Citrus Sinensis ID: 041081

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADDPLTSDDLSNNGIKLAGGCKRRKGRTSKVNSKKHKLALASIGMPKTKRGTISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVNSNLNREKASAEDEVKRDQDKMAKSAEKESVFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSGNGEGCQ
ccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccHHcccccccccHHHHHHHHHHHHHcccccccHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHccccHHHHHHccccccccccccccHHHccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccHHHcccccccccccccccccccccHHHHHHHHcccccccccccccHHcccccccccHHHccHEEEccccccEEEEEEccccccccc
mgrapccekiglkkgrwtaEEDEILTKYIRAngegswrslpknagllrcgksCRLRWINYLRADlkrgnitaeEEETIVKLHSSLGNRWSLIaaqlpgrtdneiknywnshlsrktfsftgpaddpltsddlsnngiklaggckrrkgrtskvnskkHKLALAsigmpktkrgtiSEVLDQQvtadenkssigqvscmasdeffcgeassdqasglclskdiesevlgpyewlDSEIKRVNSNLnrekasaedEVKRDQDKMAKSAEkesvfwgsnedellytfdptmmncsgfdeewldfdwaaggaechnqcelrdgddKLLCWLwdsgngegcq
mgrapccekiglkkgrwtaeeDEILTKYirangegswrslpknagllrcGKSCRLRWINYLRadlkrgnitaEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADdpltsddlsnngiklaggckrrkgrtskvnskkhklalasigmpktkrgtISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVNsnlnrekasaedevkrdqdkmaksaekesvfwgsneDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSGNGEGCQ
MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADDPLTSDDLSNNGIKLAGGCKRRKGRTSKVNSKKHKLALASIGMPKTKRGTISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVNSNLNREKASAEDEVKRDQDKMAKSAEKESVFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSGNGEGCQ
*****CCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTF******************************************************************************SCMASDEFFCGE*******GLCLSKDIESEVLGPYEWLDSE**********************************VFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWD********
*GRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTF*************************************************************************************************************LGPYEWLDSEI*******************************************************GFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSG******
MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADDPLTSDDLSNNGIKLAGG***************HKLALASIGMPKTKRGTISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVNSNL*************************SVFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSGNGEGCQ
***APCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADDPLTSDDL**************************************************************************************************************************VKRDQDKMAKSAEKESVFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDS*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPADDPLTSDDLSNNGIKLAGGCKRRKGRTSKVNSKKHKLALASIGMPKTKRGTISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVxxxxxxxxxxxxxxxxxxxxxxxxxxxxESVFWGSNEDELLYTFDPTMMNCSGFDEEWLDFDWAAGGAECHNQCELRDGDDKLLCWLWDSGNGEGCQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query337 2.2.26 [Sep-21-2011]
O22264371 Transcription factor MYB1 no no 0.442 0.401 0.708 2e-58
P27898399 Myb-related protein P OS= N/A no 0.394 0.333 0.722 3e-55
P20025255 Myb-related protein Zm38 N/A no 0.403 0.533 0.669 1e-49
P81393232 Myb-related protein 308 O N/A no 0.350 0.508 0.754 2e-48
P20026267 Myb-related protein Hv1 O N/A no 0.370 0.468 0.710 2e-48
Q9SZP1282 Transcription repressor M no no 0.341 0.407 0.765 3e-48
P81395274 Myb-related protein 330 O N/A no 0.388 0.478 0.694 3e-48
Q38851236 Transcription repressor M no no 0.353 0.504 0.722 2e-47
Q7XBH4257 Myb-related protein Myb4 no no 0.341 0.447 0.713 2e-47
Q9S9K9257 Transcription factor MYB3 no no 0.350 0.459 0.720 2e-47
>sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 Back     alignment and function desciption
 Score =  226 bits (575), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/158 (70%), Positives = 126/158 (79%), Gaps = 9/158 (5%)

Query: 1   MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
           MGRAPCCEK+G+K+GRWTAEED+IL+ YI++NGEGSWRSLPKNAGL RCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKVGIKRGRWTAEEDQILSNYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINY 60

Query: 61  LRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFT 120
           LR+DLKRGNIT EEEE +VKLHS+LGNRWSLIA  LPGRTDNEIKNYWNSHLSRK  +F 
Sbjct: 61  LRSDLKRGNITPEEEELVVKLHSTLGNRWSLIAGHLPGRTDNEIKNYWNSHLSRKLHNFI 120

Query: 121 GPADDPLTSDDLSNNGIKLAGG------CKRRKGRTSK 152
                P  S D+S   +  A         KRR GRTS+
Sbjct: 121 ---RKPSISQDVSAVIMTNASSAPPPPQAKRRLGRTSR 155
Transcription factor that activates the expression of CHS, CHI, F3H and FLS1. Flavonol-specific activator of flavonoid biosynthesis.
Arabidopsis thaliana (taxid: 3702)
>sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
327412641379 putative MYB transcription factor [Rosa 0.982 0.873 0.438 1e-69
225431879383 PREDICTED: uncharacterized protein LOC10 0.940 0.827 0.452 3e-68
297795689343 AtMYB111 [Arabidopsis lyrata subsp. lyra 0.724 0.711 0.525 2e-65
356564624350 PREDICTED: myb-related protein 308-like 0.682 0.657 0.536 6e-65
15239855342 myb domain protein 111 [Arabidopsis thal 0.688 0.678 0.519 3e-64
296083282362 unnamed protein product [Vitis vinifera] 0.875 0.814 0.459 4e-64
326631146343 MYB domain protein 111 [Brassica rapa su 0.697 0.685 0.542 5e-64
356519936337 PREDICTED: protein ODORANT1-like [Glycin 0.682 0.682 0.534 3e-63
356500104349 PREDICTED: uncharacterized protein LOC10 0.890 0.859 0.468 9e-62
71041100364 MYB22 [Malus x domestica] 0.471 0.436 0.708 1e-61
>gi|327412641|emb|CCA29109.1| putative MYB transcription factor [Rosa hybrid cultivar] Back     alignment and taxonomy information
 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 168/383 (43%), Positives = 215/383 (56%), Gaps = 52/383 (13%)

Query: 1   MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
           MGRAPCCEK+GLK+GRWTAEEDEILT YI+ +GEGSWRSLPKNAGLLRCGKSCRLRWINY
Sbjct: 1   MGRAPCCEKVGLKRGRWTAEEDEILTNYIQLHGEGSWRSLPKNAGLLRCGKSCRLRWINY 60

Query: 61  LRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFT 120
           LR DL+RGNIT EEEETIVKLH++LGNRWSLIAA LPGRTDNEIKNYWNSHLSRK ++FT
Sbjct: 61  LRTDLRRGNITQEEEETIVKLHTALGNRWSLIAAHLPGRTDNEIKNYWNSHLSRKIYTFT 120

Query: 121 GPADDPLTSDDLSNNGIKLAGGCKRRKGRTSKVNSK-KHKL--------ALASIGMPKTK 171
               +      + NN  KLA    +R+ RTS+   K K+KL            +  P  K
Sbjct: 121 KLMKNECLIPTMINNVSKLAAAKSKRRVRTSRSAMKSKNKLNKNGTVLAPFPQVPKPAYK 180

Query: 172 RGTISEVLDQQVTADENKSSIG-------------------------QVSCMASDEFFCG 206
                 +  +     +   S+G                         Q SC+   +   G
Sbjct: 181 TDVFESLTRENPNQVQTSHSMGLECWAPKERDEKEEEEKTIRTLGGVQGSCL---DITAG 237

Query: 207 EASSDQASGLCLSKDIESEVLGPYEWLDSEIKRVNSNLNREKASAEDEVKRDQDKMAKSA 266
             SS   + +  + + E E L PYE +DS++  V+ N +        + +R+   M  + 
Sbjct: 238 MISSTTPA-IYAANNGEKEALDPYECVDSDVI-VDHNPSGSTTVVGFKQQRENGVMGFTD 295

Query: 267 EKESV------FWGSNEDEL---LYTFDPTMMNCSGFDEEWLDFDW--AAGGAECH-NQC 314
           + E         W SN +     +Y F  + +N +  D EWLD DW    GG +CH ++ 
Sbjct: 296 DHEVTIKSHQGIWSSNIEGSCGEMYAFS-SPLNAAFDDHEWLDCDWFGGGGGLQCHDDEL 354

Query: 315 ELRDGDDKLLCWLWDSGNGEGCQ 337
           EL    +  + WLW+SGN  G Q
Sbjct: 355 ELWGEREVRIPWLWESGNDVGDQ 377

Source: Rosa hybrid cultivar

Species: Rosa hybrid cultivar

Genus: Rosa

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225431879|ref|XP_002271862.1| PREDICTED: uncharacterized protein LOC100251652 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297795689|ref|XP_002865729.1| AtMYB111 [Arabidopsis lyrata subsp. lyrata] gi|297311564|gb|EFH41988.1| AtMYB111 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356564624|ref|XP_003550551.1| PREDICTED: myb-related protein 308-like [Glycine max] Back     alignment and taxonomy information
>gi|15239855|ref|NP_199744.1| myb domain protein 111 [Arabidopsis thaliana] gi|15420626|gb|AAK97396.1|AF371977_1 putative transcription factor [Arabidopsis thaliana] gi|10177162|dbj|BAB10351.1| unnamed protein product [Arabidopsis thaliana] gi|41619444|gb|AAS10104.1| MYB transcription factor [Arabidopsis thaliana] gi|332008414|gb|AED95797.1| myb domain protein 111 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296083282|emb|CBI22918.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|326631146|gb|ADZ98865.1| MYB domain protein 111 [Brassica rapa subsp. rapa] Back     alignment and taxonomy information
>gi|356519936|ref|XP_003528624.1| PREDICTED: protein ODORANT1-like [Glycine max] Back     alignment and taxonomy information
>gi|356500104|ref|XP_003518874.1| PREDICTED: uncharacterized protein LOC100814275 [Glycine max] Back     alignment and taxonomy information
>gi|71041100|gb|AAZ20438.1| MYB22 [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query337
TAIR|locus:2155944342 MYB111 "myb domain protein 111 0.908 0.894 0.471 1.8e-62
TAIR|locus:2062040371 MYB12 "myb domain protein 12" 0.462 0.420 0.686 2e-59
TAIR|locus:2081735343 MYB11 "myb domain protein 11" 0.632 0.620 0.510 2.6e-54
TAIR|locus:2059883269 MYB7 "myb domain protein 7" [A 0.350 0.438 0.737 2.6e-47
TAIR|locus:2121259282 MYB4 "myb domain protein 4" [A 0.341 0.407 0.765 2.6e-47
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.397 0.448 0.649 5.4e-47
TAIR|locus:2133677236 MYB6 "myb domain protein 6" [A 0.563 0.805 0.512 6.9e-47
TAIR|locus:2009452257 MYB3 "myb domain protein 3" [A 0.350 0.459 0.720 8.8e-47
TAIR|locus:1005716764212 HOS10 "high response to osmoti 0.341 0.542 0.747 3e-46
TAIR|locus:2131576274 MYB32 "myb domain protein 32" 0.341 0.419 0.730 7.9e-46
TAIR|locus:2155944 MYB111 "myb domain protein 111" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.8e-62, P = 1.8e-62
 Identities = 165/350 (47%), Positives = 203/350 (58%)

Query:     1 MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINY 60
             MGRAPCCEKIGLK+GRWTAEEDEILTKYI+ NGEGSWRSLPK AGLLRCGKSCRLRWINY
Sbjct:     1 MGRAPCCEKIGLKRGRWTAEEDEILTKYIQTNGEGSWRSLPKKAGLLRCGKSCRLRWINY 60

Query:    61 LRADLKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFT 120
             LR DLKRGNIT++EEE IVKLHS LGNRWSLIA  LPGRTDNEIKNYWNSHLSRK ++FT
Sbjct:    61 LRRDLKRGNITSDEEEIIVKLHSLLGNRWSLIATHLPGRTDNEIKNYWNSHLSRKIYAFT 120

Query:   121 GPADDP---LTSDDLSNNGIKLAGGCK-------RRKGRTSKVNSKKHK-LALAS--IGM 167
               + D    L +D +       + G K       ++KGRTS+ + KKHK +  AS     
Sbjct:   121 AVSGDGHNLLVNDVVLKKSCSSSSGAKNNNKTKKKKKGRTSRSSMKKHKQMVTASQCFSQ 180

Query:   168 PKTKRGTISEVLDQQVTADENKSSIGQVSCMASDEFFCGEASSDQASGL--CLSKDIESE 225
             PK      SE         +N +  G+   +   E+  GE     +S +  C S   E  
Sbjct:   181 PKELESDFSE-------GGQNGNFEGE--SLGPYEWLDGELERLLSSCVWECTS---EEA 228

Query:   226 VLGPYEWLDSEIKRVNS---NLNREKASAEDEVKR------DQDKMAKSAEKESVFWGSN 276
             V+G  +    E    +S   NL  E+  +E ++        D D M    E+E  F  SN
Sbjct:   229 VIGVNDEKVCESGDNSSCCVNLFEEEQGSETKIGHVGITEVDHD-MTVEREREGSFLSSN 287

Query:   277 EDELL-YTFDPTMMNCS----GFDEEWLDFDWAAGGAECHNQCELRDGDD 321
              +E     +   + N S    G DEE LD+++  G   C +  +L D  D
Sbjct:   288 SNENNDKDWWVGLCNSSEVGFGVDEELLDWEFQ-GNVTCQSD-DLWDLSD 335
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0051555 "flavonol biosynthetic process" evidence=IMP
TAIR|locus:2062040 MYB12 "myb domain protein 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081735 MYB11 "myb domain protein 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1005716764 HOS10 "high response to osmotic stress 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131576 MYB32 "myb domain protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00033103001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (383 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 9e-55
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 6e-52
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-13
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 4e-13
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 2e-05
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  179 bits (454), Expect = 9e-55
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 3/133 (2%)

Query: 5   PCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD 64
           PCC K+G+K+G WT EEDEIL  +I+  GEG WRSLPK AGLLRCGKSCRLRW+NYLR  
Sbjct: 16  PCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPS 75

Query: 65  LKRGNITAEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFTGPAD 124
           +KRG IT++EE+ I++LH  LGNRWSLIA ++PGRTDNEIKNYWN+HL +K         
Sbjct: 76  VKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLR---QGI 132

Query: 125 DPLTSDDLSNNGI 137
           DP T   L  N I
Sbjct: 133 DPQTHKPLDANNI 145

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 337
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.93
PLN03212249 Transcription repressor MYB5; Provisional 99.9
PLN03091 459 hypothetical protein; Provisional 99.88
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.82
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.79
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.6
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.56
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.45
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.43
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.41
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.4
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.28
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.19
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.07
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.05
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.97
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.94
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.79
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.59
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.54
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.53
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.42
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.42
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.09
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.96
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.74
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.73
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.67
KOG1279506 consensus Chromatin remodeling factor subunit and 96.53
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.53
KOG1279506 consensus Chromatin remodeling factor subunit and 96.43
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.19
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 96.14
PRK13923170 putative spore coat protein regulator protein YlbO 95.83
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.15
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 94.62
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.34
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.25
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.83
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 92.21
PLN031421033 Probable chromatin-remodeling complex ATPase chain 92.03
PRK13923170 putative spore coat protein regulator protein YlbO 91.39
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 87.85
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 86.78
KOG4282345 consensus Transcription factor GT-2 and related pr 86.43
KOG1194534 consensus Predicted DNA-binding protein, contains 83.73
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-35  Score=291.89  Aligned_cols=120  Identities=63%  Similarity=1.105  Sum_probs=115.5

Q ss_pred             CCCCcccccCCCccCCCCHHHHHHHHHHHHHhCCCCCcccccccCccccccccchhhhhcccCCCCCCCCCHHHHHHHHH
Q 041081            1 MGRAPCCEKIGLKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVK   80 (337)
Q Consensus         1 m~r~~~~~k~~lkkg~WT~EED~~L~~~V~~~G~~~W~~IA~~l~~~Rt~~qCr~Rw~~~L~p~~kkg~WT~EED~~Ll~   80 (337)
                      |||++||+|+.++|++||+|||++|+++|++||.++|..||+.++.+|+++|||+||.++|+|.+++++||+|||++|++
T Consensus         1 mgr~~Cc~KqklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLLe   80 (459)
T PLN03091          1 MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLIIE   80 (459)
T ss_pred             CCCCccCcCCCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999998755999999999999999999999999999999999


Q ss_pred             HHHHcCCCHHHHHhhCCCCCHHHHHHHHHHhcccccCCCC
Q 041081           81 LHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKTFSFT  120 (337)
Q Consensus        81 lv~~~G~~W~~IA~~lpgRt~~qcr~Rw~~~L~~~i~~~~  120 (337)
                      ++++||++|..||++|||||+++||+||+.+|+++++...
T Consensus        81 L~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~  120 (459)
T PLN03091         81 LHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRG  120 (459)
T ss_pred             HHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcC
Confidence            9999999999999999999999999999999998876544

>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 5e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 6e-20
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 8e-20
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 8e-20
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-19
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 6e-18
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 5e-11
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 1e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 2e-09
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 6e-06
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
Query: 12  LKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNIT 71
           L KG WT EED+ + ++++  G   W  + K+    R GK CR RW N+L  ++K+ + T
Sbjct: 25  LNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 83
Query: 72  AEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRKT 116
            EE+  I + H  LGNRW+ IA  LPGRTDN +KN+WNS + RK 
Sbjct: 84  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query337
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 1e-60
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-59
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-59
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 3e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-48
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 9e-30
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 5e-48
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-22
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-19
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 9e-17
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-12
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-07
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 1e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 6e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 2e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-05
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 3e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 8e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 3e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 6e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  188 bits (480), Expect = 1e-60
 Identities = 49/104 (47%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 12  LKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNIT 71
           L KG WT EED+ + K ++  G   W  + K+    R GK CR RW N+L  ++K+ + T
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSWT 60

Query: 72  AEEEETIVKLHSSLGNRWSLIAAQLPGRTDNEIKNYWNSHLSRK 115
            EE+  I + H  LGNRW+ IA  LPGRTDN IKN+WNS + RK
Sbjct: 61  EEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.92
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.9
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.89
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.82
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.75
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.71
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.7
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.7
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.7
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.67
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.67
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.65
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.65
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.63
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.63
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.61
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.61
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.6
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.59
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.56
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.55
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.54
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.53
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.51
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.5
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.49
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.48
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.48
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.18
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.44
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.41
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.38
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.37
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.36
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.34
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.32
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.28
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.25
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.25
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.86
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.2
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.15
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.12
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.94
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.82
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.77
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.72
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.69
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.64
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.57
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.43
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.41
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.41
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.34
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.33
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.16
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.02
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.0
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.96
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.04
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.73
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.68
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.64
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.49
2crg_A70 Metastasis associated protein MTA3; transcription 97.48
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.45
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.4
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.38
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.02
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.94
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.59
2crg_A70 Metastasis associated protein MTA3; transcription 96.56
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.28
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.19
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.06
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.87
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 95.69
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.26
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.12
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 94.09
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.49
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 86.59
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=2.6e-41  Score=295.57  Aligned_cols=153  Identities=29%  Similarity=0.517  Sum_probs=109.8

Q ss_pred             CccCCCCHHHHHHHHHHHHHhCCCCCcccccccCccccccccchhhhhcccCCCCCCCCCHHHHHHHHHHHHHcCC-CHH
Q 041081           12 LKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRADLKRGNITAEEEETIVKLHSSLGN-RWS   90 (337)
Q Consensus        12 lkkg~WT~EED~~L~~~V~~~G~~~W~~IA~~l~~~Rt~~qCr~Rw~~~L~p~~kkg~WT~EED~~Ll~lv~~~G~-~W~   90 (337)
                      +++++||+|||++|+++|.+||.++|..||+.|++ |++.||++||.++|+|.+++++||+|||++|+++|..||. +|.
T Consensus         4 ~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~-Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W~   82 (159)
T 1h89_C            4 LGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPN-RTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWS   82 (159)
T ss_dssp             ----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCC-CCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccHH
Confidence            68999999999999999999998899999999998 9999999999999999999999999999999999999995 799


Q ss_pred             HHHhhCCCCCHHHHHHHHHHhcccccCCCC-CCCCCCcChHHHhhcCccccCCCCCCCCCCccccccccchhhhcc
Q 041081           91 LIAAQLPGRTDNEIKNYWNSHLSRKTFSFT-GPADDPLTSDDLSNNGIKLAGGCKRRKGRTSKVNSKKHKLALASI  165 (337)
Q Consensus        91 ~IA~~lpgRt~~qcr~Rw~~~L~~~i~~~~-~~~ed~l~~~~~~~~G~kw~~iak~~~GRt~~~iknr~~~~~~~~  165 (337)
                      .||++|||||++||++||+++|+|.+++.+ +++||.+++..+..+|++|+.||+.+||||++.+++||+.++++.
T Consensus        83 ~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~gRt~~~~knr~~~~~r~~  158 (159)
T 1h89_C           83 VIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK  158 (159)
T ss_dssp             HHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTSTTCCHHHHHHHHHTTTCC-
T ss_pred             HHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999988 999999999999999999999999999999999999999987653
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 337
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-16
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-15
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-08
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-14
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-13
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 0.001
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-13
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-04
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 5e-13
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 8e-13
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-07
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 5e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 8e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 6e-06
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-09
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 70.9 bits (174), Expect = 1e-16
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 12 LKKGRWTAEEDEILTKYIRANGEGSWRSLPKNAGLLRCGKSCRLRWINYLRAD 64
          L KG WT EED+ L K ++  G   W  + K+    R GK CR RW N+L  +
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query337
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.71
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.68
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.68
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.65
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.53
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.51
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.48
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.48
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.44
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.43
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.41
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.4
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.38
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.35
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.32
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.28
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.25
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.23
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.21
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.14
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.09
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.08
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.84
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.81
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.6
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.04
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.96
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.58
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.37
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.74
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.74
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.59
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.62
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 93.98
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 93.3
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 88.54
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 84.72
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 83.58
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.71  E-value=5.9e-18  Score=120.31  Aligned_cols=51  Identities=37%  Similarity=0.757  Sum_probs=48.7

Q ss_pred             CCCCCCCHHHHHHHHHHHHHcC-CCHHHHHhhCCCCCHHHHHHHHHHhcccc
Q 041081           65 LKRGNITAEEEETIVKLHSSLG-NRWSLIAAQLPGRTDNEIKNYWNSHLSRK  115 (337)
Q Consensus        65 ~kkg~WT~EED~~Ll~lv~~~G-~~W~~IA~~lpgRt~~qcr~Rw~~~L~~~  115 (337)
                      +++|+||+|||++|+++|++|| .+|..||+.|++||+.||++||+++|+|+
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTSTTCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHhhCCCC
Confidence            4789999999999999999999 68999999999999999999999999985
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure