Citrus Sinensis ID: 041084

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTSSSSSWYELAYSEAKGRIRKGDRIWQVGFGSGFNTIKPEQEKNRWTDEIDDFPVHVPNIAPINF

ccccccccccccHHHcccccccccEEEEEEcccccccccccEEEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHccEEEEccccHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHHccccccccEEEEEEEccccccccccccccccccccccccccccccccccc

ccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHEEEEHHEEccEEEEEccccccEEEEccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHccccHHcccccEEEEcccccccHHHHHHHHHHHHcccccccEEEEEEEccccccccccccccccHHHHcccccccccEEEccc

mavsfytgndrSMVLANGLFREGDAAILLSnrssdrgrskyELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHItafeplvlpaskqLLFLENSVARTIFKmkinpyvpdfkLAFEHFCVHVGGKAVLDEMEKKVQLsewhmepmtlyrfgntssssSWYELAYSEAKgrirkgdriwqvgfgsgfntikpeqeknrwtdeiddfpvhvpniapinf

mavsfytgndrSMVLANGLFREGDAAIllsnrssdrgrskYELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTSSSSSWYELAYSEAkgrirkgdriWQVGfgsgfntikpeqeknrwtdeiddfpvhvpniapinf

MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTsssssWYELAYSEAKGRIRKGDRIWQVGFGSGFNTIKPEQEKNRWTDEIDDFPVHVPNIAPINF

**********RSMVLANGLFREGDAAILL***********YELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTSSSSSWYELAYSEAKGRIRKGDRIWQVGFGSGFNTIKP****NRWTDEIDDFPVHVP*******

MAVSF**GNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTSSSSSWYELAYSEAKGRIRKGDRIWQVGFGSGFNTIKPEQEKNRWTDEIDDFPVHVPNI*P***

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		225	2.2.26 [Sep-21-2011]
O48780		509	3-ketoacyl-CoA synthase 1	yes	no	0.991	0.438	0.573	5e-75
Q5XEP9		528	3-ketoacyl-CoA synthase 1	no	no	0.973	0.414	0.564	1e-73
Q9FG87		529	3-ketoacyl-CoA synthase 1	no	no	0.991	0.421	0.592	4e-71
Q9MAM3		528	3-ketoacyl-CoA synthase 1	no	no	0.964	0.410	0.514	2e-65
Q9SS39		459	Probable 3-ketoacyl-CoA s	no	no	0.964	0.472	0.525	2e-62
Q9ZUZ0		466	3-ketoacyl-CoA synthase 1	no	no	0.964	0.465	0.525	3e-62
Q9XF43		497	3-ketoacyl-CoA synthase 6	no	no	0.968	0.438	0.5	7e-62
Q9C6L5		492	3-ketoacyl-CoA synthase 5	no	no	0.968	0.443	0.491	7e-61
Q9LN49		516	3-ketoacyl-CoA synthase 4	no	no	0.937	0.408	0.502	3e-60
Q9SIX1		512	3-ketoacyl-CoA synthase 9	no	no	0.937	0.412	0.497	9e-60

>sp\|O48780\|KCS11_ARATH 3-ketoacyl-CoA synthase 11 OS=Arabidopsis thaliana GN=KCS11 PE=1 SV=1	Back alignment and function desciption

 Score =  280 bits (717), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 171/244 (70%), Gaps = 21/244 (8%)

Query: 1   MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTM---------C 51
           + +++Y GNDRS +++N LFR G AAILLSN+  DR RSKYEL  T+RT          C
Sbjct: 266 ITLNWYFGNDRSKLVSNCLFRMGGAAILLSNKRWDRRRSKYELVDTVRTHKGADDKCFGC 325

Query: 52  RRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMK 111
             Q+          + K L+ VAG  LKT+IT   PLVLP S+QLLF    V R +FKMK
Sbjct: 326 ITQEEDSASKIGVTLSKELMAVAGDALKTNITTLGPLVLPTSEQLLFFATLVGRKLFKMK 385

Query: 112 INPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTSSSSSWYE 169
           I PY+PDFKLAFEHFC+H GG+AVLDE+EK ++L+EWHMEP  MTLYRFGNTSSSS WYE
Sbjct: 386 IKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLKLTEWHMEPSRMTLYRFGNTSSSSLWYE 445

Query: 170 LAYSEAKGRIRKGDRIWQVGFGSGFN----------TIKPEQEKNRWTDEIDDFPVHVPN 219
           LAYSEAKGRI+KGDRIWQ+ FGSGF           ++ P++EKN W DEI +FPV VP 
Sbjct: 446 LAYSEAKGRIKKGDRIWQIAFGSGFKCNSSVWRAVRSVNPKKEKNPWMDEIHEFPVEVPK 505

Query: 220 IAPI 223
           ++ I
Sbjct: 506 VSTI 509

Active on both saturated and mono-unsaturated acyl chains C16 to C20.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 1EC: 9

>sp\|Q5XEP9\|KCS17_ARATH 3-ketoacyl-CoA synthase 17 OS=Arabidopsis thaliana GN=KCS17 PE=2 SV=2	Back alignment and function description

>sp\|Q9FG87\|KCS19_ARATH 3-ketoacyl-CoA synthase 19 OS=Arabidopsis thaliana GN=KCS19 PE=2 SV=1	Back alignment and function description

>sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1 OS=Arabidopsis thaliana GN=KCS1 PE=2 SV=1	Back alignment and function description

>sp\|Q9SS39\|KCS14_ARATH Probable 3-ketoacyl-CoA synthase 14 OS=Arabidopsis thaliana GN=KCS14 PE=2 SV=1	Back alignment and function description

>sp\|Q9ZUZ0\|KCS13_ARATH 3-ketoacyl-CoA synthase 13 OS=Arabidopsis thaliana GN=HIC PE=2 SV=1	Back alignment and function description

>sp\|Q9XF43\|KCS6_ARATH 3-ketoacyl-CoA synthase 6 OS=Arabidopsis thaliana GN=CUT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9C6L5\|KCS5_ARATH 3-ketoacyl-CoA synthase 5 OS=Arabidopsis thaliana GN=KCS5 PE=1 SV=1	Back alignment and function description

>sp\|Q9LN49\|KCS4_ARATH 3-ketoacyl-CoA synthase 4 OS=Arabidopsis thaliana GN=KCS4 PE=2 SV=1	Back alignment and function description

>sp\|Q9SIX1\|KCS9_ARATH 3-ketoacyl-CoA synthase 9 OS=Arabidopsis thaliana GN=KCS9 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		225
224113235		527	beta-ketoacyl-coa synthase family protei	0.986	0.421	0.602	7e-78
356535919		517	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.991	0.431	0.594	8e-78
224102139		520	beta-ketoacyl-coa synthase family protei	0.991	0.428	0.602	9e-78
118486225		519	unknown [Populus trichocarpa]	0.986	0.427	0.594	4e-77
356500378		521	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.991	0.428	0.590	9e-77
224104071		487	beta-ketoacyl-coa synthase family protei	0.968	0.447	0.604	3e-76
157673576		529	beta-ketoacyl-CoA synthase [Gossypium hi	0.991	0.421	0.590	3e-76
356574783		517	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.991	0.431	0.586	4e-76
356535335		517	PREDICTED: 3-ketoacyl-CoA synthase 11-li	0.995	0.433	0.583	5e-76
388501916		521	unknown [Medicago truncatula]	0.991	0.428	0.581	3e-75

>gi\|224113235\|ref\|XP_002332624.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa] gi\|222832843\|gb\|EEE71320.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 176/244 (72%), Gaps = 22/244 (9%)

Query: 4   SFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTM---------CRRQ 54
           ++Y GNDRSM++ N LFR G AA+LLSNR+ DR RSKY+L  T+RT          C  Q
Sbjct: 284 NWYFGNDRSMLVTNCLFRMGAAAVLLSNRTFDRRRSKYQLIRTVRTHKGADDKSFNCVLQ 343

Query: 55  KLQLCLSTRGRVL-KNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKIN 113
           +  L     G  L K+L+ +AG+ LKT+IT   PLVLP S+QLLF    VA+ IFKMKI 
Sbjct: 344 REDLDTQRVGVSLSKDLMAIAGEALKTNITTLGPLVLPVSEQLLFFVTLVAKKIFKMKIK 403

Query: 114 PYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTSSSSSWYELA 171
           PY+PDFKLAFEHFC+H GG+ VLDE+EK ++L+EWHMEP  MTLYRFGNTSSSS WYELA
Sbjct: 404 PYIPDFKLAFEHFCIHAGGRGVLDELEKNLELTEWHMEPSRMTLYRFGNTSSSSLWYELA 463

Query: 172 YSEAKGRIRKGDRIWQVGFGSGFN----------TIKPEQEKNRWTDEIDDFPVHVPNIA 221
           YSEAKGRI+KGDRIWQ+GFGSGF            I P +EKN W DEIDDFPV VP +A
Sbjct: 464 YSEAKGRIKKGDRIWQIGFGSGFKCNSAVWRAIRAIDPAKEKNPWMDEIDDFPVRVPRVA 523

Query: 222 PINF 225
           P+ +
Sbjct: 524 PLVY 527

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356535919\|ref\|XP_003536489.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

>gi\|224102139\|ref\|XP_002312562.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa] gi\|222852382\|gb\|EEE89929.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118486225\|gb\|ABK94954.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356500378\|ref\|XP_003519009.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

>gi\|224104071\|ref\|XP_002333986.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa] gi\|222839486\|gb\|EEE77823.1\| beta-ketoacyl-coa synthase family protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|157673576\|gb\|ABV60087.1\| beta-ketoacyl-CoA synthase [Gossypium hirsutum]	Back alignment and taxonomy information

>gi\|356574783\|ref\|XP_003555524.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

>gi\|356535335\|ref\|XP_003536202.1\| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Glycine max]	Back alignment and taxonomy information

>gi\|388501916\|gb\|AFK39024.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		225
TAIR\|locus:2170837		529	KCS20 "3-ketoacyl-CoA synthase	0.991	0.421	0.576	4.4e-68
TAIR\|locus:2043849		509	KCS11 "3-ketoacyl-CoA synthase	0.991	0.438	0.557	3.6e-66
TAIR\|locus:2020215		528	KCS2 "3-ketoacyl-CoA synthase	0.991	0.422	0.557	1.8e-64
TAIR\|locus:2200955		528	KCS1 "3-ketoacyl-CoA synthase	0.964	0.410	0.502	6.6e-58
TAIR\|locus:2201262		497	KCS6 "3-ketoacyl-CoA synthase	0.973	0.440	0.493	1.4e-55
TAIR\|locus:2076254		459	KCS14 "3-ketoacyl-CoA synthase	0.96	0.470	0.514	2.3e-55
TAIR\|locus:2062775		466	KCS13 "3-ketoacyl-CoA synthase	0.96	0.463	0.514	3.7e-55
TAIR\|locus:2031260		492	KCS5 "3-ketoacyl-CoA synthase	0.973	0.445	0.485	2.6e-54
TAIR\|locus:2016397		516	KCS4 "3-ketoacyl-CoA synthase	0.937	0.408	0.493	1.9e-53
TAIR\|locus:2042684		512	KCS9 "3-ketoacyl-CoA synthase	0.937	0.412	0.480	6.3e-53

TAIR\|locus:2170837 KCS20 "3-ketoacyl-CoA synthase 20" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 691 (248.3 bits), Expect = 4.4e-68, P = 4.4e-68
 Identities = 144/250 (57%), Positives = 172/250 (68%)

Query:     1 MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTM---------C 51
             + +++Y GNDRSM+L+N +FR G AA+LLSNRSSDR RSKY+L HT+RT          C
Sbjct:   277 ITLNWYLGNDRSMLLSNCIFRMGGAAVLLSNRSSDRSRSKYQLIHTVRTHKGADDNAFGC 336

Query:    52 RRQKLQLCLSTRGRV----LKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTI 107
               Q+        G++     KNL+ +AG+ LKT+IT   PLVLP S+QLLF    VAR +
Sbjct:   337 VYQREDNNAEETGKIGVSLSKNLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKV 396

Query:   108 FKMK-INPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTXXX 164
             FK+K I PY+PDFKLAFEHFC+H GG+AVLDE+EK + LSEWHMEP  MTL RFGNT   
Sbjct:   397 FKVKKIKPYIPDFKLAFEHFCIHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSS 456

Query:   165 XXWYELAYSEAKGRIRKGDRIWQVGFGSGFN----------TIKPEQEK-NRWTDEIDDF 213
               WYELAYSEAKGRI++GDR WQ+ FGSGF           TI P  EK N W DEIDDF
Sbjct:   457 SLWYELAYSEAKGRIKRGDRTWQIAFGSGFKCNSAVWKALRTIDPMDEKTNPWIDEIDDF 516

Query:   214 PVHVPNIAPI 223
             PV VP I PI
Sbjct:   517 PVQVPRITPI 526

GO:0003824 "catalytic activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006633 "fatty acid biosynthetic process" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0008610 "lipid biosynthetic process" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA

GO:0009922 "fatty acid elongase activity" evidence=IDA

GO:0009409 "response to cold" evidence=IEP;RCA

GO:0009416 "response to light stimulus" evidence=IEP

GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA

GO:0042335 "cuticle development" evidence=RCA

TAIR\|locus:2043849 KCS11 "3-ketoacyl-CoA synthase 11" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2020215 KCS2 "3-ketoacyl-CoA synthase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2200955 KCS1 "3-ketoacyl-CoA synthase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201262 KCS6 "3-ketoacyl-CoA synthase 6" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2076254 KCS14 "3-ketoacyl-CoA synthase 14" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2062775 KCS13 "3-ketoacyl-CoA synthase 13" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031260 KCS5 "3-ketoacyl-CoA synthase 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2016397 KCS4 "3-ketoacyl-CoA synthase 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2042684 KCS9 "3-ketoacyl-CoA synthase 9" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	eugene3.00081500	beta-ketoacyl-coa synthase family protein (520 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		225
PLN02192		511	PLN02192, PLN02192, 3-ketoacyl-CoA synthase	1e-103
PLN02854		521	PLN02854, PLN02854, 3-ketoacyl-CoA synthase	1e-91
PLN00415		466	PLN00415, PLN00415, 3-ketoacyl-CoA synthase	3e-77
PLN02377		502	PLN02377, PLN02377, 3-ketoacyl-CoA synthase	1e-76
PLN02932		478	PLN02932, PLN02932, 3-ketoacyl-CoA synthase	1e-71
cd00831		361	cd00831, CHS_like, Chalcone and stilbene synthases	3e-51
pfam08392		290	pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketid	2e-32
cd00830		320	cd00830, KAS_III, Ketoacyl-acyl carrier protein sy	1e-07
pfam08541		90	pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-	3e-07
COG3424		356	COG3424, BcsA, Predicted naringenin-chalcone synth	1e-06
COG0332		323	COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]	6e-06
PRK09352		319	PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protei	2e-05
TIGR00747		318	TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein)	2e-04
PLN03169		391	PLN03169, PLN03169, chalcone synthase family prote	5e-04
pfam02797		151	pfam02797, Chal_sti_synt_C, Chalcone and stilbene	7e-04
PLN03168		389	PLN03168, PLN03168, chalcone synthase; Provisional	0.003
PRK12879		325	PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protei	0.004

>gnl\|CDD\|215123 PLN02192, PLN02192, 3-ketoacyl-CoA synthase	Back alignment and domain information

 Score =  308 bits (790), Expect = e-103
 Identities = 141/244 (57%), Positives = 173/244 (70%), Gaps = 21/244 (8%)

Query: 1   MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRT---------MC 51
           + +++Y GNDRSM+++N LFR G AAILLSN+ SDR RSKY+L HT+RT          C
Sbjct: 268 ITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYQLVHTVRTHKGADDKCFAC 327

Query: 52  RRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMK 111
             Q+          + K+L+ VAG  LKT+IT   PLVLP S+QLLF    V + +FKMK
Sbjct: 328 VTQEEDSAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFKMK 387

Query: 112 INPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTSSSSSWYE 169
           + PY+PDFKLAFEHFC+H GG+AVLDE+EK +QLS+WHMEP  MTLYRFGNTSSSS WYE
Sbjct: 388 LKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNTSSSSLWYE 447

Query: 170 LAYSEAKGRIRKGDRIWQVGFGSGFN----------TIKPEQEKNRWTDEIDDFPVHVPN 219
           LAYSEAKGRI+KGDR WQ+ FGSGF           T+ P +EKN W DEI +FPV VP 
Sbjct: 448 LAYSEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTVNPAKEKNPWMDEIHEFPVDVPK 507

Query: 220 IAPI 223
           ++ I
Sbjct: 508 VSTI 511

Length = 511

>gnl\|CDD\|215459 PLN02854, PLN02854, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|166018 PLN02377, PLN02377, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|178520 PLN02932, PLN02932, 3-ketoacyl-CoA synthase	Back alignment and domain information

>gnl\|CDD\|238427 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs	Back alignment and domain information

>gnl\|CDD\|116972 pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketide synthase-like protein	Back alignment and domain information

>gnl\|CDD\|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems	Back alignment and domain information

>gnl\|CDD\|117118 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal	Back alignment and domain information

>gnl\|CDD\|225958 COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]	Back alignment and domain information

>gnl\|CDD\|236475 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>gnl\|CDD\|233113 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III	Back alignment and domain information

>gnl\|CDD\|215612 PLN03169, PLN03169, chalcone synthase family protein; Provisional	Back alignment and domain information

>gnl\|CDD\|111670 pfam02797, Chal_sti_synt_C, Chalcone and stilbene synthases, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|178712 PLN03168, PLN03168, chalcone synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|237245 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		225
PLN02192		511	3-ketoacyl-CoA synthase	100.0
PLN02932		478	3-ketoacyl-CoA synthase	100.0
PLN02854		521	3-ketoacyl-CoA synthase	100.0
PLN02377		502	3-ketoacyl-CoA synthase	100.0
PLN00415		466	3-ketoacyl-CoA synthase	100.0
COG0332		323	FabH 3-oxoacyl-[acyl-carrier-protein]	99.97
PLN02326		379	3-oxoacyl-[acyl-carrier-protein] synthase III	99.94
CHL00203		326	fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr	99.93
PRK05963		326	3-oxoacyl-(acyl carrier protein) synthase II; Revi	99.93
PRK12880		353	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.93
PRK07204		329	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.93
PLN03172		393	chalcone synthase family protein; Provisional	99.92
cd00830		320	KAS_III Ketoacyl-acyl carrier protein synthase III	99.91
PRK12879		325	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.91
PLN03173		391	chalcone synthase; Provisional	99.9
TIGR00747		318	fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	99.9
PRK06840		339	hypothetical protein; Validated	99.9
PLN03168		389	chalcone synthase; Provisional	99.9
PLN03169		391	chalcone synthase family protein; Provisional	99.9
PRK09258		338	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.9
PLN03170		401	chalcone synthase; Provisional	99.89
cd00831		361	CHS_like Chalcone and stilbene synthases; plant-sp	99.88
PRK09352		319	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.88
PRK07515		372	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.87
PRK06816		378	3-oxoacyl-(acyl carrier protein) synthase III; Rev	99.86
PLN03171		399	chalcone synthase-like protein; Provisional	99.86
COG3424		356	BcsA Predicted naringenin-chalcone synthase [Secon	99.85
PF08541		90	ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC	99.81
TIGR00748		345	HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase	99.8
PRK04262		347	hypothetical protein; Provisional	99.78
cd00827		324	init_cond_enzymes "initiating" condensing enzymes	99.78
TIGR01835		379	HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt	99.66
PF02797		151	Chal_sti_synt_C: Chalcone and stilbene synthases,	99.59
PF08392		290	FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-	99.5
PLN02577		459	hydroxymethylglutaryl-CoA synthase	99.34
cd00327		254	cond_enzymes Condensing enzymes; Family of enzymes	99.34
COG3425		377	PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi	99.32
cd00825		332	decarbox_cond_enzymes decarboxylating condensing e	99.22
TIGR01833		454	HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth	98.83
PRK06025		417	acetyl-CoA acetyltransferase; Provisional	97.99
PRK06690		361	acetyl-CoA acetyltransferase; Provisional	97.51
PF08545		80	ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)	97.31
PRK06147		348	3-oxoacyl-(acyl carrier protein) synthase; Validat	97.06
TIGR02845		327	spore_V_AD stage V sporulation protein AD. Bacillu	96.49
KOG1393		462	consensus Hydroxymethylglutaryl-CoA synthase [Lipi	96.36
PF08540		282	HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A s	96.32
cd00834		406	KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP)	95.27
PRK06501		425	3-oxoacyl-(acyl carrier protein) synthase II; Revi	95.0
cd00828		407	elong_cond_enzymes "elongating" condensing enzymes	94.11
PRK05656		393	acetyl-CoA acetyltransferase; Provisional	93.78
PRK08256		391	lipid-transfer protein; Provisional	93.33
cd00751		386	thiolase Thiolase are ubiquitous enzymes that cata	93.27
PLN02644		394	acetyl-CoA C-acetyltransferase	93.15
smart00825		424	PKS_KS Beta-ketoacyl synthase. The structure of be	93.02
PRK08242		402	acetyl-CoA acetyltransferase; Validated	92.79
PRK06445		394	acetyl-CoA acetyltransferase; Provisional	92.58
TIGR03150		407	fabF beta-ketoacyl-acyl-carrier-protein synthase I	92.26
PRK09051		394	beta-ketothiolase; Provisional	91.97
PRK07801		382	acetyl-CoA acetyltransferase; Provisional	91.97
PRK09052		399	acetyl-CoA acetyltransferase; Provisional	91.88
TIGR01930		386	AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi	91.75
PRK07850		387	acetyl-CoA acetyltransferase; Provisional	91.36
PRK06504		390	acetyl-CoA acetyltransferase; Provisional	90.16
PRK07661		391	acetyl-CoA acetyltransferase; Provisional	90.0
PRK06954		397	acetyl-CoA acetyltransferase; Provisional	89.98
PRK08235		393	acetyl-CoA acetyltransferase; Provisional	89.86
PRK08304		337	stage V sporulation protein AD; Validated	89.56
PRK05790		393	putative acyltransferase; Provisional	89.39
PRK07314		411	3-oxoacyl-(acyl carrier protein) synthase II; Revi	88.98
PRK07851		406	acetyl-CoA acetyltransferase; Provisional	88.9
TIGR02430		400	pcaF beta-ketoadipyl CoA thiolase. Members of this	88.83
PRK05952		381	3-oxoacyl-(acyl carrier protein) synthase II; Revi	88.71
PRK13359		400	beta-ketoadipyl CoA thiolase; Provisional	88.42
cd00829		375	SCP-x_thiolase Thiolase domain associated with ste	88.13
PRK09050		401	beta-ketoadipyl CoA thiolase; Validated	87.74
KOG1390		396	consensus Acetyl-CoA acetyltransferase [Lipid tran	87.63
PRK06333		424	3-oxoacyl-(acyl carrier protein) synthase II; Revi	87.38
PRK09185		392	3-oxoacyl-(acyl carrier protein) synthase I; Revie	87.18
PRK07910		418	3-oxoacyl-(acyl carrier protein) synthase II; Revi	86.81
PRK06633		392	acetyl-CoA acetyltransferase; Provisional	86.58
PRK07103		410	polyketide beta-ketoacyl:acyl carrier protein synt	86.49
PTZ00050		421	3-oxoacyl-acyl carrier protein synthase; Provision	86.41
PRK08257		498	acetyl-CoA acetyltransferase; Validated	85.42
PRK07108		392	acetyl-CoA acetyltransferase; Provisional	85.17
cd00833		421	PKS polyketide synthases (PKSs) polymerize simple	84.96
PRK06289		403	acetyl-CoA acetyltransferase; Provisional	84.88
PRK06064		389	acetyl-CoA acetyltransferase; Provisional	84.27
PRK12578		385	acetyl-CoA acetyltransferase; Provisional	84.18
PRK06205		404	acetyl-CoA acetyltransferase; Provisional	83.62
PRK07516		389	acetyl-CoA acetyltransferase; Provisional	83.47
PLN02287		452	3-ketoacyl-CoA thiolase	83.23
PRK08947		387	fadA 3-ketoacyl-CoA thiolase; Reviewed	82.67
PF00195		226	Chal_sti_synt_N: Chalcone and stilbene synthases,	82.51
PRK08722		414	3-oxoacyl-(acyl carrier protein) synthase II; Revi	82.5
KOG1389		435	consensus 3-oxoacyl CoA thiolase [Lipid transport	82.1
PRK14691		342	3-oxoacyl-(acyl carrier protein) synthase II; Prov	81.63
PLN02787		540	3-oxoacyl-[acyl-carrier-protein] synthase II	81.05
PRK08131		401	acetyl-CoA acetyltransferase; Provisional	80.88
PRK06366		388	acetyl-CoA acetyltransferase; Provisional	80.53

>PLN02192 3-ketoacyl-CoA synthase	Back alignment and domain information

Probab=100.00  E-value=5.6e-43  Score=326.63  Aligned_cols=222  Identities=60%  Similarity=1.021  Sum_probs=189.5

Q ss_pred             CccCcccCCCCCCccceeeeecceeeeEEeccCCCCCCCcccccceEEEEeeec-cccCeeeeec--------Cccchhh
Q 041084            1 MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQ-KLQLCLSTRG--------RVLKNLI   71 (225)
Q Consensus         1 ~s~~~~~~~d~~~~~t~~LFGDGAaAvvL~~~~~~~~~~~~~~~~i~~~~~~sd-~~~~~~~~p~--------g~~~~~~   71 (225)
                      +|++||.++|++++++++||||||||+||++.+.+..+++|++.+.++++.++| +.++++..++        .++|+++
T Consensus       268 ~S~n~y~g~drs~lv~n~LFgDGAaAvLLs~~~~~~~~~k~~L~~~vrt~~~~dd~~~~~v~~~ed~~g~~g~~Lskdl~  347 (511)
T PLN02192        268 ITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKYQLVHTVRTHKGADDKCFACVTQEEDSAGKIGVSLSKDLM  347 (511)
T ss_pred             ccccCCCCCCHHHHhccccccccceEEEEeccccccccccceeeeeEEEEecCChhhccceecccccccceeeEecchhh
Confidence            578999999999999999999999999999865333344666666667888888 8898887763        4678888


Q ss_pred             hhccccccccccccCCcccccccccceeeechhhhhHhhhhccchhhhhhcccEEEEecCCHHHHHHHHHHcCCCc---C
Q 041084           72 VVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSE---W  148 (225)
Q Consensus        72 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~m~g~~v~~~a~~~~~~~~~~dId~~i~Hq~~~~i~~~v~~~lgl~~---e  148 (225)
                      ..+|+.++.++++++|.+.+..+...+.+.|+|+++|+++++.++++++.+||||++||+|+++++.+.+.||+++   |
T Consensus       348 ~vag~al~~ni~~l~p~vlp~~e~~~~~~~m~gr~vfk~~~~~~~p~~~~~Idhf~iHqggr~IId~v~k~LgL~~~~~e  427 (511)
T PLN02192        348 AVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFKMKLKPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHME  427 (511)
T ss_pred             hhhhhhhhhhhhhcccccCccchhhceeEEEcChHHHHHHhhhccHHHHHhhceEeeccCCHHHHHHHHHHcCCCchhhh
Confidence            8888887777888888776665666677899999999999988888999999999999999999999999999997   6


Q ss_pred             cccccccccccccccchHHHHHHHHHHcCCCCCCCEEEEEeEcCCcccc-------CCCC---cCCCcchhcccCCCCCC
Q 041084          149 HMEPMTLYRFGNTSSSSSWYELAYSEAKGRIRKGDRIWQVGFGSGFNTI-------KPEQ---EKNRWTDEIDDFPVHVP  218 (225)
Q Consensus       149 ~~~~~~~~~~GNt~sasip~~L~~~~~~g~l~~Gd~vll~a~G~G~s~~-------~~~~---~~~~~~~~~~~~~~~~~  218 (225)
                      +. ..++++||||||+|+|++|+++.++|++++||+|+++|||+||+|-       +++.   ++|||.||||+||++.|
T Consensus       428 ~s-r~tL~rfGNTSSaSI~~aL~~~eakgrik~GDrVl~iaFGsGf~~~sav~~~~~~~~~~~~~~~w~~~i~~yp~~~~  506 (511)
T PLN02192        428 PS-RMTLYRFGNTSSSSLWYELAYSEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALRTVNPAKEKNPWMDEIHEFPVDVP  506 (511)
T ss_pred             HH-HHHHhHcCChHHhHHHHHHHHHHHcCCCCCCCEEEEEEEcchHhhhhhheeeecccCCcccCCCchhhHHhCCCCCC
Confidence            66 3899999999999999999999999999999999999999999933       4433   34999999999999987


Q ss_pred             CCCCC
Q 041084          219 NIAPI  223 (225)
Q Consensus       219 ~~~~~  223 (225)
                      .+..|
T Consensus       507 ~~~~~  511 (511)
T PLN02192        507 KVSTI  511 (511)
T ss_pred             CCCCC
Confidence            76544

>PLN02932 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN02854 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN02377 3-ketoacyl-CoA synthase	Back alignment and domain information

>PLN00415 3-ketoacyl-CoA synthase	Back alignment and domain information

>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein]	Back alignment and domain information

>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III	Back alignment and domain information

>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional	Back alignment and domain information

>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PLN03172 chalcone synthase family protein; Provisional	Back alignment and domain information

>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems	Back alignment and domain information

>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PLN03173 chalcone synthase; Provisional	Back alignment and domain information

>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III	Back alignment and domain information

>PRK06840 hypothetical protein; Validated	Back alignment and domain information

>PLN03168 chalcone synthase; Provisional	Back alignment and domain information

>PLN03169 chalcone synthase family protein; Provisional	Back alignment and domain information

>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PLN03170 chalcone synthase; Provisional	Back alignment and domain information

>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs	Back alignment and domain information

>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed	Back alignment and domain information

>PLN03171 chalcone synthase-like protein; Provisional	Back alignment and domain information

>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2	Back alignment and domain information

>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative	Back alignment and domain information

>PRK04262 hypothetical protein; Provisional	Back alignment and domain information

>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes	Back alignment and domain information

>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade	Back alignment and domain information

>PF02797 Chal_sti_synt_C: Chalcone and stilbene synthases, C-terminal domain; InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2	Back alignment and domain information

>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species	Back alignment and domain information

>PLN02577 hydroxymethylglutaryl-CoA synthase	Back alignment and domain information

>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction	Back alignment and domain information

>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism]	Back alignment and domain information

>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction	Back alignment and domain information

>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade	Back alignment and domain information

>PRK06025 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06690 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways	Back alignment and domain information

>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated	Back alignment and domain information

>TIGR02845 spore_V_AD stage V sporulation protein AD	Back alignment and domain information

>KOG1393 consensus Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism]	Back alignment and domain information

>PF08540 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A synthase C terminal; InterPro: IPR013746 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase	Back alignment and domain information

>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II	Back alignment and domain information

>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases	Back alignment and domain information

>PRK05656 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08256 lipid-transfer protein; Provisional	Back alignment and domain information

>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine	Back alignment and domain information

>PLN02644 acetyl-CoA C-acetyltransferase	Back alignment and domain information

>smart00825 PKS_KS Beta-ketoacyl synthase	Back alignment and domain information

>PRK08242 acetyl-CoA acetyltransferase; Validated	Back alignment and domain information

>PRK06445 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II	Back alignment and domain information

>PRK09051 beta-ketothiolase; Provisional	Back alignment and domain information

>PRK07801 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK09052 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases	Back alignment and domain information

>PRK07850 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06504 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07661 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06954 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08235 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK08304 stage V sporulation protein AD; Validated	Back alignment and domain information

>PRK05790 putative acyltransferase; Provisional	Back alignment and domain information

>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK07851 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>TIGR02430 pcaF beta-ketoadipyl CoA thiolase	Back alignment and domain information

>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK13359 beta-ketoadipyl CoA thiolase; Provisional	Back alignment and domain information

>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism	Back alignment and domain information

>PRK09050 beta-ketoadipyl CoA thiolase; Validated	Back alignment and domain information

>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism]	Back alignment and domain information

>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed	Back alignment and domain information

>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>PRK06633 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated	Back alignment and domain information

>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional	Back alignment and domain information

>PRK08257 acetyl-CoA acetyltransferase; Validated	Back alignment and domain information

>PRK07108 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations	Back alignment and domain information

>PRK06289 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06064 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK12578 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06205 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK07516 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PLN02287 3-ketoacyl-CoA thiolase	Back alignment and domain information

>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed	Back alignment and domain information

>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2	Back alignment and domain information

>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed	Back alignment and domain information

>KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism]	Back alignment and domain information

>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional	Back alignment and domain information

>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II	Back alignment and domain information

>PRK08131 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

>PRK06366 acetyl-CoA acetyltransferase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		225
2h84_A		374	Steely1; thiolase-fold, type III polyketide syntha	1e-40
3oit_A		387	OS07G0271500 protein; type III polyketide synthase	3e-36
3awk_A		402	Chalcone synthase-like polyketide synthase; type I	5e-23
3v7i_A		413	Putative polyketide synthase; type III polyketide	2e-21
3a5r_A		387	Benzalacetone synthase; chalcone synthase, type II	1e-20
1i88_A		389	CHS2, chalcone synthase 2; polyketide synthase, tr	5e-18
1xes_A		413	Dihydropinosylvin synthase; native structure, tran	7e-17
2p0u_A		413	Stilbenecarboxylate synthase 2; polyketide synthas	1e-16
2d3m_A		406	Pentaketide chromone synthase; chalcone synthase,	6e-15
3e1h_A		465	PKSIIINC, putative uncharacterized protein; resorc	2e-14
3euo_A		379	Type III pentaketide synthase; alpha helix, acyltr	7e-14
1u0m_A		382	Putative polyketide synthase; type III polyketide	6e-13
1ee0_A		402	2-pyrone synthase; polyketide synthase, thiolase f	1e-12
1ted_A		393	PKS18; thiolase fold, substrate binding tunnel, tr	2e-09
3led_A		392	3-oxoacyl-acyl carrier protein synthase III; struc	8e-09
3ov2_A		393	Curcumin synthase; type III polyketide synthase, t	2e-08
3h78_A		359	PQS biosynthetic enzyme; PQSD, anthranilic acid, a	3e-07
3s21_A		345	3-oxoacyl-[ACP] synthase III; non-decarboxylative	5e-07
3gwa_A		365	3-oxoacyl-(acyl-carrier-protein) synthase III; str	1e-06
1mzj_A		339	Beta-ketoacylsynthase III; beta-ketosynthase, arom	1e-06
1hnj_A		317	Beta-ketoacyl-acyl carrier protein synthase III; F	3e-06
2ebd_A		309	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	3e-06
4efi_A		354	3-oxoacyl-(acyl-carrier protein) synthase; structu	3e-06
4dfe_A		333	3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci	4e-06
1ub7_A		322	3-oxoacyl-[acyl-carrier protein] synthase; fatty a	4e-06
2x3e_A		331	3-oxoacyl-[acyl-carrier-protein] synthase 3; HED,	4e-06
3il3_A		323	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	5e-06
1zow_A		313	3-oxoacyl-[acyl-carrier-protein] synthase III; FAB	5e-06
1u6e_A		335	3-oxoacyl-[acyl-carrier-protein] synthase III; tra	2e-05
1xpm_A		396	3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s	3e-05
3s3l_A		357	CERJ; acyltransferase, FABH homologue, KS III homo	4e-05
3il6_A		321	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	2e-04
3v4n_A		388	HMG-COA synthase; hydroxymethylglutaryl-COA syntha	4e-04
3tsy_A		979	Fusion protein 4-coumarate--COA ligase 1, resvera	8e-04

>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Length = 374	Back alignment and structure

 Score =  141 bits (358), Expect = 1e-40
 Identities = 28/207 (13%), Positives = 67/207 (32%), Gaps = 43/207 (20%)

Query: 1   MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMC--------- 51
            ++ F   +    ++A+ +F +G AA ++           YE+  ++             
Sbjct: 187 CSLHFSNTDGGDQMVASSIFADGSAAYIIGCNPRIEETPLYEVMCSINRSFPNTENAMVW 246

Query: 52  --RRQKLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFK 109
              ++   L L        ++ +V G  ++  +                    + +   +
Sbjct: 247 DLEKEGWNLGLD------ASIPIVIGSGIEAFVDTL-----------------LDKAKLQ 283

Query: 110 MKINPYVPDFKLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTSSSSSW 167
                   D       F +H GGK++L  +E  + +     +      + +GN SS+S  
Sbjct: 284 TSTAISAKDC-----EFLIHTGGKSILMNIENSLGIDPKQTKNTWDVYHAYGNMSSASVI 338

Query: 168 YELAYSEAKGRIRKGDRIWQVGFGSGF 194
           + + ++              + FG G 
Sbjct: 339 FVMDHARKSK--SLPTYSISLAFGPGL 363

PyMOL of 2h84

>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Length = 387	Back alignment and structure

>3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A Length = 402	Back alignment and structure

>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Length = 413	Back alignment and structure

>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Length = 387	Back alignment and structure

>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A* Length = 389	Back alignment and structure

>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Length = 413	Back alignment and structure

>2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha} Length = 413	Back alignment and structure

>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* Length = 406	Back alignment and structure

>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Length = 465	Back alignment and structure

>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A* Length = 379	Back alignment and structure

>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Length = 382	Back alignment and structure

>1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A Length = 402	Back alignment and structure

>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Length = 393	Back alignment and structure

>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Length = 392	Back alignment and structure

>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Length = 393	Back alignment and structure

>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Length = 359	Back alignment and structure

>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Length = 345	Back alignment and structure

>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Length = 365	Back alignment and structure

>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Length = 339	Back alignment and structure

>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Length = 317	Back alignment and structure

>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Length = 309	Back alignment and structure

>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Length = 354	Back alignment and structure

>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Length = 333	Back alignment and structure

>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Length = 322	Back alignment and structure

>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Length = 331	Back alignment and structure

>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Length = 323	Back alignment and structure

>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Length = 313	Back alignment and structure

>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Length = 335	Back alignment and structure

>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Length = 396	Back alignment and structure

>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Length = 357	Back alignment and structure

>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Length = 321	Back alignment and structure

>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Length = 388	Back alignment and structure

>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		225
3il6_A		321	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	99.97
3gwa_A		365	3-oxoacyl-(acyl-carrier-protein) synthase III; str	99.96
4ewp_A		350	3-oxoacyl-[acyl-carrier-protein] synthase 3; trans	99.96
3il3_A		323	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	99.96
4efi_A		354	3-oxoacyl-(acyl-carrier protein) synthase; structu	99.95
4dfe_A		333	3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci	99.95
3h78_A		359	PQS biosynthetic enzyme; PQSD, anthranilic acid, a	99.95
3led_A		392	3-oxoacyl-acyl carrier protein synthase III; struc	99.93
3e1h_A		465	PKSIIINC, putative uncharacterized protein; resorc	99.93
3s21_A		345	3-oxoacyl-[ACP] synthase III; non-decarboxylative	99.93
3s3l_A		357	CERJ; acyltransferase, FABH homologue, KS III homo	99.92
2x3e_A		331	3-oxoacyl-[acyl-carrier-protein] synthase 3; HED,	99.91
3ov2_A		393	Curcumin synthase; type III polyketide synthase, t	99.91
3oit_A		387	OS07G0271500 protein; type III polyketide synthase	99.91
3euo_A		379	Type III pentaketide synthase; alpha helix, acyltr	99.91
3v7i_A		413	Putative polyketide synthase; type III polyketide	99.89
1mzj_A		339	Beta-ketoacylsynthase III; beta-ketosynthase, arom	99.88
1hnj_A		317	Beta-ketoacyl-acyl carrier protein synthase III; F	99.88
1ted_A		393	PKS18; thiolase fold, substrate binding tunnel, tr	99.88
3awk_A		402	Chalcone synthase-like polyketide synthase; type I	99.87
1i88_A		389	CHS2, chalcone synthase 2; polyketide synthase, tr	99.87
2p0u_A		413	Stilbenecarboxylate synthase 2; polyketide synthas	99.86
3a5r_A		387	Benzalacetone synthase; chalcone synthase, type II	99.86
1ub7_A		322	3-oxoacyl-[acyl-carrier protein] synthase; fatty a	99.86
1ee0_A		402	2-pyrone synthase; polyketide synthase, thiolase f	99.86
2ebd_A		309	3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH,	99.85
1zow_A		313	3-oxoacyl-[acyl-carrier-protein] synthase III; FAB	99.85
1xes_A		413	Dihydropinosylvin synthase; native structure, tran	99.85
3v4n_A		388	HMG-COA synthase; hydroxymethylglutaryl-COA syntha	99.85
2d3m_A		406	Pentaketide chromone synthase; chalcone synthase,	99.84
1u0m_A		382	Putative polyketide synthase; type III polyketide	99.84
3sqz_A		425	Putative hydroxymethylglutaryl-COA synthase; thiol	99.84
2h84_A		374	Steely1; thiolase-fold, type III polyketide syntha	99.84
2v4w_A		460	Hydroxymethylglutaryl-COA synthase, mitochondrial;	99.84
1u6e_A		335	3-oxoacyl-[acyl-carrier-protein] synthase III; tra	99.83
1xpm_A		396	3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s	99.83
3tsy_A		979	Fusion protein 4-coumarate--COA ligase 1, resvera	99.79
2p8u_A		478	Hydroxymethylglutaryl-COA synthase, cytoplasmic; h	99.77
2f82_A		450	HMG-COA synthase; HMGS1, transferase; 2.10A {Brass	99.77
2wya_A		460	Hydroxymethylglutaryl-COA synthase, mitochondrial;	99.77
3lma_A		347	Stage V sporulation protein AD (spovad); NESG, str	98.81
1tqy_A		424	Beta-ketoacyl synthase/acyl transferase; alpha-bet	97.57
1j3n_A		408	3-oxoacyl-(acyl-carrier protein) synthase II; cond	97.47
3ho9_A		427	3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF,	97.3
4e1l_A		395	Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich,	97.24
3kzu_A		428	3-oxoacyl-(acyl-carrier-protein) synthase II; seat	97.14
2gqd_A		437	3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli	96.98
3ss6_A		394	Acetyl-COA acetyltransferase; structural genomics,	96.95
2iwz_A		438	3-oxoacyl-[acyl-carrier-protein] synthase; mitocho	96.38
1e5m_A		416	KAS II, beta ketoacyl acyl carrier protein synthas	96.33
3svk_A		407	Acetyl-COA acetyltransferase; ssgcid, NIH, niaid,	96.26
3o04_A		413	LMO2201 protein, beta-keto-acyl carrier protein sy	96.05
2gp6_A		434	3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol	95.97
2vu1_A		392	Acetyl-COA acetyltransferase; acyltransferase, PHB	95.82
1ox0_A		430	Beta ketoacyl-acyl carrier protein synthase; trans	95.77
3goa_A		387	3-ketoacyl-COA thiolase; metabolism, fatty acid, p	95.63
2ix4_A		431	3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke	95.55
1wl4_A		397	Acetyl-coenzyme A acetyltransferase 2; thiolase fo	95.52
2ib8_A		395	Acetyl-COA acetyltransferase; thiolase fold, potas	95.47
2vba_A		406	3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop	94.79
4dd5_A		396	Acetyl-COA acetyltransferase; structural genomics,	94.65
1tqy_B		415	Actinorhodin polyketide putative beta-ketoacyl SY;	94.46
2wge_A		416	3-oxoacyl-[acyl-carrier-protein] synthase 1; beta	94.41
1wdk_C		390	3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame	94.36
1ulq_A		401	Putative acetyl-COA acetyltransferase; structural	94.08
1afw_A		393	3-ketoacetyl-COA thiolase; fatty acid metabolism;	93.71
2wu9_A		442	3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o	93.05
4ddo_A		451	3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci	92.28
2iik_A		418	3-ketoacyl-COA thiolase, peroxisomal; fatty acid m	92.01
2qo3_A		915	Eryaii erythromycin polyketide synthase modules 3;	91.56
4ewg_A		412	Beta-ketoacyl synthase; ssgcid, structural genomic	89.54
2hg4_A		917	DEBS, 6-deoxyerythronolide B synthase; ketosynthas	89.41
3mqd_A		428	Beta-ketoacyl synthase; ssgcid, ALS collaborative	85.79
4egv_A		520	Acetyl-COA acetyltransferase; NEW SUB-family, thio	81.6

>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A*	Back alignment and structure

Probab=99.97  E-value=7.9e-30  Score=225.93  Aligned_cols=160  Identities=20%  Similarity=0.286  Sum_probs=129.7

Q ss_pred             cccCCCCCCccceeeeecceeeeEEeccCCCCCCCcccccceEEEEeeec-cccCeeeeecCccchhhhhcccccccccc
Q 041084            5 FYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQ-KLQLCLSTRGRVLKNLIVVAGQVLKTHIT   83 (225)
Q Consensus         5 ~~~~~d~~~~~t~~LFGDGAaAvvL~~~~~~~~~~~~~~~~i~~~~~~sd-~~~~~~~~p~g~~~~~~~~~g~~~~~~~~   83 (225)
                      ++.++|++   +.+||||||+|+||++.++         .+++.+.+.+| +.++.+.+|.++++....         . 
T Consensus       146 ~~~~~dr~---~~~lfGDGA~A~vl~~~~~---------~~i~~~~~~s~~~~~~~~~~~~~~~~~~~~---------~-  203 (321)
T 3il6_A          146 MLDWTDRS---TAVLFGDGAAGVLIEAAET---------PHFLNEKLQADGQRWTALTSGYTINESPFY---------Q-  203 (321)
T ss_dssp             GSCTTCTT---TGGGBCCEEEEEEEEEESS---------CCEEEEEEEECGGGGGGEECCCCCCCSTTC---------C-
T ss_pred             cCCccccc---cceeeccccEEEEEEEcCC---------CCEEEEEEEEcCCCCCeEEeCCCCCCCCCC---------c-
Confidence            33456665   6899999999999999864         25778899999 888888887643331100         0 


Q ss_pred             ccCCcccccccccceeeechhhhhHhhhhccchhhh-----hhcccEEEEecCCHHHHHHHHHHcCCCcCcccccccccc
Q 041084           84 AFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDF-----KLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRF  158 (225)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~m~g~~v~~~a~~~~~~~~-----~~dId~~i~Hq~~~~i~~~v~~~lgl~~e~~~~~~~~~~  158 (225)
                          .. .. +  ..+++|+|+++|+++++.+...+     .+|||+|++||+|.++++.++++||++++|+. .++++|
T Consensus       204 ----~~-~~-~--~~~~~~~g~~v~~~~~~~~~~~i~~~l~~~did~~v~Hq~~~~i~~~~~~~lgl~~ek~~-~~l~~~  274 (321)
T 3il6_A          204 ----GH-KQ-A--SKTLQMEGRSIFDFAIKDVSQNILSLVTDETVDYLLLHQANVRIIDKIARKTKISREKFL-TNMDKY  274 (321)
T ss_dssp             ----CC-CC-C--CCSCEECHHHHHHHHHHHHHHHHHTTCCGGGCSEEEECCSCHHHHHHHHHHHTCCGGGBC-CCGGGT
T ss_pred             ----cc-cc-c--ccceeechHHHHHHHHHHHHHHHHHHcCcccCCEEEEcCCCHHHHHHHHHHcCcCHHHhh-hhHhhc
Confidence                00 00 0  13578999999999877643333     57999999999999999999999999999994 799999


Q ss_pred             cccccchHHHHHHHHHHcCCCCCC--CEEEEEeEcCCcc
Q 041084          159 GNTSSSSSWYELAYSEAKGRIRKG--DRIWQVGFGSGFN  195 (225)
Q Consensus       159 GNt~sasip~~L~~~~~~g~l~~G--d~vll~a~G~G~s  195 (225)
                      |||||||+|++|++++++|++++|  |+|+|++||+|++
T Consensus       275 GNt~sasi~~~L~~~~~~g~~~~G~~d~vll~~fG~G~t  313 (321)
T 3il6_A          275 GNTSAASIPILLDEAVENGTLILGSQQRVVLTGFGGGLT  313 (321)
T ss_dssp             CBCGGGHHHHHHHHHHHTTSSCTTSCCEEEEEEEETTTE
T ss_pred             ccHHHHHHHHHHHHHHHhCCCCCCCCCEEEEEEEehhhe
Confidence            999999999999999999999999  9999999999998

PyMOL of 3il6

>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A	Back alignment and structure

>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665}	Back alignment and structure

>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae}	Back alignment and structure

>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans}	Back alignment and structure

>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans}	Back alignment and structure

>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A*	Back alignment and structure

>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris}	Back alignment and structure

>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa}	Back alignment and structure

>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A	Back alignment and structure

>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B*	Back alignment and structure

>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa}	Back alignment and structure

>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A	Back alignment and structure

>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A	Back alignment and structure

>3euo_A Type III pentaketide synthase; alpha helix, acyltransferase, transferase; 1.75A {Neurospora crassa} PDB: 3eut_A* 3euq_A*	Back alignment and structure

>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor}	Back alignment and structure

>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A*	Back alignment and structure

>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A	Back alignment and structure

>3awk_A Chalcone synthase-like polyketide synthase; type III polyketide synthase, transferase; 2.00A {Huperzia serrata} PDB: 3awj_A	Back alignment and structure

>1i88_A CHS2, chalcone synthase 2; polyketide synthase, transferase; 1.45A {Medicago sativa} SCOP: c.95.1.2 c.95.1.2 PDB: 1i89_A 1i86_A 1i8b_A 1bi5_A 1cml_A* 1d6f_A* 1chw_A* 1cgz_A* 1cgk_A* 1bq6_A* 1jwx_A 1d6i_A 1d6h_A* 1u0v_A 1u0w_A* 1z1e_A* 1z1f_A*	Back alignment and structure

>2p0u_A Stilbenecarboxylate synthase 2; polyketide synthase, PKS type transferase; 1.90A {Marchantia polymorpha}	Back alignment and structure

>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A	Back alignment and structure

>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>1ee0_A 2-pyrone synthase; polyketide synthase, thiolase fold, transferase; HET: CAA; 2.05A {Gerbera hybrid cultivar} SCOP: c.95.1.2 c.95.1.2 PDB: 1qlv_A	Back alignment and structure

>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus}	Back alignment and structure

>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A	Back alignment and structure

>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A	Back alignment and structure

>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A*	Back alignment and structure

>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A*	Back alignment and structure

>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2	Back alignment and structure

>3sqz_A Putative hydroxymethylglutaryl-COA synthase; thiolase fold, HMG_COA synthase, transferase; HET: COA; 1.20A {Streptococcus mutans} PDB: 3leh_A	Back alignment and structure

>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum}	Back alignment and structure

>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A	Back alignment and structure

>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A*	Back alignment and structure

>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana}	Back alignment and structure

>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens}	Back alignment and structure

>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A*	Back alignment and structure

>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens}	Back alignment and structure

>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A	Back alignment and structure

>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A	Back alignment and structure

>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile}	Back alignment and structure

>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A	Back alignment and structure

>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus}	Back alignment and structure

>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis}	Back alignment and structure

>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A	Back alignment and structure

>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium}	Back alignment and structure

>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes}	Back alignment and structure

>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ...	Back alignment and structure

>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A	Back alignment and structure

>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium}	Back alignment and structure

>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A	Back alignment and structure

>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A	Back alignment and structure

>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A*	Back alignment and structure

>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ...	Back alignment and structure

>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile}	Back alignment and structure

>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A*	Back alignment and structure

>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C*	Back alignment and structure

>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1	Back alignment and structure

>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A	Back alignment and structure

>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A	Back alignment and structure

>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A*	Back alignment and structure

>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens}	Back alignment and structure

>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea}	Back alignment and structure

>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum}	Back alignment and structure

>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea}	Back alignment and structure

>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A*	Back alignment and structure

>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		225
d1teda_		372	c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacte	2e-17
d1u0ma2		148	c.95.1.2 (A:202-349) Putative polyketide synthase	6e-16
d1ee0a2		160	c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcon	4e-13
d1u6ea2		148	c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa	2e-12
d1mzja2		153	c.95.1.2 (A:184-336) Priming beta-ketosynthase fro	7e-12
d1bi5a2		154	c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (M	5e-11
d1u0ua2		156	c.95.1.2 (A:238-393) Dihydropinosylvin synthase {S	6e-11
d1ub7a2		149	c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (Fa	3e-10
d1hnja2		143	c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa	1e-08

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 372	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 77.6 bits (190), Expect = 2e-17
 Identities = 28/198 (14%), Positives = 59/198 (29%), Gaps = 23/198 (11%)

Query: 1   MAVSFYTGNDRSMVLANGLFREGDAAILLSNRSSDRGRSKYELTHTLRTMCRRQKLQLCL 60
            +V+    +D + V+ + LF +G AA+++            ++             +  +
Sbjct: 184 CSVNAVFADDINDVVIHSLFGDGCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTEDGI 243

Query: 61  STRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDFK 120
                       ++  +     +   P+V                T         + D  
Sbjct: 244 VLGVNHNGITCELSENLPGYIFSGVAPVV----------------TEMLWDNGLQISDID 287

Query: 121 LAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEP--MTLYRFGNTSSSSSWYELAYSEAKGR 178
                + +H GG  ++++  + + +S          L RFGN  S S  + L     +  
Sbjct: 288 ----LWAIHPGGPKIIEQSVRSLGISAELAAQSWDVLARFGNMLSVSLIFVLETMVQQAE 343

Query: 179 IRKG-DRIWQVGFGSGFN 195
             K         FG G  
Sbjct: 344 SAKAISTGVAFAFGPGVT 361

PyMOL of d1teda_

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 148	Back information, alignment and structure

>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Length = 160	Back information, alignment and structure

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148	Back information, alignment and structure

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Length = 153	Back information, alignment and structure

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 154	Back information, alignment and structure

>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Length = 156	Back information, alignment and structure

>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Length = 149	Back information, alignment and structure

>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Length = 143	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		225
d1hnja2		143	Ketoacyl-ACP synthase III (FabH) {Escherichia coli	99.96
d1mzja2		153	Priming beta-ketosynthase from the r1128 polyketid	99.95
d1ub7a2		149	Ketoacyl-ACP synthase III (FabH) {Thermus thermoph	99.95
d1u6ea2		148	Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu	99.95
d1teda_		372	Polyketide synthase PKS18 {Mycobacterium tuberculo	99.91
d1u0ma2		148	Putative polyketide synthase SCO1206 {Streptomyces	99.83
d1u0ua2		156	Dihydropinosylvin synthase {Scots pine (Pinus sylv	99.81
d1ee0a2		160	Pyrone synthase (PyS, chalcone synthase 2) {Gerber	99.81
d1bi5a2		154	Chalcone synthase {Alfalfa (Medicago sativa) [TaxI	99.8
d1xpma2		221	3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap	98.79
d1tqyb2		194	Actinorhodin polyketide putative beta-ketoacyl syn	88.34
d1m3ka2		124	Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3	87.28
d1tqya2		205	Actinorhodin polyketide putative beta-ketoacyl syn	86.77
d1afwa2		124	Thiolase {Baker's yeast (Saccharomyces cerevisiae)	81.46

>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Ketoacyl-ACP synthase III (FabH)
species: Escherichia coli [TaxId: 562]

Probab=99.96  E-value=5.3e-29  Score=195.55  Aligned_cols=124  Identities=21%  Similarity=0.254  Sum_probs=108.0

Q ss_pred             EEEEeeec-cccCeeeeecCccchhhhhccccccccccccCCcccccccccceeeechhhhhHhhhhccchhhh------
Q 041084           47 LRTMCRRQ-KLQLCLSTRGRVLKNLIVVAGQVLKTHITAFEPLVLPASKQLLFLENSVARTIFKMKINPYVPDF------  119 (225)
Q Consensus        47 ~~~~~~sd-~~~~~~~~p~g~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~m~g~~v~~~a~~~~~~~~------  119 (225)
                      ++++++|| +.++.+.+|.++++++                        ....+++|+|++||+++++.++..+      
T Consensus         1 lst~l~sdG~~~~~l~~p~g~~~~p------------------------~~~~~~~m~G~~vf~~av~~~~~~i~~~L~~   56 (143)
T d1hnja2           1 ISTHLHADGSYGELLTLPNADRVNP------------------------ENSIHLTMAGNEVFKVAVTELAHIVDETLAA   56 (143)
T ss_dssp             EEEEEEECGGGGGGEECCCCCSSCT------------------------TSCCSCEECHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCccEEccCCCCCEEEECCCCCCCC------------------------CCCceEEEEChHHhhhhhhhhhHHHHHHHHH
Confidence            46889999 9999999986544311                        0113578999999999998854433      


Q ss_pred             ----hhcccEEEEecCCHHHHHHHHHHcCCCcCcccccccccccccccchHHHHHHHHHHcCCCCCCCEEEEEeEcCCcc
Q 041084          120 ----KLAFEHFCVHVGGKAVLDEMEKKVQLSEWHMEPMTLYRFGNTSSSSSWYELAYSEAKGRIRKGDRIWQVGFGSGFN  195 (225)
Q Consensus       120 ----~~dId~~i~Hq~~~~i~~~v~~~lgl~~e~~~~~~~~~~GNt~sasip~~L~~~~~~g~l~~Gd~vll~a~G~G~s  195 (225)
                          .+|||+|++||+|.++++.++++||++++|+ +.++++||||+|||+|++|++++++|++++||+|+|++||+|++
T Consensus        57 ~g~~~~dId~~i~Hq~~~~~~~~~~~~l~l~~~k~-~~~~~~~GN~~sasip~~L~~~~~~~~~~~Gd~vll~g~G~G~s  135 (143)
T d1hnja2          57 NNLDRSQLDWLVPHQANLRIISATAKKLGMSMDNV-VVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVLLEAFGGGFT  135 (143)
T ss_dssp             TTCCGGGCCEEEECCSCHHHHHHHHHHTTCCGGGB-CCCHHHHCBCGGGHHHHHHHHHHHTTCSCTTCEEEEEEEETTTE
T ss_pred             hhhcccccceEEeccCchHHHHHHHHhCccchhhh-hhhhhhhcccccchHHHHHHHHHHhCCCCCCCEEEEEEEehhhh
Confidence                4799999999999999999999999999999 58999999999999999999999999999999999999999998

PyMOL of d1hnja2

>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}	Back information, alignment and structure

>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]}	Back information, alignment and structure

>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]}	Back information, alignment and structure

>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]}	Back information, alignment and structure

>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure