Citrus Sinensis ID: 041021

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
SLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
cccEEEEEccccccEEccccccccccccccccccccccccccEEEccccccccEEcccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccEEcccccccccccHHHHHccccccccccccccccccEEEccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEccccccHHcccccccccccccccccccEEEcc
cccEcEEcccHHHHHHHcccccccccccccccccEEccccccEEEHcccHcHHHHHccccccccHccccEEEEEcccccHHHcccHHHHHHHHHHcEEEEcccHcHHHHEEcccccccccccEEEcccccEEEEcccHHHHHHccccccccccccccEEEEccccccEEEccccccccccccccccccccccHHHHccccccccccccHccHHHHHHHcccccccccccccccEEEEEccHHHHHccccccccccccEEEEccccccHEcccHHHHHHHHHccEEEEccHHHHHHHHHHcccccccccEEccccEEEEcc
slvnlkvsgcpklEEIVGHVGQEVKENRIAFSKLKigfrdikylqlshfprlqeiwhgqalpvsfFNNLAQLVVddctnmssaipANLLWCLNnlawlevrncdsleevlhleelsadkehigplfpklselrlidlpklkrfcnftgniielpkleyliiencpdmetftsnSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFecsklqklvptswhlenlatlevskCHGLINlltlstseslVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
slvnlkvsgcpkleeivghvgqevkeNRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEElsadkehigplfPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLltlstseslvnLERMKITDCKMMEEIIQsqvgeeaedcIVFRKLECLGLD
SLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPanllwclnnlawlEVRNCDSleevlhleelSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
******VSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDN*********ENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLG**
SLVNLKVSGCPKLEEIVGHVGQEVK*******KLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHL************LFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSN*******TTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEII***********IVFRKLECLGLD
SLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
SLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SLVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVFRKLECLGLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.959 0.229 0.313 4e-25
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.965 0.125 0.274 8e-25
358344895 906 Resistance protein RGC2, partial [Medica 0.931 0.328 0.304 6e-24
357439633 1039 Rpp4 candidate [Medicago truncatula] gi| 0.903 0.278 0.282 1e-20
147787802 1517 hypothetical protein VITISV_005047 [Viti 0.953 0.201 0.277 1e-20
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.428 0.058 0.435 2e-20
359488025 1781 PREDICTED: uncharacterized protein LOC10 0.881 0.158 0.282 4e-19
296087869 1711 unnamed protein product [Vitis vinifera] 0.868 0.162 0.283 4e-19
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.765 0.182 0.314 4e-19
224111304 474 predicted protein [Populus trichocarpa] 0.775 0.523 0.297 9e-18
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  121 bits (304), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 114/364 (31%), Positives = 174/364 (47%), Gaps = 57/364 (15%)

Query: 2    LVNLKVSGCPKLEEIVGHVGQEVKENRIAFSKLKIGFRDIKYLQLSHFPRL--------- 52
            L  + ++ C  + EIV    +E+K+   A +     F +++YL L   P+L         
Sbjct: 842  LKEITMTRCKSMGEIVPQGRKEIKDGDDAVNVPL--FPELRYLTLQDLPKLINFCFEENL 899

Query: 53   -------------------QEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLN 93
                                E+W+GQ L +SF  NL  L++ +C ++    P++L   L 
Sbjct: 900  MLSKPVSTIAGRSTSLFNQAEVWNGQ-LSLSF-GNLRSLMMQNCMSLLKVFPSSLFQSLQ 957

Query: 94   NLAWLEVRNCDSLEEVLHLEELSADKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIEL 153
            NL  L+V NC+ LEE+  LE L+ D  H+G L PKL E+ L     L+        IIE+
Sbjct: 958  NLEVLKVENCNQLEEIFDLEGLNVDGGHVG-LLPKLEEMCLTGCIPLEELILDGSRIIEI 1016

Query: 154  -----P-----KLEYLIIENCPDMETFTSNSTFVLYMTTDN---------KEAQKLKS-- 192
                 P     +L  L I    D+     +S      T +          KE  +L+   
Sbjct: 1017 WQEQFPVESFCRLRVLSICEYRDILVVIPSSMLQRLHTLEKLTVRSCGSVKEVVQLEGLV 1076

Query: 193  -EENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSW 251
             EEN   A    L + +L+ L ++++LWKEN+     F NL+ L+I++C  L  LVP+S 
Sbjct: 1077 DEENHFRA-LARLRELELNDLPELKYLWKENSNVGPHFQNLEILKIWDCDNLMNLVPSSV 1135

Query: 252  HLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEIIQSQVGEEAEDCIVF 311
               NLA+L++S C  LINLL    ++SLV  +  KI    MM+E++ ++ GE A D I F
Sbjct: 1136 SFHNLASLDISYCCSLINLLPPLIAKSLVQHKIFKIGRSDMMKEVVANE-GENAGDEITF 1194

Query: 312  RKLE 315
             KLE
Sbjct: 1195 CKLE 1198

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358344895|ref|XP_003636521.1| Resistance protein RGC2, partial [Medicago truncatula] gi|355502456|gb|AES83659.1| Resistance protein RGC2, partial [Medicago truncatula] Back     alignment and taxonomy information
>gi|357439633|ref|XP_003590094.1| Rpp4 candidate [Medicago truncatula] gi|355479142|gb|AES60345.1| Rpp4 candidate [Medicago truncatula] Back     alignment and taxonomy information
>gi|147787802|emb|CAN71755.1| hypothetical protein VITISV_005047 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488025|ref|XP_003633688.1| PREDICTED: uncharacterized protein LOC100852821 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087869|emb|CBI35152.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111304|ref|XP_002332954.1| predicted protein [Populus trichocarpa] gi|222834266|gb|EEE72743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_329000001
cc-nbs-lrr resistance protein (2359 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.001
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 46.0 bits (109), Expect = 2e-05
 Identities = 64/266 (24%), Positives = 112/266 (42%), Gaps = 55/266 (20%)

Query: 40  DIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMS---SAIPANLLWCLN--- 93
           +++ L+LS    L E+       + + N L  L +  C N+    + I    L+ LN   
Sbjct: 658 NLETLKLSDCSSLVEL----PSSIQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSG 713

Query: 94  ------------NLAWLEVRNCDSLEEV---LHLE-------------ELSADKEHIGPL 125
                       N++WL++    ++EE    L LE             +L    + + PL
Sbjct: 714 CSRLKSFPDISTNISWLDLDET-AIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPL 772

Query: 126 F----PKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPDMETFTSNSTFVLYMT 181
                P L+ L L D+P L        +I  L KLE+L IENC ++ET  +        +
Sbjct: 773 MTMLSPSLTRLFLSDIPSL---VELPSSIQNLHKLEHLEIENCINLETLPTGINLESLES 829

Query: 182 TDNKEAQKLKSEENLLVANQIHLFDEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECS 241
            D     +L++  +  ++  I   +   +G+ +V   W E       F+NL  L++  C+
Sbjct: 830 LDLSGCSRLRTFPD--ISTNISDLNLSRTGIEEVP-WWIEK------FSNLSFLDMNGCN 880

Query: 242 KLQKLVPTSWHLENLATLEVSKCHGL 267
            LQ++      L++L T++ S C  L
Sbjct: 881 NLQRVSLNISKLKHLETVDFSDCGAL 906

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.67
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.64
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.47
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.43
KOG4341483 consensus F-box protein containing LRR [General fu 99.41
KOG4341483 consensus F-box protein containing LRR [General fu 99.25
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.03
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.68
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.66
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.61
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.54
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.51
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.44
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.4
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.4
PRK15386 426 type III secretion protein GogB; Provisional 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.26
PRK15386 426 type III secretion protein GogB; Provisional 98.18
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.13
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.03
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.97
KOG0472 565 consensus Leucine-rich repeat protein [Function un 97.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.92
KOG0617264 consensus Ras suppressor protein (contains leucine 97.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.86
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 97.76
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.75
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.71
KOG0617264 consensus Ras suppressor protein (contains leucine 97.67
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.44
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.41
KOG4237 498 consensus Extracellular matrix protein slit, conta 97.31
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.49
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 96.41
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.73
PLN03150623 hypothetical protein; Provisional 95.52
PLN03150623 hypothetical protein; Provisional 95.31
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 94.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 93.97
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.58
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 93.49
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.82
KOG2123 388 consensus Uncharacterized conserved protein [Funct 92.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.64
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 92.55
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 91.5
KOG2123388 consensus Uncharacterized conserved protein [Funct 90.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 89.65
KOG2982418 consensus Uncharacterized conserved protein [Funct 89.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 87.47
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 87.25
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 83.12
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=99.67  E-value=5.5e-16  Score=160.10  Aligned_cols=64  Identities=20%  Similarity=0.340  Sum_probs=39.3

Q ss_pred             CccceEEEccCCCcccccCCccCCCCccEEeecCccccccccCcchhhhccccCEEeEcccccccee
Q 041021          230 ANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCHGLINLLTLSTSESLVNLERMKITDCKMMEEI  296 (320)
Q Consensus       230 ~~L~~L~i~~c~~l~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~l~~L~~L~l~~C~~l~~~  296 (320)
                      ++|+.|++.+. .++.+|..+..+++|+.|++++|++++.++..  ...+++|+.+++++|+++.++
T Consensus       846 ~nL~~L~Ls~n-~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~--~~~L~~L~~L~l~~C~~L~~~  909 (1153)
T PLN03210        846 TNISDLNLSRT-GIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLN--ISKLKHLETVDFSDCGALTEA  909 (1153)
T ss_pred             cccCEeECCCC-CCccChHHHhcCCCCCEEECCCCCCcCccCcc--cccccCCCeeecCCCcccccc
Confidence            34555555543 44555555556677777777777777776552  245667777777777766544

syringae 6; Provisional
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 59.9 bits (144), Expect = 4e-10
 Identities = 50/244 (20%), Positives = 87/244 (35%), Gaps = 65/244 (26%)

Query: 93  NNLAWLEVRNCDSLEEVL-HLEELSADKEHIGPLFPKLSE------LRLIDL-PKLKRFC 144
             + WL ++NC+S E VL  L++L      I P +   S+      LR+  +  +L+R  
Sbjct: 182 FKIFWLNLKNCNSPETVLEMLQKLLY---QIDPNWTSRSDHSSNIKLRIHSIQAELRRL- 237

Query: 145 NFTGNIIELPKLE--YLIIENCPD---METFTSNSTFVLYMTTDNKEAQKLKSEENLLVA 199
                 ++    E   L++ N  +      F  +   +L +TT  K+       + L  A
Sbjct: 238 ------LKSKPYENCLLVLLNVQNAKAWNAFNLSCK-IL-LTTRFKQVT-----DFLSAA 284

Query: 200 NQIHLF-DEKLSGLHKVQHLWKENAESNKVFANLKSLEIFECSKLQKLVPTSWHLENLAT 258
              H+  D     L           E   +    K L+     + Q L P          
Sbjct: 285 TTTHISLDHHSMTLTP--------DEVKSLLL--KYLDC----RPQDL-P---------- 319

Query: 259 LEVSKCHGL-INLLTLSTSESLVNLERMKITDCKMMEEIIQSQVG--EEAE------DCI 309
            EV   +   ++++  S  + L   +  K  +C  +  II+S +   E AE         
Sbjct: 320 REVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLS 379

Query: 310 VFRK 313
           VF  
Sbjct: 380 VFPP 383
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.7
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.69
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.66
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.66
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.65
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.64
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.62
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.61
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.6
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.59
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.59
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.59
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.58
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.57
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.57
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.56
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.56
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.55
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.54
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.54
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.54
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.53
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.52
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.52
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.51
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.51
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.5
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.5
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.5
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.5
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.5
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.48
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.48
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.47
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.47
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.47
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.47
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.47
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.47
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.46
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.46
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.46
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.45
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.44
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.44
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.43
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.43
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.41
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.41
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.4
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.4
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.39
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.38
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.35
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.35
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.34
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.34
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.33
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.32
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.3
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.3
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.29
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.29
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.29
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.28
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.28
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.26
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.26
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.25
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.25
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.24
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.23
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.22
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.2
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.1
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.03
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.02
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.98
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.98
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.96
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.9
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.89
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.88
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.87
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.86
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.82
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.74
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.55
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.5
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.34
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.34
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.32
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.31
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.24
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.03
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.01
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.92
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.86
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.81
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.78
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.69
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.62
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.37
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.36
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.35
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.73
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 89.8
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 82.49
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.70  E-value=4e-16  Score=139.24  Aligned_cols=203  Identities=18%  Similarity=0.274  Sum_probs=128.9

Q ss_pred             cccccEEeecCCccchhhhcCCCCCCccCCCccEEeeccCcCccccCchhHHhhcccCCeEEEccCcccceecccccccc
Q 041021           38 FRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSA  117 (320)
Q Consensus        38 ~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~~~~  117 (320)
                      .++++.|+++++. +..++.    ....+++|++|++.++ .+.. +|.. +..+++|++|++++| .++.++..     
T Consensus        80 ~~~l~~L~L~~n~-l~~lp~----~l~~l~~L~~L~L~~n-~l~~-lp~~-~~~l~~L~~L~Ls~n-~l~~lp~~-----  145 (328)
T 4fcg_A           80 QPGRVALELRSVP-LPQFPD----QAFRLSHLQHMTIDAA-GLME-LPDT-MQQFAGLETLTLARN-PLRALPAS-----  145 (328)
T ss_dssp             STTCCEEEEESSC-CSSCCS----CGGGGTTCSEEEEESS-CCCC-CCSC-GGGGTTCSEEEEESC-CCCCCCGG-----
T ss_pred             ccceeEEEccCCC-chhcCh----hhhhCCCCCEEECCCC-Cccc-hhHH-HhccCCCCEEECCCC-ccccCcHH-----
Confidence            4678888887654 444322    2445788888888876 4554 4443 367888888888887 56655431     


Q ss_pred             ccCCCCCcCCccCeEeecCCcccccccCCCc------cccCCCCccEEeeecCCCCCccccCcccccccccccccccccc
Q 041021          118 DKEHIGPLFPKLSELRLIDLPKLKRFCNFTG------NIIELPKLEYLIIENCPDMETFTSNSTFVLYMTTDNKEAQKLK  191 (320)
Q Consensus       118 ~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~------~~~~l~~L~~l~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~l~  191 (320)
                           ...+++|++|++++|..+..++....      .+..+++|++|+++++ .++.+|..                  
T Consensus       146 -----l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n-~l~~lp~~------------------  201 (328)
T 4fcg_A          146 -----IASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWT-GIRSLPAS------------------  201 (328)
T ss_dssp             -----GGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEE-CCCCCCGG------------------
T ss_pred             -----HhcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCC-CcCcchHh------------------
Confidence                 12357888888888877766655320      1234788888888776 34444432                  


Q ss_pred             ChhHHhhcccccchHHHhcCCCCCceeccccccCc------cccCccceEEEccCCCcccccCCccCCCCccEEeecCcc
Q 041021          192 SEENLLVANQIHLFDEKLSGLHKVQHLWKENAESN------KVFANLKSLEIFECSKLQKLVPTSWHLENLATLEVSKCH  265 (320)
Q Consensus       192 ~l~~L~~~~~~~~~~~li~~~~~L~~l~~~~~~~~------~~~~~L~~L~i~~c~~l~~l~~~~~~~~~L~~L~l~~c~  265 (320)
                                       +..+++|+.+.+.++...      ..+++|+.|++++|.....++..+..+++|++|++++|+
T Consensus       202 -----------------l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  264 (328)
T 4fcg_A          202 -----------------IANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCS  264 (328)
T ss_dssp             -----------------GGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCT
T ss_pred             -----------------hcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCC
Confidence                             455666666665543321      456677777777776666666666677777777777777


Q ss_pred             ccccccCcchhhhccccCEEeEccccccceee
Q 041021          266 GLINLLTLSTSESLVNLERMKITDCKMMEEII  297 (320)
Q Consensus       266 ~l~~l~~~~~~~~l~~L~~L~l~~C~~l~~~~  297 (320)
                      .++.+|..  ...+++|++|++++|+.+..+.
T Consensus       265 ~~~~~p~~--~~~l~~L~~L~L~~n~~~~~iP  294 (328)
T 4fcg_A          265 NLLTLPLD--IHRLTQLEKLDLRGCVNLSRLP  294 (328)
T ss_dssp             TCCBCCTT--GGGCTTCCEEECTTCTTCCCCC
T ss_pred             chhhcchh--hhcCCCCCEEeCCCCCchhhcc
Confidence            66666542  3566777777777776665443
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.41
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.28
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.27
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.27
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.22
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.16
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.15
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.12
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.1
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.08
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.04
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.98
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.75
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.73
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.38
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.38
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.34
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.01
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.94
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.84
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.7
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.96
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.92
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.45
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.64
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.98
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 83.94
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.58  E-value=2e-16  Score=136.26  Aligned_cols=207  Identities=16%  Similarity=0.108  Sum_probs=120.1

Q ss_pred             cccccEEeecCCccchhhhcCCCCCCccCCCccEEeeccCcCccccCchhHHhhcccCCeEEEccCcccceecccccccc
Q 041021           38 FRDIKYLQLSHFPRLQEIWHGQALPVSFFNNLAQLVVDDCTNMSSAIPANLLWCLNNLAWLEVRNCDSLEEVLHLEELSA  117 (320)
Q Consensus        38 ~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~l~~L~~L~i~~c~~l~~i~~~~~~~~  117 (320)
                      ..+|++|+++++.--.....   .....+++|++|.+.+| .+.+..... +..+++|++|++++|..+++..-      
T Consensus        45 ~~~L~~LdLs~~~i~~~~l~---~l~~~c~~L~~L~L~~~-~l~~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l------  113 (284)
T d2astb2          45 PFRVQHMDLSNSVIEVSTLH---GILSQCSKLQNLSLEGL-RLSDPIVNT-LAKNSNLVRLNLSGCSGFSEFAL------  113 (284)
T ss_dssp             CBCCCEEECTTCEECHHHHH---HHHTTBCCCSEEECTTC-BCCHHHHHH-HTTCTTCSEEECTTCBSCCHHHH------
T ss_pred             CCCCCEEECCCCccCHHHHH---HHHHhCCCccccccccc-CCCcHHHHH-HhcCCCCcCcccccccccccccc------
Confidence            45788888887643222111   11345788888888887 344433333 35678888888888877764211      


Q ss_pred             ccCCCCCcCCccCeEeecCCcccccccCCCccccCCCCccEEeeecCCC-CCccccCccccccccccccccccccChhHH
Q 041021          118 DKEHIGPLFPKLSELRLIDLPKLKRFCNFTGNIIELPKLEYLIIENCPD-METFTSNSTFVLYMTTDNKEAQKLKSEENL  196 (320)
Q Consensus       118 ~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~l~~L~~l~l~~c~~-l~~~~~~~~~~~~~~~~~~~~~~l~~l~~L  196 (320)
                        ......+++|++|++++|.++..-..........++|+++++++|.. ++.....                       
T Consensus       114 --~~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~-----------------------  168 (284)
T d2astb2         114 --QTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLS-----------------------  168 (284)
T ss_dssp             --HHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHH-----------------------
T ss_pred             --chhhHHHHhccccccccccccccccchhhhcccccccchhhhccccccccccccc-----------------------
Confidence              11112357888888888877643221110112246788888877642 2211110                       


Q ss_pred             hhcccccchHHHhcCCCCCceeccccccCc--------cccCccceEEEccCCCccccc-CCccCCCCccEEeecCcccc
Q 041021          197 LVANQIHLFDEKLSGLHKVQHLWKENAESN--------KVFANLKSLEIFECSKLQKLV-PTSWHLENLATLEVSKCHGL  267 (320)
Q Consensus       197 ~~~~~~~~~~~li~~~~~L~~l~~~~~~~~--------~~~~~L~~L~i~~c~~l~~l~-~~~~~~~~L~~L~l~~c~~l  267 (320)
                                .++.+|++|+++.+.++...        ..+++|++|++++|+.+++-. ..+..+++|++|++++|  +
T Consensus       169 ----------~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l~~L~~~~~L~~L~l~~~--~  236 (284)
T d2astb2         169 ----------TLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI--V  236 (284)
T ss_dssp             ----------HHHHHCTTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGGGCTTCCEEECTTS--S
T ss_pred             ----------ccccccccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChHHHHHHhcCCCCCEEeeeCC--C
Confidence                      00445666666666543221        566788888888888876532 23467788999999888  4


Q ss_pred             ccccCcchhhhccccCEEeEcccccccee
Q 041021          268 INLLTLSTSESLVNLERMKITDCKMMEEI  296 (320)
Q Consensus       268 ~~l~~~~~~~~l~~L~~L~l~~C~~l~~~  296 (320)
                      ++-....++..+|+|+.    +|..+..+
T Consensus       237 ~d~~l~~l~~~lp~L~i----~~~~ls~~  261 (284)
T d2astb2         237 PDGTLQLLKEALPHLQI----NCSHFTTI  261 (284)
T ss_dssp             CTTCHHHHHHHSTTSEE----SCCCSCCT
T ss_pred             CHHHHHHHHHhCccccc----cCccCCCC
Confidence            44333334456666653    56666544
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure