Citrus Sinensis ID: 041065


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDATNVSSKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCTP
cEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccEEccccccEEEEEccccccEEEEccccccccccccEEEccccccEEcccHHHHccccccEEEccccccEEcccccccccccccEEEccccccEEEcccccccc
ccEEEcccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcccccEEEEEccccccccccccccccccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEcccccccccccccccc
flitisseSNEEADALLKWKASLKNHNRSLLSSCindatnvssktspcndagrvinislpnrgvngtlhdfsfssfphlayldltwngffgtippqisnlsNLRYIYlgsnqffgnipaeVGLLSHLEVLHIQLNrldgswrmctctp
flitissesneEADALLKWKASLKNHNRSLLSScindatnvssktspcnDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQlnrldgswrmctctp
FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDATNVSSKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCTP
*****************KWK*********LLSSCIN***********CNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTC**
FLITI**ESNEEADALLKWKASLKN********CINDATNVSSKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCT*
FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDAT********CNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCTP
FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDATNVSSKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDATNVSSKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTCTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query148 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik yes no 0.905 0.128 0.437 7e-21
Q9LP24 1120 Probable leucine-rich rep no no 0.837 0.110 0.454 6e-19
Q9C9N5 685 Probable inactive leucine no no 0.918 0.198 0.326 2e-11
Q94F62 615 BRASSINOSTEROID INSENSITI no no 0.898 0.216 0.35 2e-10
Q9LVP0 1102 Probable leucine-rich rep no no 0.878 0.117 0.343 4e-10
Q9LVI6 647 Probable inactive recepto no no 0.648 0.148 0.352 7e-10
Q9LP77 655 Probable inactive recepto no no 0.648 0.146 0.372 7e-10
Q9M8T0 627 Probable inactive recepto no no 0.871 0.205 0.324 9e-10
Q00874 372 DNA-damage-repair/tolerat no no 0.608 0.241 0.359 2e-09
C0LGQ5 1249 LRR receptor-like serine/ no no 0.614 0.072 0.382 4e-09
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/137 (43%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 7   SESNEEADALLKWKASLKNH-NRSLLSSCINDATN--VSSKTSPCNDAGRVINISLPNRG 63
           S + EEA+ALLKWK++  N  + S LSS +N  T+   +S        G +I ++L N G
Sbjct: 45  SATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTSSFCTSWYGVACSLGSIIRLNLTNTG 104

Query: 64  VNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGL 123
           + GT  DF FSS P+L ++DL+ N F GTI P     S L Y  L  NQ  G IP E+G 
Sbjct: 105 IEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPELGD 164

Query: 124 LSHLEVLHIQLNRLDGS 140
           LS+L+ LH+  N+L+GS
Sbjct: 165 LSNLDTLHLVENKLNGS 181





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=1 SV=1 Back     alignment and function description
>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVI6|RLK90_ARATH Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP77|Y1848_ARATH Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M8T0|Y3288_ARATH Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1 Back     alignment and function description
>sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
225456159 1038 PREDICTED: probable LRR receptor-like se 0.918 0.131 0.54 1e-32
225456161 1037 PREDICTED: probable LRR receptor-like se 0.918 0.131 0.52 6e-31
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.918 0.131 0.523 8e-30
359491509 1032 PREDICTED: probable LRR receptor-like se 0.918 0.131 0.523 8e-30
359491512 1078 PREDICTED: probable LRR receptor-like se 0.918 0.126 0.490 1e-28
6635236 861 elicitor-inducible LRR receptor-like pro 0.932 0.160 0.460 7e-24
60327224 487 Hcr2-p7.6 [Solanum pimpinellifolium] 0.891 0.271 0.445 9e-24
60327218 487 Hcr2-p7.3 [Solanum pimpinellifolium] 0.891 0.271 0.445 9e-24
60327230 487 Hcr2-p7.9 [Solanum pimpinellifolium] 0.891 0.271 0.445 9e-24
60327228 487 Hcr2-p7.8 [Solanum pimpinellifolium] 0.891 0.271 0.445 9e-24
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 102/150 (68%), Gaps = 14/150 (9%)

Query: 5   ISSESNEEADALLKWKASLKNHNRSLLSS-------CINDATNVSSKTSPC-------ND 50
           +SS SNEE  ALLKWKASL+NHN S L S         N +T++ + TSPC       N 
Sbjct: 27  VSSYSNEETQALLKWKASLQNHNHSSLLSWDLYPNNSTNSSTHLGTATSPCKWYGISCNH 86

Query: 51  AGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGS 110
           AG VI I+L   G+NGTL DFSFSSFP+LAY+D++ N   G IPPQI  L  L+Y+ L  
Sbjct: 87  AGSVIKINLTESGLNGTLMDFSFSSFPNLAYVDISMNNLSGPIPPQIGLLFELKYLDLSI 146

Query: 111 NQFFGNIPAEVGLLSHLEVLHIQLNRLDGS 140
           NQF G IP+E+GLL++LEVLH+  N+L+GS
Sbjct: 147 NQFSGGIPSEIGLLTNLEVLHLVQNQLNGS 176




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|6635236|dbj|BAA88636.1| elicitor-inducible LRR receptor-like protein EILP [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|60327224|gb|AAX19035.1| Hcr2-p7.6 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327218|gb|AAX19032.1| Hcr2-p7.3 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327230|gb|AAX19038.1| Hcr2-p7.9 [Solanum pimpinellifolium] Back     alignment and taxonomy information
>gi|60327228|gb|AAX19037.1| Hcr2-p7.8 [Solanum pimpinellifolium] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query148
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.891 0.126 0.453 7.7e-22
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.878 0.116 0.442 3.4e-20
TAIR|locus:2033379 685 AT1G66830 [Arabidopsis thalian 0.912 0.197 0.328 3.9e-13
TAIR|locus:2132634 688 AT4G22730 [Arabidopsis thalian 0.932 0.200 0.361 3.9e-13
TAIR|locus:2153097 680 AT5G51560 [Arabidopsis thalian 0.912 0.198 0.323 6.3e-13
TAIR|locus:2050877 691 AT2G45340 [Arabidopsis thalian 0.932 0.199 0.384 6.5e-13
TAIR|locus:2178968218 AT5G21090 [Arabidopsis thalian 0.925 0.628 0.351 3.1e-12
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.932 0.125 0.338 7e-12
TAIR|locus:2155001 418 AT5G66330 [Arabidopsis thalian 0.601 0.212 0.422 1.1e-11
TAIR|locus:2171973 614 AT5G45780 [Arabidopsis thalian 0.871 0.210 0.323 1.7e-11
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 7.7e-22, P = 7.7e-22
 Identities = 63/139 (45%), Positives = 85/139 (61%)

Query:     7 SESNEEADALLKWKASLKNH-NRSLLSSCINDATNVSSKTS----PCNDAGRVINISLPN 61
             S + EEA+ALLKWK++  N  + S LSS +N  T+ S  TS     C+  G +I ++L N
Sbjct:    45 SATVEEANALLKWKSTFTNQTSSSKLSSWVNPNTS-SFCTSWYGVACS-LGSIIRLNLTN 102

Query:    62 RGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEV 121
              G+ GT  DF FSS P+L ++DL+ N F GTI P     S L Y  L  NQ  G IP E+
Sbjct:   103 TGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSINQLVGEIPPEL 162

Query:   122 GLLSHLEVLHIQLNRLDGS 140
             G LS+L+ LH+  N+L+GS
Sbjct:   163 GDLSNLDTLHLVENKLNGS 181


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033379 AT1G66830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132634 AT4G22730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153097 AT5G51560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050877 AT2G45340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178968 AT5G21090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155001 AT5G66330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171973 AT5G45780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00017828001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (438 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-07
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 54.5 bits (131), Expect = 2e-09
 Identities = 26/65 (40%), Positives = 38/65 (58%)

Query: 75  SFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQL 134
           SF  L  LDL  N   G IP  ++NL++L ++ L SNQ  G IP E+G +  L+ +++  
Sbjct: 162 SFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGY 221

Query: 135 NRLDG 139
           N L G
Sbjct: 222 NNLSG 226


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 148
PLN03150 623 hypothetical protein; Provisional 99.85
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.84
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.46
PLN03150623 hypothetical protein; Provisional 99.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.18
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.17
KOG0617264 consensus Ras suppressor protein (contains leucine 99.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.03
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.95
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.66
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.64
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.64
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.63
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.57
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.56
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.53
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.44
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.4
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.39
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.38
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.33
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.32
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.32
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.32
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.23
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.15
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.05
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.02
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.0
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.0
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 97.96
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.7
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.64
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.48
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.25
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.21
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.18
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.11
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.98
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 96.98
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.63
KOG0473 326 consensus Leucine-rich repeat protein [Function un 96.52
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.45
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.32
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.15
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.08
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.89
smart0037026 LRR Leucine-rich repeats, outliers. 95.89
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.55
PRK15386 426 type III secretion protein GogB; Provisional 95.49
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.4
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.26
smart0037026 LRR Leucine-rich repeats, outliers. 94.88
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.88
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.0
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.9
PRK15386 426 type III secretion protein GogB; Provisional 93.78
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.07
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.03
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.26
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.06
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 85.67
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.97
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 80.66
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.85  E-value=7.1e-21  Score=154.58  Aligned_cols=134  Identities=26%  Similarity=0.367  Sum_probs=118.0

Q ss_pred             CCCHHHHHHHHHHHHhccCCCCCCcCCCcCCCCCc-----cccceeeCCC-----CCeEEEEcCCCCccceecCCCCCCC
Q 041065            7 SESNEEADALLKWKASLKNHNRSLLSSCINDATNV-----SSKTSPCNDA-----GRVINISLPNRGVNGTLHDFSFSSF   76 (148)
Q Consensus         7 ~~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~c-----~~~gv~c~~~-----~~l~~L~l~~n~l~~~~p~~~~~~l   76 (148)
                      .....|..+|..+|..+..+.   ..+|.+  ++|     .|.|+.|...     ..++.|+|++|.+.|.+|. .+..+
T Consensus       368 ~t~~~~~~aL~~~k~~~~~~~---~~~W~g--~~C~p~~~~w~Gv~C~~~~~~~~~~v~~L~L~~n~L~g~ip~-~i~~L  441 (623)
T PLN03150        368 KTLLEEVSALQTLKSSLGLPL---RFGWNG--DPCVPQQHPWSGADCQFDSTKGKWFIDGLGLDNQGLRGFIPN-DISKL  441 (623)
T ss_pred             ccCchHHHHHHHHHHhcCCcc---cCCCCC--CCCCCcccccccceeeccCCCCceEEEEEECCCCCccccCCH-HHhCC
Confidence            345678999999999886432   237965  345     6999999522     2489999999999999997 89999


Q ss_pred             CCCcEEEcccCccccCCCccccCCCCCceeecCCCcccccCCccccCCCCCcEEEccCccccccCCCCCc
Q 041065           77 PHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTC  146 (148)
Q Consensus        77 ~~L~~L~ls~n~l~g~~p~~~~~l~~L~~L~ls~n~l~g~~p~~~~~l~~L~~L~l~~N~l~g~iP~~~~  146 (148)
                      ++|+.|+|++|.+.|.+|..++.+++|+.|+|++|+++|.+|..++.+++|++|+|++|+++|.+|..++
T Consensus       442 ~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~  511 (623)
T PLN03150        442 RHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALG  511 (623)
T ss_pred             CCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCChHHh
Confidence            9999999999999999999999999999999999999999999999999999999999999999998765



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 5e-07
3rgx_A768 Structural Insight Into Brassinosteroid Perception 5e-07
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-06
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 5e-07, Method: Compositional matrix adjust. Identities = 32/97 (32%), Positives = 48/97 (49%), Gaps = 10/97 (10%) Query: 43 SKTSPCNDAGRVINISLPNRGVNGTLHDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSN 102 S +PCN RV G +F + + +LD+++N G IP +I ++ Sbjct: 605 STRNPCNITSRVY----------GGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY 654 Query: 103 LRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDG 139 L + LG N G+IP EVG L L +L + N+LDG Sbjct: 655 LFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG 691
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query148
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-24
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-08
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 7e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 8e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 5e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 4e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 96.5 bits (241), Expect = 2e-24
 Identities = 34/150 (22%), Positives = 55/150 (36%), Gaps = 20/150 (13%)

Query: 1   FLITISSESNEEADALLKWKASLKNHNRSLLSSCINDATNVSSKTSPCN------DAGRV 54
           F  + S     E   L+ +K  L + N  LL          SS  +PC          +V
Sbjct: 2   FQASPSQSLYREIHQLISFKDVLPDKN--LLPDW-------SSNKNPCTFDGVTCRDDKV 52

Query: 55  INISLPNRGVNGTLHDF--SFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQ 112
            +I L ++ +N        S  S   L  L L+ +   G++       ++L  + L  N 
Sbjct: 53  TSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSLDLSRNS 111

Query: 113 FFGNIPAEVGL--LSHLEVLHIQLNRLDGS 140
             G +     L   S L+ L++  N LD  
Sbjct: 112 LSGPVTTLTSLGSCSGLKFLNVSSNTLDFP 141


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.9
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.87
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.82
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.62
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.62
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.57
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.55
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.55
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.5
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.49
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.49
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.49
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.48
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.47
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.46
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.45
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.45
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.45
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.43
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.43
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.42
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.42
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.42
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.42
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.42
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.42
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.41
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.4
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.39
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.39
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.38
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.38
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.38
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.36
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.36
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.36
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.35
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 99.35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.35
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.35
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.34
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.33
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.33
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.33
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 99.33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.32
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.31
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.31
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.3
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.3
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.28
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.26
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.22
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 99.22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.22
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.2
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.2
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.18
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.02
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.01
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.0
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.99
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.99
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.98
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.98
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.97
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.96
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.94
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.94
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.94
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.92
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.9
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.86
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.81
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.68
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.66
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.58
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.52
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.43
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.42
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.32
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.97
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.9
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.78
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.39
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.9
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.8
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 96.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.16
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.16
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.13
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.17
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.81
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.65
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.61
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.93  E-value=6.6e-26  Score=168.99  Aligned_cols=137  Identities=26%  Similarity=0.411  Sum_probs=113.7

Q ss_pred             CCCHHHHHHHHHHHHhccCCCCCCcCCCcCCCCCcc--ccceeeCCC---CCeEEEEcCCCCccc--eecCCCCCCCCCC
Q 041065            7 SESNEEADALLKWKASLKNHNRSLLSSCINDATNVS--SKTSPCNDA---GRVINISLPNRGVNG--TLHDFSFSSFPHL   79 (148)
Q Consensus         7 ~~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~c~--~~gv~c~~~---~~l~~L~l~~n~l~~--~~p~~~~~~l~~L   79 (148)
                      .|.++|++||++||+++.++.  .+.+|..+.++|.  |.||+|...   ++|+.|+++++.+.+  .+|. .+..+++|
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~--~l~~W~~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~-~l~~l~~L   78 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-SLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG--GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-GGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHhcCCcc--cccCCCCCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccCh-hHhCCCCC
Confidence            578899999999999997643  4789987778998  999999854   689999999999998  7886 78888888


Q ss_pred             cEEEccc-CccccCCCccccCCCCCceeecCCCcccccCCccccCCCCCcEEEccCccccccCCCCCc
Q 041065           80 AYLDLTW-NGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTC  146 (148)
Q Consensus        80 ~~L~ls~-n~l~g~~p~~~~~l~~L~~L~ls~n~l~g~~p~~~~~l~~L~~L~l~~N~l~g~iP~~~~  146 (148)
                      ++|++++ |.+.+.+|..+.++++|++|++++|++++.+|..+..+++|++|++++|+++|.+|..++
T Consensus        79 ~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  146 (313)
T 1ogq_A           79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS  146 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             CeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHh
Confidence            8888884 888888888888888888888888888777777777777888888887777777776554



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 148
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 46.7 bits (109), Expect = 2e-07
 Identities = 18/69 (26%), Positives = 28/69 (40%), Gaps = 1/69 (1%)

Query: 69  HDFSFSSFPHLAYLDLTWNGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLE 128
                    +L  LDL  N  +GT+P  ++ L  L  + +  N   G IP + G L   +
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFD 294

Query: 129 VLHIQLNRL 137
           V     N+ 
Sbjct: 295 VSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query148
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.28
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.27
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.27
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.21
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.07
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.96
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.88
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.85
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.84
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.78
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.73
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.63
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.43
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.04
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.92
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.68
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.67
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.35
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.36
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.39
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.94  E-value=2.3e-27  Score=174.65  Aligned_cols=137  Identities=26%  Similarity=0.411  Sum_probs=116.5

Q ss_pred             CCCHHHHHHHHHHHHhccCCCCCCcCCCcCCCCCcc--ccceeeCCC---CCeEEEEcCCCCccc--eecCCCCCCCCCC
Q 041065            7 SESNEEADALLKWKASLKNHNRSLLSSCINDATNVS--SKTSPCNDA---GRVINISLPNRGVNG--TLHDFSFSSFPHL   79 (148)
Q Consensus         7 ~~~~~~~~~l~~~~~~~~~~~~~~~~~W~~~~~~c~--~~gv~c~~~---~~l~~L~l~~n~l~~--~~p~~~~~~l~~L   79 (148)
                      -|.++|++||++||+.+.++.  .+++|..++|||.  |.||+|+..   .+|++|+|+++++.|  .+|. .+.++++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~--~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~-~l~~L~~L   78 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT--TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS-SLANLPYL   78 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG--GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG-GGGGCTTC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC--cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh-HHhcCccc
Confidence            478999999999999998753  3789988889994  999999854   379999999999987  4676 89999999


Q ss_pred             cEEEccc-CccccCCCccccCCCCCceeecCCCcccccCCccccCCCCCcEEEccCccccccCCCCCc
Q 041065           80 AYLDLTW-NGFFGTIPPQISNLSNLRYIYLGSNQFFGNIPAEVGLLSHLEVLHIQLNRLDGSWRMCTC  146 (148)
Q Consensus        80 ~~L~ls~-n~l~g~~p~~~~~l~~L~~L~ls~n~l~g~~p~~~~~l~~L~~L~l~~N~l~g~iP~~~~  146 (148)
                      ++|+|++ |+++|.+|+.|+++++|++|+|++|++.+..|..+..+.+|++++++.|.+.+.+|..++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~  146 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS  146 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhc
Confidence            9999997 899999999999999999999999998887777777777777777777777766666554



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure