Citrus Sinensis ID: 041028


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280---
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPWSRLKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPDR
cccccHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccEEcccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEcHHHHHHHHHHHHccccEEEEEcccccccccccccccEEccEEEEEccccccccccc
cccccHHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHEEEEcccccEEEEcccccHHHHHHHccHHHcccccHHHccccccccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHccHHccccHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHHcccccEEEEEEcccccEEcccHHHHccEEEEEcccccccccccc
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEvsqnpnikkIQGEIAFKLGlkfdeesesgrtrspwsrlKKEKLQIICGKkmegdyaegsELKWLAMDVAKecaglpvsivtgikeqELFEWKDALEqlrrpsstnfkdvqPAAYKAMELGYnklegdelkSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMlldhtskneklfsIHDVVRDVAISIASgeqnvfsatneqvdgctewsdeSAVILYTSIVLRdiktnvlpdr
mggigkttlAKEVArkakngklfdQIVFtevsqnpnikkiQGEIAFKlglkfdeesesgrtrspwsrlkkekLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALeqlrrpsstnfkdvqpAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYtsivlrdiktnvlpdr
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPWSRLKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDllmygmglglFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPDR
******************NGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKF*******************KLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQL*********DVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNV****
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPWSRLKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLP**
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFD**************LKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPDR
**GIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPWSRLKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIGKTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPWSRLKKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTAIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query283 2.2.26 [Sep-21-2011]
O81825 919 Probable disease resistan yes no 0.971 0.299 0.252 7e-16
Q8L3R3 885 Disease resistance protei no no 0.819 0.262 0.258 1e-11
Q8RXS5 888 Probable disease resistan no no 0.812 0.259 0.256 4e-10
Q9FLB4 874 Putative disease resistan no no 0.886 0.287 0.236 8e-10
Q9T048 985 Disease resistance protei no no 0.593 0.170 0.297 2e-09
O64973 889 Disease resistance protei no no 0.837 0.266 0.233 3e-09
Q42484 909 Disease resistance protei no no 0.575 0.179 0.296 5e-09
P60838 894 Probable disease resistan no no 0.823 0.260 0.233 5e-09
Q9LVT4 843 Probable disease resistan no no 0.932 0.313 0.225 8e-07
P60839 884 Probable disease resistan no no 0.830 0.265 0.226 2e-06
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 145/353 (41%), Gaps = 78/353 (22%)

Query: 1   MGGIGKTTLAKEVAR---KAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEES- 56
           MGG+GKTTL + +     K    + F  +++  VS++ ++K++Q +IA +LG +F  E  
Sbjct: 142 MGGVGKTTLVRTLNNDLLKYAATQQFALVIWVTVSKDFDLKRVQMDIAKRLGKRFTREQM 201

Query: 57  -------------------------------------------------ESGRTRSPWSR 67
                                                             S R       
Sbjct: 202 NQLGLTICERLIDLKNFLLILDDVWHPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQM 261

Query: 68  LKKEKLQIICGKKME---------GDYAEGSELKWLAMDVAKECAGLPVSIVT------G 112
           +  E +++ C ++ E         G+ A    +K +A DV+ EC GLP++I+T      G
Sbjct: 262 MTNENIKVACLQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRG 321

Query: 113 IKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFL---LIGYT 169
             + E+  WK  L  L+R + +   D +   +  ++L Y+ L+ D +KS FL   L    
Sbjct: 322 KPQVEV--WKHTLNLLKRSAPS--IDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPED 376

Query: 170 AIASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDV 229
               + +L+MY +  GL  G +  E       TLV +LK SC+L D  S +     +HDV
Sbjct: 377 YSIKVSELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDT--VKMHDV 434

Query: 230 VRDVAISIASGEQNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPD 282
           VRD AI   S +   F +      G  E+  +  V     + L   K   LP+
Sbjct: 435 VRDFAIWFMSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPN 487




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.851 0.210 0.461 4e-56
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.978 0.206 0.387 4e-51
147802546 1409 hypothetical protein VITISV_007222 [Viti 0.946 0.190 0.400 2e-49
296087872 1152 unnamed protein product [Vitis vinifera] 0.946 0.232 0.400 2e-49
359488027 1520 PREDICTED: disease resistance protein At 0.946 0.176 0.400 2e-49
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.893 0.149 0.387 2e-46
255563252 1603 Disease resistance protein RPS5, putativ 0.950 0.167 0.387 2e-46
147833354 1494 hypothetical protein VITISV_041837 [Viti 0.975 0.184 0.365 2e-44
359488095 1347 PREDICTED: probable disease resistance p 0.975 0.204 0.365 3e-44
359488103 1530 PREDICTED: disease resistance protein At 0.904 0.167 0.375 4e-44
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 143/310 (46%), Positives = 178/310 (57%), Gaps = 69/310 (22%)

Query: 6   KTTLAKEVARKAKNGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESESGRTRSPW 65
           KTTL KE AR+A   KLF+Q+VF  ++Q  +IKKIQG+IA +L LKFDEESE GR     
Sbjct: 189 KTTLVKEAARQAIQEKLFNQVVFATITQTQDIKKIQGQIADQLSLKFDEESECGRAGRLR 248

Query: 66  SRLKKE-KLQII-------------------------------------CG--------- 78
            RLK+E K+ II                                     CG         
Sbjct: 249 QRLKQEQKILIILDDLWKSLDLEAVGIPLKDEHEGCKMLVTSREFDVLSCGMDIQKNFPI 308

Query: 79  ------------KKMEGDYAEGSELKWLAMDVAKECAGLPVSIVT---GIKEQELFEWKD 123
                       KKM GD+ E  +L+ LA++VAK CAGLPV+IVT    +K + L +WK+
Sbjct: 309 NALSEEETWELFKKMAGDHVEHPDLQSLAIEVAKMCAGLPVAIVTVARALKNKNLSQWKN 368

Query: 124 ALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLL---IGYTAIASIDDLLMY 180
           AL +L+RPS  NF  VQ   Y A+EL YN LE  ELKSTFLL   +GY   AS  DLL Y
Sbjct: 369 ALRELKRPSPRNFAGVQEDVYAAIELSYNHLESKELKSTFLLCSRMGYN--ASTRDLLKY 426

Query: 181 GMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASG 240
           GMGLGLF G   +E A+ RVH+LVHKLKAS +LL++ S  +  FS+HD VRDVAISIA  
Sbjct: 427 GMGLGLFSGFVTVEEAQDRVHSLVHKLKASGLLLENHSDWQ--FSMHDAVRDVAISIAFR 484

Query: 241 EQNVFSATNE 250
           + +VF   +E
Sbjct: 485 DCHVFVGGDE 494




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147802546|emb|CAN77665.1| hypothetical protein VITISV_007222 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147833354|emb|CAN66237.1| hypothetical protein VITISV_041837 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488103|ref|XP_002263579.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query283
TAIR|locus:2131689 919 AT4G27220 [Arabidopsis thalian 0.731 0.225 0.285 1.5e-14
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.579 0.184 0.252 1.8e-12
TAIR|locus:2136447 985 AT4G27190 [Arabidopsis thalian 0.731 0.210 0.258 2.1e-12
TAIR|locus:2203881 893 AT1G62630 [Arabidopsis thalian 0.565 0.179 0.263 8.4e-12
TAIR|locus:2031356 884 AT1G63360 [Arabidopsis thalian 0.565 0.180 0.257 1.9e-11
TAIR|locus:2005517 909 RPS2 "RESISTANT TO P. SYRINGAE 0.590 0.183 0.281 2.7e-11
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.551 0.175 0.262 8e-11
TAIR|locus:2153474 874 AT5G05400 [Arabidopsis thalian 0.363 0.117 0.321 3.5e-09
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.268 0.085 0.325 9.7e-09
TAIR|locus:2031366 898 AT1G63350 "AT1G63350" [Arabido 0.579 0.182 0.237 1.6e-08
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 1.5e-14, Sum P(2) = 1.5e-14
 Identities = 63/221 (28%), Positives = 99/221 (44%)

Query:    69 KKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVT-G--IKEQELFE-WKDA 124
             +KE  ++ C     G+ A    +K +A DV+ EC GLP++I+T G  ++ +   E WK  
Sbjct:   274 EKEAWELFCHNV--GEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query:   125 LEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFL---LIGYTAIASIDDXXXXX 181
             L  L+R S+ +  D +   +  ++L Y+ L+ D +KS FL   L        + +     
Sbjct:   332 LNLLKR-SAPSI-DTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYW 388

Query:   182 XXXXXFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISIASGE 241
                    G +  E       TLV +LK SC+L D  S +     +HDVVRD AI   S +
Sbjct:   389 VAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDT--VKMHDVVRDFAIWFMSSQ 446

Query:   242 QNVFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPD 282
                F +      G  E+  +  V     + L   K   LP+
Sbjct:   447 GEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPN 487


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031356 AT1G63360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00050016
cc-nbs-lrr resistance protein (1144 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 4e-06
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 5e-06
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 46.9 bits (112), Expect = 4e-06
 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 9/101 (8%)

Query: 69  KKEKLQIICGKKMEGDYAEGSELKWLAMDVAKECAGLPVSIVTGIKE-----QELFEWKD 123
            +E  ++   K  E +     EL+ +A ++ ++C GLP+++   +         + EW+ 
Sbjct: 158 PEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKV-LGGLLAFKSTVQEWEH 216

Query: 124 ALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFL 164
            LEQL        +D        + L Y+ L    LK  FL
Sbjct: 217 VLEQLNN--ELAGRDGLNEVLSILSLSYDNLP-MHLKRCFL 254


