP5 (RNA polymerase subuni | 91.23 | |
| d1dzfa2 | 72 | Eukaryotic RPB5 C-terminal domain {Baker's yeast ( | 89.78 | |
| d1cl4a_ | 32 | Nucleocapsid protein from mason-pfizer monkey viru | 88.89 | |
| d1eika_ | 77 | RNA polymerase subunit RBP5 (RNA polymerase subuni | 86.05 |
| >d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Retrovirus zinc finger-like domains superfamily: Retrovirus zinc finger-like domains family: Retrovirus zinc finger-like domains domain: HIV nucleocapsid species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=97.42 E-value=3.4e-05 Score=37.09 Aligned_cols=24 Identities=38% Similarity=0.769 Sum_probs=19.9
Q ss_pred cCCcccccccccccCCCCCCCCCC
Q 040998 82 SLPINCFNCGKYGHVSIGCPENGD 105 (117)
Q Consensus 82 ~lp~~C~~Cg~~GH~~~~C~~~~~ 105 (117)
+-+..||+||+.||..++|.-+..
T Consensus 4 r~~ikCfNCGkeGH~ar~CrAPRk 27 (29)
T d1nc8a_ 4 RKVIRCWNCGKEGHSARQCRAPRR 27 (29)
T ss_dssp CCCCBCTTTSCBSSCGGGCCSSSS
T ss_pred cceeEeecCCccchhhhhccCccc
Confidence 345789999999999999986643
|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} | Back information, alignment and structure |
|---|
| >d1hmja_ d.78.1.1 (A:) RNA polymerase subunit RBP5 (RNA polymerase subunit H) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dzfa2 d.78.1.1 (A:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} | Back information, alignment and structure |
|---|
| >d1eika_ d.78.1.1 (A:) RNA polymerase subunit RBP5 (RNA polymerase subunit H) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|