Length = 285

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 283
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.96
PRK04841 903 transcriptional regulator MalT; Provisional 98.96
COG3903414 Predicted ATPase [General function prediction only 98.37
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.21
cd01128249 rho_factor Transcription termination factor rho is 98.07
PRK09376416 rho transcription termination factor Rho; Provisio 98.04
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.86
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.67
TIGR00767415 rho transcription termination factor Rho. Members 97.47
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.21
PRK08118167 topology modulation protein; Reviewed 97.16
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 97.14
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.05
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.04
TIGR02928365 orc1/cdc6 family replication initiation protein. M 96.69
PRK11331459 5-methylcytosine-specific restriction enzyme subun 96.64
PF05729166 NACHT: NACHT domain 96.58
PTZ00202550 tuzin; Provisional 96.57
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.14
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.08
PRK07261171 topology modulation protein; Provisional 95.95
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.42
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.39
PRK12608380 transcription termination factor Rho; Provisional 95.18
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.04
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.0
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.86
PRK08233182 hypothetical protein; Provisional 94.66
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.64
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 94.51
smart00382148 AAA ATPases associated with a variety of cellular 94.47
PHA02518211 ParA-like protein; Provisional 94.44
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.29
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.26
PRK03839180 putative kinase; Provisional 94.26
PRK05541176 adenylylsulfate kinase; Provisional 94.25
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.17
COG0003322 ArsA Predicted ATPase involved in chromosome parti 94.08
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 94.06
PRK06217183 hypothetical protein; Validated 94.05
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.01
TIGR02012321 tigrfam_recA protein RecA. This model describes or 93.99
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.95
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.92
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 93.83
PRK00625173 shikimate kinase; Provisional 93.83
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.82
COG1192259 Soj ATPases involved in chromosome partitioning [C 93.81
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.81
PRK09354349 recA recombinase A; Provisional 93.76
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.69
PF07726131 AAA_3: ATPase family associated with various cellu 93.68
PF13173128 AAA_14: AAA domain 93.59
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.58
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 93.5
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 93.4
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.38
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.37
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 93.36
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 93.32
COG3899 849 Predicted ATPase [General function prediction only 93.3
PRK08116268 hypothetical protein; Validated 93.28
cd02040270 NifH NifH gene encodes component II (iron protein) 93.15
PF00004132 AAA: ATPase family associated with various cellula 93.15
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.14
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 93.13
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.11
PRK07952244 DNA replication protein DnaC; Validated 93.11
KOG2028 554 consensus ATPase related to the helicase subunit o 93.08
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 93.06
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 92.99
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 92.95
PRK13947171 shikimate kinase; Provisional 92.94
PRK13849231 putative crown gall tumor protein VirC1; Provision 92.91
PRK09361225 radB DNA repair and recombination protein RadB; Pr 92.91
PRK12377248 putative replication protein; Provisional 92.9
PRK06762166 hypothetical protein; Provisional 92.87
PRK06893229 DNA replication initiation factor; Validated 92.86
cd01394218 radB RadB. The archaeal protein radB shares simila 92.84
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 92.8
PRK00771437 signal recognition particle protein Srp54; Provisi 92.69
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 92.64
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 92.64
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 92.6
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 92.58
PRK00131175 aroK shikimate kinase; Reviewed 92.56
PRK13231264 nitrogenase reductase-like protein; Reviewed 92.55
cd02036179 MinD Bacterial cell division requires the formatio 92.4
PHA00729226 NTP-binding motif containing protein 92.33
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 92.27
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.27
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.13
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 92.05
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 91.94
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.92
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 91.87
PRK10037250 cell division protein; Provisional 91.84
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 91.82
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 91.81
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.77
COG2255332 RuvB Holliday junction resolvasome, helicase subun 91.75
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 91.75
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 91.73
TIGR01287275 nifH nitrogenase iron protein. This model describe 91.71
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 91.67
COG0703172 AroK Shikimate kinase [Amino acid transport and me 91.55
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 91.54
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 91.48
PRK13230279 nitrogenase reductase-like protein; Reviewed 91.45
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 91.4
PRK13949169 shikimate kinase; Provisional 91.32
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.31
PRK13975196 thymidylate kinase; Provisional 91.28
TIGR02236310 recomb_radA DNA repair and recombination protein R 91.22
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 91.21
PTZ00301210 uridine kinase; Provisional 91.19
cd02032267 Bchl_like This family of proteins contains bchL an 91.18
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 91.17
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 91.17
PRK04301317 radA DNA repair and recombination protein RadA; Va 91.16
PRK13233275 nifH nitrogenase reductase; Reviewed 91.15
PRK13946184 shikimate kinase; Provisional 91.09
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 91.07
cd03115173 SRP The signal recognition particle (SRP) mediates 91.07
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 91.06
PTZ00088229 adenylate kinase 1; Provisional 91.05
KOG1969 877 consensus DNA replication checkpoint protein CHL12 90.96
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 90.93
TIGR00362405 DnaA chromosomal replication initiator protein Dna 90.93
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 90.88
PRK05480209 uridine/cytidine kinase; Provisional 90.85
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 90.85
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 90.84
PRK13235274 nifH nitrogenase reductase; Reviewed 90.82
PRK06547172 hypothetical protein; Provisional 90.79
PRK13232273 nifH nitrogenase reductase; Reviewed 90.79
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 90.76
PRK04040188 adenylate kinase; Provisional 90.73
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 90.7
PRK13342413 recombination factor protein RarA; Reviewed 90.69
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 90.68
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 90.67
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 90.54
cd03110179 Fer4_NifH_child This protein family's function is 90.51
PRK05973237 replicative DNA helicase; Provisional 90.48
PRK06921266 hypothetical protein; Provisional 90.46
PRK08727233 hypothetical protein; Validated 90.45
cd01124187 KaiC KaiC is a circadian clock protein primarily f 90.44
PRK13948182 shikimate kinase; Provisional 90.43
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 90.42
PRK06696223 uridine kinase; Validated 90.39
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 90.36
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 90.35
PRK05564313 DNA polymerase III subunit delta'; Validated 90.34
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 90.33
PRK14087450 dnaA chromosomal replication initiation protein; P 90.26
PRK08939306 primosomal protein DnaI; Reviewed 90.23
PLN03186342 DNA repair protein RAD51 homolog; Provisional 90.14
cd02117212 NifH_like This family contains the NifH (iron prot 90.11
PRK00889175 adenylylsulfate kinase; Provisional 90.06
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 90.05
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 90.04
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 90.03
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 89.97
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 89.94
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 89.85
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 89.82
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 89.8
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 89.79
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 89.78
TIGR00959428 ffh signal recognition particle protein. This mode 89.77
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 89.76
COG4088261 Predicted nucleotide kinase [Nucleotide transport 89.73
CHL00181287 cbbX CbbX; Provisional 89.73
TIGR00235207 udk uridine kinase. Model contains a number of lon 89.72
PRK08903227 DnaA regulatory inactivator Hda; Validated 89.68
TIGR03453387 partition_RepA plasmid partitioning protein RepA. 89.65
PRK12422445 chromosomal replication initiation protein; Provis 89.64
PRK14532188 adenylate kinase; Provisional 89.59
PRK12339197 2-phosphoglycerate kinase; Provisional 89.59
PRK03731171 aroL shikimate kinase II; Reviewed 89.59
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 89.54
PRK10646153 ADP-binding protein; Provisional 89.47
PRK08084235 DNA replication initiation factor; Provisional 89.41
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 89.4
PRK05057172 aroK shikimate kinase I; Reviewed 89.4
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 89.38
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 89.37
CHL00072290 chlL photochlorophyllide reductase subunit L 89.37
PRK13695174 putative NTPase; Provisional 89.34
PRK11545163 gntK gluconate kinase 1; Provisional 89.34
PRK14529223 adenylate kinase; Provisional 89.33
PRK05642234 DNA replication initiation factor; Validated 89.19
PRK13869405 plasmid-partitioning protein RepA; Provisional 89.18
TIGR01968261 minD_bact septum site-determining protein MinD. Th 89.16
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.1
PLN03025319 replication factor C subunit; Provisional 89.07
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 89.02
PRK07004460 replicative DNA helicase; Provisional 89.01
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 89.01
PRK09519 790 recA DNA recombination protein RecA; Reviewed 88.95
PRK14530215 adenylate kinase; Provisional 88.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.87
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 88.82
COG1149284 MinD superfamily P-loop ATPase containing an inser 88.79
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 88.71
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 88.7
PRK13973213 thymidylate kinase; Provisional 88.66
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 88.64
PRK08533230 flagellar accessory protein FlaH; Reviewed 88.63
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 88.6
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 88.59
PRK00149450 dnaA chromosomal replication initiation protein; R 88.53
cd02034116 CooC The accessory protein CooC, which contains a 88.53
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 88.51
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 88.47
PRK10818270 cell division inhibitor MinD; Provisional 88.45
cd03111106 CpaE_like This protein family consists of proteins 88.38
PRK07667193 uridine kinase; Provisional 88.33
COG1936180 Predicted nucleotide kinase (related to CMP and AM 88.28
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 88.28
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 88.28
CHL00175281 minD septum-site determining protein; Validated 88.24
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 88.22
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). 88.17
PRK03846198 adenylylsulfate kinase; Provisional 88.14
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 88.12
PRK13976209 thymidylate kinase; Provisional 88.1
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 88.07
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 87.94
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 87.94
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 87.93
PRK10867433 signal recognition particle protein; Provisional 87.86
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 87.85
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 87.75
PHA02519387 plasmid partition protein SopA; Reviewed 87.67
PRK06761282 hypothetical protein; Provisional 87.65
PLN02924220 thymidylate kinase 87.62
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 87.61
PRK06835329 DNA replication protein DnaC; Validated 87.59
PRK04182180 cytidylate kinase; Provisional 87.57
PRK06620214 hypothetical protein; Validated 87.57
PF1324576 AAA_19: Part of AAA domain 87.52
COG0470325 HolB ATPase involved in DNA replication [DNA repli 87.39
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 87.38
PF09140261 MipZ: ATPase MipZ; InterPro: IPR015223 Cell divisi 87.33
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 87.27
PRK13705388 plasmid-partitioning protein SopA; Provisional 87.27
PRK13236296 nitrogenase reductase; Reviewed 87.24
PRK00698205 tmk thymidylate kinase; Validated 87.17
PRK04328249 hypothetical protein; Provisional 87.12
COG0714329 MoxR-like ATPases [General function prediction onl 87.0
PRK14528186 adenylate kinase; Provisional 86.99
PHA02530300 pseT polynucleotide kinase; Provisional 86.98
PRK06067234 flagellar accessory protein FlaH; Validated 86.91
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 86.9
TIGR02016296 BchX chlorophyllide reductase iron protein subunit 86.89
PRK04296190 thymidine kinase; Provisional 86.84
PRK09183259 transposase/IS protein; Provisional 86.79
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 86.72
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 86.66
PRK13768253 GTPase; Provisional 86.58
COG0802149 Predicted ATPase or kinase [General function predi 86.53
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 86.49
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 86.44
PRK06526254 transposase; Provisional 86.4
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 86.36
PF00693281 Herpes_TK: Thymidine kinase from herpesvirus; Inte 86.33
PRK13765 637 ATP-dependent protease Lon; Provisional 86.32
PTZ001121164 origin recognition complex 1 protein; Provisional 86.25
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 86.22
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 86.16
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 86.15
PRK14088440 dnaA chromosomal replication initiation protein; P 86.13
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 86.09
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 86.06
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 86.01
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 85.92
PRK08181269 transposase; Validated 85.86
PRK14527191 adenylate kinase; Provisional 85.83
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 85.8
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 85.79
TIGR00064272 ftsY signal recognition particle-docking protein F 85.78
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 85.68
PRK05439311 pantothenate kinase; Provisional 85.65
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 85.57
COG1100219 GTPase SAR1 and related small G proteins [General 85.55
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 85.48
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 85.47
PRK14526211 adenylate kinase; Provisional 85.45
PTZ00035337 Rad51 protein; Provisional 85.44
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 85.39
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 85.38
PRK13234295 nifH nitrogenase reductase; Reviewed 85.35
PLN02200234 adenylate kinase family protein 85.33
PRK03992389 proteasome-activating nucleotidase; Provisional 85.26
PRK08840464 replicative DNA helicase; Provisional 85.16
PRK13341 725 recombination factor protein RarA/unknown domain f 85.14
PRK00279215 adk adenylate kinase; Reviewed 85.12
PRK14531183 adenylate kinase; Provisional 85.06
PRK12402337 replication factor C small subunit 2; Reviewed 85.01
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 85.01
PRK10536262 hypothetical protein; Provisional 85.0
PRK04195 482 replication factor C large subunit; Provisional 84.9
PRK02496184 adk adenylate kinase; Provisional 84.85
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 84.78
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 84.74
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 84.74
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 84.72
PRK09087226 hypothetical protein; Validated 84.72
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 84.69
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 84.66
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 84.63
PRK09280463 F0F1 ATP synthase subunit beta; Validated 84.61
cd03114148 ArgK-like The function of this protein family is u 84.59
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 84.54
PRK08006471 replicative DNA helicase; Provisional 84.5
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 84.45
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 84.4
PRK09270229 nucleoside triphosphate hydrolase domain-containin 84.37
PRK12338319 hypothetical protein; Provisional 84.35
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 84.33
PRK06904472 replicative DNA helicase; Validated 84.33
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 84.32
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 84.24
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 84.18
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 84.17
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 84.16
PRK14974336 cell division protein FtsY; Provisional 84.13
PRK07933213 thymidylate kinase; Validated 84.02
PRK00300205 gmk guanylate kinase; Provisional 83.99
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 83.87
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 83.86
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 83.82
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 83.77
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 83.71
PRK11670369 antiporter inner membrane protein; Provisional 83.64
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 83.63
PRK09302 509 circadian clock protein KaiC; Reviewed 83.55
PF00154322 RecA: recA bacterial DNA recombination protein; In 83.5
PRK05748448 replicative DNA helicase; Provisional 83.5
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 83.5
PF13614157 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ 83.46
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 83.44
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 83.36
PRK05636505 replicative DNA helicase; Provisional 83.27
PRK13531 498 regulatory ATPase RavA; Provisional 83.17
PRK08760476 replicative DNA helicase; Provisional 83.16
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 83.13
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 83.09
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 83.05
PRK09825176 idnK D-gluconate kinase; Provisional 82.99
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 82.85
COG0645170 Predicted kinase [General function prediction only 82.76
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 82.69
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 82.68
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 82.64
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 82.59
PRK05595444 replicative DNA helicase; Provisional 82.56
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 82.53
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 82.48
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 82.44
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 82.41
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 82.41
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 82.39
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 82.34
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 82.27
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 82.26
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 82.06
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 81.81
TIGR00231161 small_GTP small GTP-binding protein domain. This m 81.79
PRK14086617 dnaA chromosomal replication initiation protein; P 81.79
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 81.77
PRK04220301 2-phosphoglycerate kinase; Provisional 81.74
PRK13974212 thymidylate kinase; Provisional 81.72
PRK08506472 replicative DNA helicase; Provisional 81.67
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 81.67
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 81.59
PHA02544316 44 clamp loader, small subunit; Provisional 81.25
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 81.25
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 81.18
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 81.14
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 81.02
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 81.01
PHA02244383 ATPase-like protein 80.94
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 80.92
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 80.89
PRK00440319 rfc replication factor C small subunit; Reviewed 80.77
TIGR00665434 DnaB replicative DNA helicase. This model describe 80.75
COG3598402 RepA RecA-family ATPase [DNA replication, recombin 80.74
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 80.59
PRK14737186 gmk guanylate kinase; Provisional 80.58
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 80.55
PRK08356195 hypothetical protein; Provisional 80.45
PRK14738206 gmk guanylate kinase; Provisional 80.44
PRK06321472 replicative DNA helicase; Provisional 80.42
PRK13886241 conjugal transfer protein TraL; Provisional 80.29
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 80.24
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 80.2
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 80.18
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 80.17
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 80.16
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 80.14
PRK08154309 anaerobic benzoate catabolism transcriptional regu 80.13
cd00154159 Rab Rab family. Rab GTPases form the largest famil 80.11
PRK11823446 DNA repair protein RadA; Provisional 80.11
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 80.05
PRK08099399 bifunctional DNA-binding transcriptional repressor 80.05
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=7e-50  Score=383.86  Aligned_cols=277  Identities=25%  Similarity=0.414  Sum_probs=235.7

Q ss_pred             CCCCcHHHHHHHHHhhhc-cCCCCCeEEEEEeCCCCCHHHHHHHHHHHhCCCCCcC---CHhhhHHhHHHHccCCcEEEE
Q 041028            1 MGGIGKTTLAKEVARKAK-NGKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEE---SESGRTRSPWSRLKKEKLQII   76 (283)
Q Consensus         1 mgGiGKTtLA~~v~~~~~-~~~~Fd~~~wv~v~~~~~~~~l~~~i~~~l~~~~~~~---~~~~~~~~l~~~L~~kr~LlV   76 (283)
                      |||+||||||+.++|+.. +..+||.++||.||+.++...++.+|++.++.....+   +..+.+..|.+.|++||||||
T Consensus       187 MGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~krfllv  266 (889)
T KOG4658|consen  187 MGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGKRFLLV  266 (889)
T ss_pred             CCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccCceEEE
Confidence            999999999999999987 8899999999999999999999999999998854433   335678899999999999999


Q ss_pred             ---------------------cC--------------------------------------eecCCC-CCCCcchHHHHH
Q 041028           77 ---------------------CG--------------------------------------KKMEGD-YAEGSELKWLAM   96 (283)
Q Consensus        77 ---------------------~G--------------------------------------~~~~~~-~~~~~~~~~~~~   96 (283)
                                           +|                                      +.++.. ....+.++++|+
T Consensus       267 LDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak  346 (889)
T KOG4658|consen  267 LDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAK  346 (889)
T ss_pred             EecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHH
Confidence                                 22                                      233332 223344899999


Q ss_pred             HHHHhcCCchHHHHH---hhc-cCChHHHHHHHHHhcCCCCCCCCCchhHHHHHHhhhhccCCCCcHHHHHHHHhhCc--
Q 041028           97 DVAKECAGLPVSIVT---GIK-EQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLIGYTA--  170 (283)
Q Consensus        97 ~i~~~c~glPLal~~---~l~-~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~~fl~~s~fp--  170 (283)
                      +|+++|+|+|||+.+   .|+ +.+..+|+++.+.+.+....+.+++...+..++++||+.||++ +|.||+|||+||  
T Consensus       347 ~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED  425 (889)
T KOG4658|consen  347 EVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPED  425 (889)
T ss_pred             HHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcc
Confidence            999999999999999   777 8888899999999988866666677889999999999999987 999999999999  


Q ss_pred             -CCCHHHHHHHHhhccccCCCchHHHHHHHHHHHHHHHHhccccccccC-CCcceEEechhHHHHHHHHHc-----cCCc
Q 041028          171 -IASIDDLLMYGMGLGLFQGVNKMEAARARVHTLVHKLKASCMLLDHTS-KNEKLFSIHDVVRDVAISIAS-----GEQN  243 (283)
Q Consensus       171 -~i~~~~l~~~w~aeg~~~~~~~~~~~~~~~~~~~~~L~~~sLl~~~~~-~~~~~~~mH~lv~~~a~~~~~-----~~~~  243 (283)
                       .|+++.|+.+|+||||+.+....+.+++.+++++.+|+++||++.... .+..+|+|||+||++|.++++     ++++
T Consensus       426 ~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~  505 (889)
T KOG4658|consen  426 YEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQ  505 (889)
T ss_pred             cccchHHHHHHHHhccCcCccccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccce
Confidence             899999999999999998866666689999999999999999976653 244799999999999999999     6663


Q ss_pred             eeeeccccccCCCcCCcccccccccEEEEeCCCCCCCCC
Q 041028          244 VFSATNEQVDGCTEWSDESAVILYTSIVLRDIKTNVLPD  282 (283)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~r~lsl~~~~~~~lp~  282 (283)
                      + +..+.++   .+.|....|..+||+|+++|++..+|.
T Consensus       506 i-v~~~~~~---~~~~~~~~~~~~rr~s~~~~~~~~~~~  540 (889)
T KOG4658|consen  506 I-VSDGVGL---SEIPQVKSWNSVRRMSLMNNKIEHIAG  540 (889)
T ss_pred             E-EECCcCc---cccccccchhheeEEEEeccchhhccC
Confidence            3 3333233   456777888999999999999988774



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF09140 MipZ: ATPase MipZ; InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF00693 Herpes_TK: Thymidine kinase from herpesvirus; InterPro: IPR001889 The thymidine kinase from Herpesviridae catalyses the reaction: ATP + THYMIDINE = ADP + THYMIDINE 5'-PHOSPHATE Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK11670 antiporter inner membrane protein; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13614 AAA_31: AAA domain; PDB: 2VED_B 2PH1_A 3EA0_B 3FKQ_A 3KB1_B 1ION_A 3LA6_H 3BFV_B 3CIO_D Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query283
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 9e-10
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 1e-08
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 3e-05
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 5e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 70.3 bits (171), Expect = 1e-13
 Identities = 33/299 (11%), Positives = 86/299 (28%), Gaps = 79/299 (26%)

Query: 1   MGGIGKTTLAKEVARKAKNGKLFDQIVF----TEVSQNPNIKKIQGEIAFKLGLKFDEES 56
           + G GKT +A +V    K     D  +F       +    + ++  ++ +++   +   S
Sbjct: 158 VLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRS 217

Query: 57  E-SGRTRSPWSRLKKEKLQIICGKKMEGDYAEG---------SELKWLAMDVAKEC---- 102
           + S   +     ++ E  +++  K     Y            ++  W A ++   C    
Sbjct: 218 DHSSNIKLRIHSIQAELRRLLKSK----PYENCLLVLLNVQNAKA-WNAFNL--SCKILL 270

Query: 103 -----------AGLPVSIVTGIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMEL-- 149
                      +    + ++           +    L +      +D+            
Sbjct: 271 TTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRL 330

Query: 150 ---------------GYNKLEGDELKSTFLLIGYTAIASIDDLL------MYGMGLGLFQ 188
                           +  +  D+L +          +S++ L       M+   L +F 
Sbjct: 331 SIIAESIRDGLATWDNWKHVNCDKLTTIIE-------SSLNVLEPAEYRKMFDR-LSVFP 382

Query: 189 -GVNKMEAARAR---------VHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISI 237
              +      +          V  +V+KL    ++       E   SI  +  ++ + +
Sbjct: 383 PSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQ--PKESTISIPSIYLELKVKL 439


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.96
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.94
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.93
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.04
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 97.61
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.94
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.92
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.78
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.67
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 96.48
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.77
2fna_A357 Conserved hypothetical protein; structural genomic 94.33
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.27
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.07
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.03
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.8
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.72
2chg_A226 Replication factor C small subunit; DNA-binding pr 93.53
3io5_A333 Recombination and repair protein; storage dimer, i 93.5
3cwq_A209 Para family chromosome partitioning protein; alpha 93.47
3bos_A242 Putative DNA replication factor; P-loop containing 93.19
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.14
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 93.11
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 93.09
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.04
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.96
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 92.94
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 92.33
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 92.33
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 92.32
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 92.26
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 92.25
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 92.16
3vaa_A199 Shikimate kinase, SK; structural genomics, center 92.15
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 92.1
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 92.06
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 91.86
1via_A175 Shikimate kinase; structural genomics, transferase 91.8
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.74
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 91.74
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 91.73
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 91.63
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 91.61
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 91.43
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.42
2z43_A324 DNA repair and recombination protein RADA; archaea 91.26
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 91.18
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.15
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 91.11
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.02
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 90.98
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 90.95
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.82
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 90.77
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 90.72
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 90.68
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 90.67
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 90.58
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 90.5
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 90.49
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 90.47
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 90.45
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 90.38
2vli_A183 Antibiotic resistance protein; transferase, tunica 90.37
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.35
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.3
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 90.22
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 90.21
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 90.18
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 90.11
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.04
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 90.04
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 89.97
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 89.95
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 89.92
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 89.91
3end_A307 Light-independent protochlorophyllide reductase ir 89.9
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 89.89
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 89.84
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 89.84
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.79
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 89.75
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.72
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 89.63
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 89.62
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 89.54
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.43
2r62_A268 Cell division protease FTSH homolog; ATPase domain 89.39
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 89.37
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 89.34
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 89.3
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 89.29
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.27
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 89.18
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 89.08
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 89.03
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 88.98
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 88.91
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 88.9
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 88.89
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 88.79
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 88.77
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 88.76
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 88.71
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 88.7
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 88.63
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 88.6
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 88.59
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 88.59
3pg5_A361 Uncharacterized protein; structural genomics, PSI- 88.56
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 88.51
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.5
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 88.44
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 88.43
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 88.39
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 88.38
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 88.38
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 88.34
4a74_A231 DNA repair and recombination protein RADA; hydrola 88.34
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 88.29
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 88.23
2xxa_A433 Signal recognition particle protein; protein trans 88.21
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 88.2
2kjq_A149 DNAA-related protein; solution structure, NESG, st 88.18
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 88.17
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 88.12
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 88.08
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 88.07
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 88.03
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.01
2qgz_A308 Helicase loader, putative primosome component; str 87.96
3fwy_A314 Light-independent protochlorophyllide reductase I 87.96
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 87.93
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 87.85
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.84
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 87.75
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 87.58
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.55
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 87.55
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 87.49
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.46
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 87.45
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 87.42
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.32
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 87.3
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 87.23
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 87.21
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.07
3co5_A143 Putative two-component system transcriptional RES 87.03
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 87.02
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.95
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 86.94
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 86.76
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 86.72
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 86.69
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 86.67
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 86.61
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 86.59
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 86.53
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 86.43
3tlx_A243 Adenylate kinase 2; structural genomics, structura 86.37
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 86.33
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 86.31
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 86.31
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 86.23
1xjc_A169 MOBB protein homolog; structural genomics, midwest 86.13
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 86.11
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, 86.08
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 86.07
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 86.01
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 85.96
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 85.94
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 85.73
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 85.66
2hf9_A226 Probable hydrogenase nickel incorporation protein 85.47
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 85.46
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 85.46
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 85.39
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 85.32
2fna_A357 Conserved hypothetical protein; structural genomic 85.27
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 85.26
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 85.26
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 85.19
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 85.16
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 85.0
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 84.96
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 84.81
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 84.77
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 84.74
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 84.64
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 84.58
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 84.5
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 84.48
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 84.48
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 84.37
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 84.35
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 84.27
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 84.27
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 84.2
3pvs_A 447 Replication-associated recombination protein A; ma 84.18
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 84.06
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 83.95
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 83.9
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 83.87
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 83.86
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 83.85
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 83.83
3igf_A374 ALL4481 protein; two-domained protein consisting o 83.75
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 83.72
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 83.72
2r6a_A454 DNAB helicase, replicative helicase; replication, 83.49
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 83.45
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 83.25
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 83.07
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 83.03
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 82.98
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 82.93
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 82.86
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 82.72
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 82.64
3r20_A233 Cytidylate kinase; structural genomics, seattle st 82.64
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 82.53
2r44_A331 Uncharacterized protein; putative ATPase, structur 82.52
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 82.52
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.51
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 82.49
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 82.47
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 82.4
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 82.38
1vma_A306 Cell division protein FTSY; TM0570, structural gen 82.34
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 82.27
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 82.23
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 82.17
1tue_A212 Replication protein E1; helicase, replication, E1E 82.16
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 82.02
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 82.01
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 81.99
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 81.99
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 81.98
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 81.89
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 81.88
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 81.86
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 81.82
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 81.81
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 81.72
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 81.6
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 81.57
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 81.52
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 81.29
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 81.29
3ez9_A403 Para; DNA binding, winged-HTH, partition, biosynth 81.27
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 81.21
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 81.08
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 81.06
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 81.03
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 80.97
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 80.91
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 80.87
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 80.72
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 80.67
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 80.64
2wji_A165 Ferrous iron transport protein B homolog; membrane 80.6
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 80.58
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 80.56
2chq_A319 Replication factor C small subunit; DNA-binding pr 80.3
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=3.7e-37  Score=287.16  Aligned_cols=231  Identities=13%  Similarity=0.056  Sum_probs=166.8

Q ss_pred             CCCCcHHHHHHHHHh--hhccCCCCCeEEEEEeCCCC--CHHHHHHHHHHHhCCCCC--------cCCHhhhHHhHHHHc
Q 041028            1 MGGIGKTTLAKEVAR--KAKNGKLFDQIVFTEVSQNP--NIKKIQGEIAFKLGLKFD--------EESESGRTRSPWSRL   68 (283)
Q Consensus         1 mgGiGKTtLA~~v~~--~~~~~~~Fd~~~wv~v~~~~--~~~~l~~~i~~~l~~~~~--------~~~~~~~~~~l~~~L   68 (283)
                      ||||||||||+++|+  +.++..+|++++||++++.+  ++..+++.|+.+++....        ..+...+...+++.|
T Consensus       160 ~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~vs~~~~~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L  239 (549)
T 2a5y_B          160 RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL  239 (549)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhHHHhccCCcEEEEEECCCCCCCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHH
Confidence            899999999999998  56677889999999999885  899999999999986522        113445678999999


Q ss_pred             cCC-cEEEE---------------cC--------------------------------------eecCCCCCCCcchHHH
Q 041028           69 KKE-KLQII---------------CG--------------------------------------KKMEGDYAEGSELKWL   94 (283)
Q Consensus        69 ~~k-r~LlV---------------~G--------------------------------------~~~~~~~~~~~~~~~~   94 (283)
                      +++ |||||               .|                                      +.+++.. ..+.+.++
T Consensus       240 ~~~kr~LlVLDdv~~~~~~~~~~~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~-~~~~~~~~  318 (549)
T 2a5y_B          240 IDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP-VGEKEEDV  318 (549)
T ss_dssp             TTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHHHHH
T ss_pred             cCCCcEEEEEECCCCchhhcccccCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC-CchhHHHH
Confidence            996 99999               11                                      1223221 23677889


Q ss_pred             HHHHHHhcCCchHHHHH---hhccCChHHHHHHHHHhcCCCCCCCCCchhHHHHHHhhhhccCCCCcHHHHHH-------
Q 041028           95 AMDVAKECAGLPVSIVT---GIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFL-------  164 (283)
Q Consensus        95 ~~~i~~~c~glPLal~~---~l~~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~~fl-------  164 (283)
                      +++|+++|+|+||||++   .++.+ .++|...+.......   .   ...+..++.+||+.||++ +|.||+       
T Consensus       319 ~~~I~~~c~GlPLAl~~~g~~l~~~-~w~~~~~l~~~l~~~---~---~~~i~~~l~~Sy~~L~~~-lk~~f~~Ls~~er  390 (549)
T 2a5y_B          319 LNKTIELSSGNPATLMMFFKSCEPK-TFEKMAQLNNKLESR---G---LVGVECITPYSYKSLAMA-LQRCVEVLSDEDR  390 (549)
T ss_dssp             HHHHHHHHTTCHHHHHHHHTTCCSS-SHHHHHHHHHHHHHH---C---SSTTCCCSSSSSSSHHHH-HHHHHHTSCHHHH
T ss_pred             HHHHHHHhCCChHHHHHHHHHhccc-hHHHHHHhHHHhhcc---c---HHHHHHHHhcccccccHH-HHHHHhccchhhh
Confidence            99999999999999999   34444 233433332211110   0   234678899999999998 999999       


Q ss_pred             ----HHhhCc-CCCHHHHHHHHhhc--cccCCCchHHHHHHHHHHHHHHHHhccccccccCCCcceEEechhHHHHHHHH
Q 041028          165 ----LIGYTA-IASIDDLLMYGMGL--GLFQGVNKMEAARARVHTLVHKLKASCMLLDHTSKNEKLFSIHDVVRDVAISI  237 (283)
Q Consensus       165 ----~~s~fp-~i~~~~l~~~w~ae--g~~~~~~~~~~~~~~~~~~~~~L~~~sLl~~~~~~~~~~~~mH~lv~~~a~~~  237 (283)
                          |||+|| +.+..  +++|+|+  ||+.........++.++ ++++|+++||+++...++..+|+|||+||+||+++
T Consensus       391 ~l~~~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~  467 (549)
T 2a5y_B          391 SALAFAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHV  467 (549)
T ss_dssp             HHTTGGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTT
T ss_pred             hHhhheeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHH
Confidence                999998 33333  7899999  99965321111223334 88899999999877654446899999999999998


Q ss_pred             HccCCc
Q 041028          238 ASGEQN  243 (283)
Q Consensus       238 ~~~~~~  243 (283)
                      +.+++.
T Consensus       468 ~~~~~~  473 (549)
T 2a5y_B          468 VDAQTI  473 (549)
T ss_dssp             SCTHHH
T ss_pred             HHHHHH
Confidence            877654



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3pg5_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 3.30A {Corynebacterium diphtheriae} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 283
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 5e-06
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 44.4 bits (104), Expect = 5e-06
 Identities = 13/60 (21%), Positives = 24/60 (40%), Gaps = 2/60 (3%)

Query: 1   MGGIGKTTLAKEVARKAKN--GKLFDQIVFTEVSQNPNIKKIQGEIAFKLGLKFDEESES 58
             G GK+ +A +   K+    G  +D IV+ + S               L LK +++  +
Sbjct: 52  RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLN 111


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query283
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.92
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.18
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.97
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.91
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.6
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.38
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 95.22
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.16
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 95.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.06
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.79
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.77
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 94.74
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.63
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.61
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.52
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.42
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.35
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 94.22
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.14
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 93.87
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.61
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.57
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.53
d1okkd2207 GTPase domain of the signal recognition particle r 93.47
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 93.32
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 93.26
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 93.14
d1ls1a2207 GTPase domain of the signal sequence recognition p 93.06
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 93.04
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 93.01
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.98
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 92.97
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.92
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 92.86
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 92.78
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 92.59
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 92.57
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.46
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.43
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.41
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.2
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 92.14
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 92.1
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 92.01
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.96
d2qy9a2211 GTPase domain of the signal recognition particle r 91.81
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.79
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 91.64
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 91.61
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.58
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.52
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 91.34
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 91.2
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 91.17
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 91.15
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.09
d1j8yf2211 GTPase domain of the signal sequence recognition p 91.03
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 90.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.75
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 90.67
d1vmaa2213 GTPase domain of the signal recognition particle r 90.62
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 90.56
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 90.54
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.41
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 90.31
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 90.28
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.98
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 89.73
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 89.6
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.59
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.54
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.44
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 89.22
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 88.44
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.05
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 87.77
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 87.64
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 87.57
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 87.35
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 87.01
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.8
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 86.27
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 86.05
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.02
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.01
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 85.91
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.87
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 85.78
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 85.73
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 85.59
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 85.5
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 84.23
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 84.14
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 83.89
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 83.85
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 83.81
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.8
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 83.67
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 83.66
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.44
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 83.09
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.09
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 83.02
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 82.84
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 82.83
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 82.73
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 82.54
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 82.52
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 82.4
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 82.4
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 82.28
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 82.2
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 81.93
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 81.74
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 81.51
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 81.28
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 81.2
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 81.19
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 81.04
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 80.87
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 80.84
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.8
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 80.68
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 80.51
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 80.42
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 80.34
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 80.04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.92  E-value=8.8e-26  Score=190.68  Aligned_cols=157  Identities=12%  Similarity=0.054  Sum_probs=117.2

Q ss_pred             CCCCcHHHHHHHHHhhhc--cCCCCCeEEEEEeCCCCCHHHHHHHHHH---HhCCCCC------c--CCHhhhHHhHHHH
Q 041028            1 MGGIGKTTLAKEVARKAK--NGKLFDQIVFTEVSQNPNIKKIQGEIAF---KLGLKFD------E--ESESGRTRSPWSR   67 (283)
Q Consensus         1 mgGiGKTtLA~~v~~~~~--~~~~Fd~~~wv~v~~~~~~~~l~~~i~~---~l~~~~~------~--~~~~~~~~~l~~~   67 (283)
                      ||||||||||+++|++..  ...+|++++||++++.++...+...+..   .++....      .  .........+.+.
T Consensus        52 mgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (277)
T d2a5yb3          52 RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL  131 (277)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHH
Confidence            899999999999999854  5567899999999999887776665544   3332211      1  1222344467888


Q ss_pred             ccCCcEEEE---------------cC--------------------------------------eecCCCCCCCcchHHH
Q 041028           68 LKKEKLQII---------------CG--------------------------------------KKMEGDYAEGSELKWL   94 (283)
Q Consensus        68 L~~kr~LlV---------------~G--------------------------------------~~~~~~~~~~~~~~~~   94 (283)
                      |.++|+|+|               .|                                      +..+.. ...+..+++
T Consensus       132 L~~kr~LlVLDDv~~~~~~~~~~~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~-~~~~~~~~~  210 (277)
T d2a5yb3         132 IDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPM-PVGEKEEDV  210 (277)
T ss_dssp             TTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCC-C--CHHHHH
T ss_pred             hccCCeeEecchhhHHhhhhhhcccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCc-cCchhhHHH
Confidence            999999999               01                                      223332 234456888


Q ss_pred             HHHHHHhcCCchHHHHH---hhccCChHHHHHHHHHhcCCCCCCCCCchhHHHHHHhhhhccCCCCcHHHHHHHH
Q 041028           95 AMDVAKECAGLPVSIVT---GIKEQELFEWKDALEQLRRPSSTNFKDVQPAAYKAMELGYNKLEGDELKSTFLLI  166 (283)
Q Consensus        95 ~~~i~~~c~glPLal~~---~l~~~~~~~w~~~l~~l~~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~~fl~~  166 (283)
                      +++|+++|+|+||||++   .++.++.+.|.+...+|....       ...+..++.+||++||++ +|.||.++
T Consensus       211 ~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~-------~~~v~~il~~sY~~L~~~-lk~c~~~l  277 (277)
T d2a5yb3         211 LNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG-------LVGVECITPYSYKSLAMA-LQRCVEVL  277 (277)
T ss_dssp             HHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC-------SSTTCCCSSSSSSSHHHH-HHHHHHTS
T ss_pred             HHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCc-------HHHHHHHHHHHHhcccHH-HHHHHHhC
Confidence            99999999999999999   566888999999988886543       234688899999999998 99999864



>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure