Citrus Sinensis ID: 041111

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPIDF
cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEEEccccccccccccHHHHccccccccEEEEEEccccccccccEEEEEEEcccccccccccccEEEccccccccccHHHHHcccEEccccHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccccEEEEEEEccHHHHHHHHHHHcccccccccccccccccccccccccccccccc
ccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHcEEEEEEcccccccccHHHHHHHHccccccHHEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccccccccHHHHHHHHHHccccEEEEEccccccccccHEEEHHHHHcccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHccHHHHHHHHcccccHHHHHHHHHHHHHccccccccEEEEEEEccccEEcEEEEEEcccccccccccccHHHHcccccccccEEEccc
MGNMAYVAKAmldkpadkkNMAEARKETESVIIGAIDELLaktgvkprdiGILVVNsslfnpmpslSAMVVNHYKLRgnilsynfggvgcsagLISIDLAKQllqlppnscalvvstenitmnwyagndrsMLLTNCLFRLGGAAILLsnrssdrrrsKYELVHTLrthkggddrsfGRKIFKMkikpyipnfkLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIrkgdrtwqiafgsgfkCNSAVWRALRTinpaheknpwmdeidnfpvhvpkvmpidf
MGNMAYVAkamldkpadkkNMAEARKETESVIIGAIDEllaktgvkprDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAIllsnrssdrrrskyelvhtlrthkggddrsfgRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIafgsgfkcnsAVWRALRTINPaheknpwmdeidnfpvhvpkVMPIDF
MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLsnrssdrrrsKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPIDF
*****************************SVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLS**********YELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHV********
MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKV*PI**
MGNMAYVAKAMLDKPAD**********TESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPIDF
***MAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPIDF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKIFKMKIKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPIDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
Q5XEP9528 3-ketoacyl-CoA synthase 1 yes no 0.990 0.583 0.618 1e-126
Q9MAM3528 3-ketoacyl-CoA synthase 1 no no 0.971 0.571 0.550 1e-109
Q9LN49516 3-ketoacyl-CoA synthase 4 no no 0.961 0.579 0.549 1e-106
Q9SYZ0493 3-ketoacyl-CoA synthase 1 no no 0.967 0.610 0.529 4e-99
Q4V3C9481 3-ketoacyl-CoA synthase 8 no no 0.967 0.625 0.523 6e-99
Q38860506 3-ketoacyl-CoA synthase 1 no no 0.967 0.594 0.519 2e-96
Q9SUY9451 3-ketoacyl-CoA synthase 1 no no 0.932 0.643 0.490 5e-83
Q9FH27464 Probable 3-ketoacyl-CoA s no no 0.971 0.650 0.447 3e-81
Q9C992460 3-ketoacyl-CoA synthase 7 no no 0.903 0.610 0.414 2e-73
O48780509 3-ketoacyl-CoA synthase 1 no no 0.569 0.347 0.713 4e-69
>sp|Q5XEP9|KCS17_ARATH 3-ketoacyl-CoA synthase 17 OS=Arabidopsis thaliana GN=KCS17 PE=2 SV=2 Back     alignment and function desciption
 Score =  451 bits (1159), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/370 (61%), Positives = 266/370 (71%), Gaps = 62/370 (16%)

Query: 1   MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLF 60
           +G   Y  +A+L  P +   M+EARKE E+V+ GAID +L KTGV P+DIGILVVN SLF
Sbjct: 153 LGQKTYFPEALLRVPPNP-CMSEARKEAETVMFGAIDAVLEKTGVNPKDIGILVVNCSLF 211

Query: 61  NPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENI 120
           NP PSLSAM+VN YKLRGN+LSYN GG+GCSAGLISIDLAKQLLQ+ PNS ALVVSTENI
Sbjct: 212 NPTPSLSAMIVNKYKLRGNVLSYNLGGMGCSAGLISIDLAKQLLQVQPNSYALVVSTENI 271

Query: 121 TMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGG-------- 172
           T+NWY GNDRSMLL+NC+FR+GGAA+LLSNRSSDR RSKY+L+HT+RTHKG         
Sbjct: 272 TLNWYLGNDRSMLLSNCIFRMGGAAVLLSNRSSDRCRSKYQLIHTVRTHKGSDDNAFNCV 331

Query: 173 -------DDRSFG-----------------------------------------RKIFKM 184
                  D++  G                                         RK+F +
Sbjct: 332 YQREDNDDNKQIGVSLSKNLMAIAGEALKTNITTLGPLVLPMSEQLLFFATLVARKVFNV 391

Query: 185 K-IKPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLW 243
           K IKPYIP+FKLAFEH CI  GGRAVLDE+EK+L L+EW MEPSRMTL RFGNTSSS LW
Sbjct: 392 KKIKPYIPDFKLAFEHFCIHAGGRAVLDEIEKNLDLSEWHMEPSRMTLNRFGNTSSSSLW 451

Query: 244 YKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEK----NPWMDEIDNF 299
           Y+LAY EAK RI++GDRTWQIAFGSGFKCNSAVWRALRTI+P+ EK    NPW+DEI  F
Sbjct: 452 YELAYSEAKGRIKRGDRTWQIAFGSGFKCNSAVWRALRTIDPSKEKKKKTNPWIDEIHEF 511

Query: 300 PVHVPKVMPI 309
           PV VP+  P+
Sbjct: 512 PVPVPRTSPV 521
Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q9MAM3|KCS1_ARATH 3-ketoacyl-CoA synthase 1 OS=Arabidopsis thaliana GN=KCS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LN49|KCS4_ARATH 3-ketoacyl-CoA synthase 4 OS=Arabidopsis thaliana GN=KCS4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYZ0|KCS16_ARATH 3-ketoacyl-CoA synthase 16 OS=Arabidopsis thaliana GN=KCS16 PE=2 SV=1 Back     alignment and function description
>sp|Q4V3C9|KCS8_ARATH 3-ketoacyl-CoA synthase 8 OS=Arabidopsis thaliana GN=KCS8 PE=2 SV=1 Back     alignment and function description
>sp|Q38860|KCS18_ARATH 3-ketoacyl-CoA synthase 18 OS=Arabidopsis thaliana GN=FAE1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SUY9|KCS15_ARATH 3-ketoacyl-CoA synthase 15 OS=Arabidopsis thaliana GN=KCS15 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH27|KCS20_ARATH Probable 3-ketoacyl-CoA synthase 20 OS=Arabidopsis thaliana GN=KCS20 PE=2 SV=1 Back     alignment and function description
>sp|Q9C992|KCS7_ARATH 3-ketoacyl-CoA synthase 7 OS=Arabidopsis thaliana GN=KCS7 PE=2 SV=1 Back     alignment and function description
>sp|O48780|KCS11_ARATH 3-ketoacyl-CoA synthase 11 OS=Arabidopsis thaliana GN=KCS11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
358346983 521 Beta-ketoacyl-CoA synthase [Medicago tru 0.980 0.585 0.655 1e-130
157673576 529 beta-ketoacyl-CoA synthase [Gossypium hi 0.990 0.582 0.644 1e-128
388501916 521 unknown [Medicago truncatula] 0.980 0.585 0.647 1e-127
297848640 524 hypothetical protein ARALYDRAFT_470398 [ 0.990 0.587 0.629 1e-126
53850553 518 At1g04220 [Arabidopsis thaliana] 0.990 0.594 0.618 1e-124
15219676 528 3-ketoacyl-CoA synthase 17 [Arabidopsis 0.990 0.583 0.618 1e-124
18377979 523 putative beta-ketoacyl-CoA synthase [Ara 0.990 0.588 0.618 1e-124
183238687 498 beta-ketoacyl-CoA synthase [Helianthus a 0.996 0.622 0.649 1e-123
358345936 565 Beta-ketoacyl-CoA synthase [Medicago tru 0.980 0.539 0.584 1e-123
357139949 519 PREDICTED: 3-ketoacyl-CoA synthase 11-li 0.980 0.587 0.616 1e-121
>gi|358346983|ref|XP_003637542.1| Beta-ketoacyl-CoA synthase [Medicago truncatula] gi|355503477|gb|AES84680.1| Beta-ketoacyl-CoA synthase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/360 (65%), Positives = 266/360 (73%), Gaps = 55/360 (15%)

Query: 1   MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLF 60
           +G   Y+  A++  P +   MAEARKE E V+ GAIDE+L KTGVK +DIGILVVN SLF
Sbjct: 157 LGQKTYLPPAIMRVPPNP-CMAEARKEAEEVMFGAIDEVLQKTGVKAKDIGILVVNCSLF 215

Query: 61  NPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENI 120
           NP PSLSAM+VNHYKLRGNILSYN GG+GCSAGLISIDLAKQLLQ+ PNS ALVVS ENI
Sbjct: 216 NPTPSLSAMIVNHYKLRGNILSYNLGGMGCSAGLISIDLAKQLLQVHPNSYALVVSMENI 275

Query: 121 TMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRS---- 176
           T+NWY GNDRSML+ NCLFR+GGAA+LLSN+  DR RSKY+LVHT+RTHKG D++S    
Sbjct: 276 TLNWYFGNDRSMLVPNCLFRMGGAAVLLSNKPRDRLRSKYQLVHTVRTHKGADNKSYGCV 335

Query: 177 ----------------------------------------------FG----RKIFKMKI 186
                                                         FG    RKIFKMKI
Sbjct: 336 FQEEDDTKQVGVSLSKDLMAVAGEALKTNITTLGPLVLPMSEQLLFFGTLVARKIFKMKI 395

Query: 187 KPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKL 246
           KPYIP+FKLAFEH CI  GGRAVLDE+EK+L L++W MEPSRMTL RFGNTSSS LWY+L
Sbjct: 396 KPYIPDFKLAFEHFCIHAGGRAVLDELEKNLDLSDWHMEPSRMTLNRFGNTSSSSLWYEL 455

Query: 247 AYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKV 306
           AY EAK RI+KGDRTWQIAFGSGFKCNSAVW+AL+TINPA EKNPW+DEI  FPVHVPKV
Sbjct: 456 AYTEAKGRIKKGDRTWQIAFGSGFKCNSAVWKALKTINPAKEKNPWIDEIHEFPVHVPKV 515

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|157673576|gb|ABV60087.1| beta-ketoacyl-CoA synthase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|388501916|gb|AFK39024.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297848640|ref|XP_002892201.1| hypothetical protein ARALYDRAFT_470398 [Arabidopsis lyrata subsp. lyrata] gi|297338043|gb|EFH68460.1| hypothetical protein ARALYDRAFT_470398 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|53850553|gb|AAU95453.1| At1g04220 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15219676|ref|NP_171918.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana] gi|114149942|sp|Q5XEP9.2|KCS17_ARATH RecName: Full=3-ketoacyl-CoA synthase 17; Short=KCS-17; AltName: Full=Very long-chain fatty acid condensing enzyme 17; Short=VLCFA condensing enzyme 17 gi|3142289|gb|AAC16740.1| Strong similarity to beta-keto-Coa synthase gb|U37088 from Simmondsia chinensis [Arabidopsis thaliana] gi|332189550|gb|AEE27671.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18377979|gb|AAL67132.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|183238687|gb|ACC60973.1| beta-ketoacyl-CoA synthase [Helianthus annuus] Back     alignment and taxonomy information
>gi|358345936|ref|XP_003637030.1| Beta-ketoacyl-CoA synthase [Medicago truncatula] gi|355502965|gb|AES84168.1| Beta-ketoacyl-CoA synthase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357139949|ref|XP_003571537.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2170837529 KCS20 "3-ketoacyl-CoA synthase 0.569 0.334 0.685 5.2e-119
TAIR|locus:2043849509 KCS11 "3-ketoacyl-CoA synthase 0.569 0.347 0.674 5.2e-119
TAIR|locus:2020215528 KCS2 "3-ketoacyl-CoA synthase 0.565 0.333 0.677 7.7e-116
TAIR|locus:2200955528 KCS1 "3-ketoacyl-CoA synthase 0.565 0.333 0.610 1.4e-103
TAIR|locus:2016397516 KCS4 "3-ketoacyl-CoA synthase 0.565 0.341 0.598 4.2e-98
TAIR|locus:2062775466 KCS13 "3-ketoacyl-CoA synthase 0.565 0.377 0.525 4.8e-95
TAIR|locus:2042684512 KCS9 "3-ketoacyl-CoA synthase 0.565 0.343 0.570 1.3e-94
TAIR|locus:2055782481 KCS8 "3-ketoacyl-CoA synthase 0.565 0.365 0.587 1e-92
TAIR|locus:2139579487 KCS17 "3-ketoacyl-CoA synthase 0.565 0.361 0.564 1.3e-92
TAIR|locus:2201262497 KCS6 "3-ketoacyl-CoA synthase 0.504 0.315 0.592 1.3e-92
TAIR|locus:2170837 KCS20 "3-ketoacyl-CoA synthase 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 634 (228.2 bits), Expect = 5.2e-119, Sum P(2) = 5.2e-119
 Identities = 122/178 (68%), Positives = 143/178 (80%)

Query:     1 MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLF 60
             +G   Y  +A+L  P +   M EARKE E+V+ GAID +L KTGVKP+DIGILVVN SLF
Sbjct:   159 LGQKTYFPEALLRVPPNPC-MEEARKEAETVMFGAIDAVLEKTGVKPKDIGILVVNCSLF 217

Query:    61 NPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENI 120
             NP PSLSAM+VN YKLRGNILSYN GG+GCSAGLISIDLAKQ+LQ+ PNS ALVVSTENI
Sbjct:   218 NPTPSLSAMIVNKYKLRGNILSYNLGGMGCSAGLISIDLAKQMLQVQPNSYALVVSTENI 277

Query:   121 TMNWYAGNDRSMLLTNCLFRLGGAAILLXXXXXXXXXXKYELVHTLRTHKGGDDRSFG 178
             T+NWY GNDRSMLL+NC+FR+GGAA+LL          KY+L+HT+RTHKG DD +FG
Sbjct:   278 TLNWYLGNDRSMLLSNCIFRMGGAAVLLSNRSSDRSRSKYQLIHTVRTHKGADDNAFG 335
GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006633 "fatty acid biosynthetic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008610 "lipid biosynthetic process" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0009922 "fatty acid elongase activity" evidence=IDA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0009416 "response to light stimulus" evidence=IEP
GO:0000038 "very long-chain fatty acid metabolic process" evidence=RCA
GO:0042335 "cuticle development" evidence=RCA
TAIR|locus:2043849 KCS11 "3-ketoacyl-CoA synthase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020215 KCS2 "3-ketoacyl-CoA synthase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200955 KCS1 "3-ketoacyl-CoA synthase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016397 KCS4 "3-ketoacyl-CoA synthase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062775 KCS13 "3-ketoacyl-CoA synthase 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042684 KCS9 "3-ketoacyl-CoA synthase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055782 KCS8 "3-ketoacyl-CoA synthase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139579 KCS17 "3-ketoacyl-CoA synthase 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201262 KCS6 "3-ketoacyl-CoA synthase 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.10.921
3rd Layer2.3.1.1190.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
PLN02854521 PLN02854, PLN02854, 3-ketoacyl-CoA synthase 1e-161
PLN02932478 PLN02932, PLN02932, 3-ketoacyl-CoA synthase 1e-131
cd00831361 cd00831, CHS_like, Chalcone and stilbene synthases 1e-122
pfam08392290 pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketid 1e-113
PLN02192511 PLN02192, PLN02192, 3-ketoacyl-CoA synthase 6e-96
PLN02192511 PLN02192, PLN02192, 3-ketoacyl-CoA synthase 2e-82
PLN02377502 PLN02377, PLN02377, 3-ketoacyl-CoA synthase 4e-79
PLN00415466 PLN00415, PLN00415, 3-ketoacyl-CoA synthase 8e-69
PLN00415466 PLN00415, PLN00415, 3-ketoacyl-CoA synthase 5e-57
PLN02377502 PLN02377, PLN02377, 3-ketoacyl-CoA synthase 4e-56
COG3424356 COG3424, BcsA, Predicted naringenin-chalcone synth 2e-20
COG0332323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 3e-14
cd00830320 cd00830, KAS_III, Ketoacyl-acyl carrier protein sy 1e-13
cd00827324 cd00827, init_cond_enzymes, "initiating" condensin 7e-12
TIGR00747318 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) 3e-09
PLN03169391 PLN03169, PLN03169, chalcone synthase family prote 9e-09
PLN03172393 PLN03172, PLN03172, chalcone synthase family prote 8e-08
pfam02797151 pfam02797, Chal_sti_synt_C, Chalcone and stilbene 9e-08
PLN03171399 PLN03171, PLN03171, chalcone synthase-like protein 5e-07
PLN03170401 PLN03170, PLN03170, chalcone synthase; Provisional 7e-07
PLN03173391 PLN03173, PLN03173, chalcone synthase; Provisional 1e-06
pfam0854190 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier- 3e-05
PLN03168389 PLN03168, PLN03168, chalcone synthase; Provisional 2e-04
PRK12879325 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protei 4e-04
PRK09352319 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protei 7e-04
pfam0854580 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-pr 0.002
>gnl|CDD|215459 PLN02854, PLN02854, 3-ketoacyl-CoA synthase Back     alignment and domain information 
 Score =  459 bits (1182), Expect = e-161
 Identities = 210/360 (58%), Positives = 251/360 (69%), Gaps = 58/360 (16%)

Query: 1   MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLF 60
           +G+  Y+ + +  +P     M EAR E E+V+ GA+D L +KTGVKPRDIGIL+VN SLF
Sbjct: 162 LGDETYLPRGITSRPP-NLCMEEARAEAEAVMFGALDSLFSKTGVKPRDIGILIVNCSLF 220

Query: 61  NPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENI 120
           NP PSLSAM+VNHYKLR +I SYN GG+GCSAGLISIDLA  LL+  PNS A+VVSTENI
Sbjct: 221 NPTPSLSAMIVNHYKLRTDIKSYNLGGMGCSAGLISIDLANDLLKANPNSYAVVVSTENI 280

Query: 121 TMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGG-------- 172
           T+NWY GNDRSMLL NC+FR+GGAA+LLSN++ DR+RSKY+LVHT+RTHKG         
Sbjct: 281 TLNWYFGNDRSMLLCNCIFRMGGAAVLLSNKARDRKRSKYQLVHTVRTHKGADDKNYNCV 340

Query: 173 ----DDR------------------------SFG------------------RKIFKMKI 186
               DD+                        + G                  RK+ K K+
Sbjct: 341 YQREDDKGTIGVSLARELMAVAGDALKTNITTLGPLVLPLSEQFMFFVTLVRRKLLKAKV 400

Query: 187 KPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKL 246
           KPYIP+FKLAFEH CI  GGRAVLDE++K+L+L++W MEPSRMTL+RFGNTSSS LWY+L
Sbjct: 401 KPYIPDFKLAFEHFCIHAGGRAVLDELQKNLQLSDWHMEPSRMTLHRFGNTSSSSLWYEL 460

Query: 247 AYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRALRTINPAHEK--NPWMDEIDNFPVHVP 304
           AY EAK R+  GDR WQIAFGSGFKCNSAVW+ALR I P  E   NPW D ID +PV VP
Sbjct: 461 AYTEAKGRVSAGDRVWQIAFGSGFKCNSAVWKALREI-PTGESTGNPWADSIDRYPVKVP 519

Length = 521
>gnl|CDD|178520 PLN02932, PLN02932, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|238427 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>gnl|CDD|116972 pfam08392, FAE1_CUT1_RppA, FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>gnl|CDD|215123 PLN02192, PLN02192, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|215123 PLN02192, PLN02192, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|166018 PLN02377, PLN02377, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|177808 PLN00415, PLN00415, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|166018 PLN02377, PLN02377, 3-ketoacyl-CoA synthase Back     alignment and domain information
>gnl|CDD|225958 COG3424, BcsA, Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223409 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|238426 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|238423 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|233113 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>gnl|CDD|215612 PLN03169, PLN03169, chalcone synthase family protein; Provisional Back     alignment and domain information
>gnl|CDD|178716 PLN03172, PLN03172, chalcone synthase family protein; Provisional Back     alignment and domain information
>gnl|CDD|111670 pfam02797, Chal_sti_synt_C, Chalcone and stilbene synthases, C-terminal domain Back     alignment and domain information
>gnl|CDD|178715 PLN03171, PLN03171, chalcone synthase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178714 PLN03170, PLN03170, chalcone synthase; Provisional Back     alignment and domain information
>gnl|CDD|178717 PLN03173, PLN03173, chalcone synthase; Provisional Back     alignment and domain information
>gnl|CDD|117118 pfam08541, ACP_syn_III_C, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>gnl|CDD|178712 PLN03168, PLN03168, chalcone synthase; Provisional Back     alignment and domain information
>gnl|CDD|237245 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|236475 PRK09352, PRK09352, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|203976 pfam08545, ACP_syn_III, 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
PLN02192511 3-ketoacyl-CoA synthase 100.0
PLN02854521 3-ketoacyl-CoA synthase 100.0
PLN02932478 3-ketoacyl-CoA synthase 100.0
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 100.0
PLN02377502 3-ketoacyl-CoA synthase 100.0
PLN00415466 3-ketoacyl-CoA synthase 100.0
PLN03168389 chalcone synthase; Provisional 100.0
PLN03172393 chalcone synthase family protein; Provisional 100.0
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PLN03169391 chalcone synthase family protein; Provisional 100.0
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 100.0
PLN03173391 chalcone synthase; Provisional 100.0
PLN03170401 chalcone synthase; Provisional 100.0
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 100.0
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 100.0
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PLN03171399 chalcone synthase-like protein; Provisional 100.0
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 100.0
PRK06840339 hypothetical protein; Validated 100.0
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 100.0
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 100.0
PRK04262347 hypothetical protein; Provisional 100.0
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 100.0
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 100.0
cd00827324 init_cond_enzymes "initiating" condensing enzymes 100.0
TIGR01835379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 100.0
PLN02577459 hydroxymethylglutaryl-CoA synthase 99.97
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 99.97
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.96
TIGR01833454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 99.96
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 99.95
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 99.95
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 99.9
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 99.83
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 99.81
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 99.79
PRK05656393 acetyl-CoA acetyltransferase; Provisional 99.73
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 99.73
PRK08304337 stage V sporulation protein AD; Validated 99.72
PRK09051394 beta-ketothiolase; Provisional 99.7
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.69
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.68
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 99.68
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.67
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.67
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.66
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 99.65
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.65
KOG1393462 consensus Hydroxymethylglutaryl-CoA synthase [Lipi 99.65
PRK05790393 putative acyltransferase; Provisional 99.64
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.63
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.62
PRK08313386 acetyl-CoA acetyltransferase; Provisional 99.62
PRK07661391 acetyl-CoA acetyltransferase; Provisional 99.61
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.61
PRK12404334 stage V sporulation protein AD; Provisional 99.61
PRK06059399 lipid-transfer protein; Provisional 99.61
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 99.6
PLN02287452 3-ketoacyl-CoA thiolase 99.6
PRK06025 417 acetyl-CoA acetyltransferase; Provisional 99.6
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 99.6
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.59
cd00829375 SCP-x_thiolase Thiolase domain associated with ste 99.59
PF02797151 Chal_sti_synt_C: Chalcone and stilbene synthases, 99.57
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 99.56
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.56
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.56
PLN02644394 acetyl-CoA C-acetyltransferase 99.56
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.55
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.54
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.53
PRK07851406 acetyl-CoA acetyltransferase; Provisional 99.53
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 99.52
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.52
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.52
PRK08963 428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.52
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.52
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.52
cd00826393 nondecarbox_cond_enzymes nondecarboxylating conden 99.51
PRK06158384 thiolase; Provisional 99.51
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.51
PRK08439406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.5
PRK08256391 lipid-transfer protein; Provisional 99.5
PRK06065392 acetyl-CoA acetyltransferase; Provisional 99.5
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.5
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 99.5
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.49
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.49
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.48
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.47
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 99.46
PRK06289403 acetyl-CoA acetyltransferase; Provisional 99.46
cd00832399 CLF Chain-length factor (CLF) is a factor required 99.46
TIGR02446 430 FadI fatty oxidation complex, beta subunit FadI. T 99.45
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.45
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.45
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.45
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 99.44
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.42
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 99.42
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.42
PRK06157398 acetyl-CoA acetyltransferase; Validated 99.42
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 99.41
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 99.4
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 99.37
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 99.37
PRK06365 430 acetyl-CoA acetyltransferase; Provisional 99.36
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 99.36
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 99.34
PRK08170 426 acetyl-CoA acetyltransferase; Provisional 99.3
PRK08257498 acetyl-CoA acetyltransferase; Validated 99.27
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.25
PRK06066385 acetyl-CoA acetyltransferase; Provisional 99.2
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 99.19
KOG1390396 consensus Acetyl-CoA acetyltransferase [Lipid tran 99.13
PF07451329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 99.11
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 99.09
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.07
PRK09268 427 acetyl-CoA acetyltransferase; Provisional 99.01
PRK07937352 lipid-transfer protein; Provisional 98.98
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 98.95
KOG1389435 consensus 3-oxoacyl CoA thiolase [Lipid transport 98.81
KOG1394440 consensus 3-oxoacyl-(acyl-carrier-protein) synthas 98.73
PRK07855386 lipid-transfer protein; Provisional 98.64
COG3321 1061 Polyketide synthase modules and related proteins [ 98.61
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.49
KOG1406408 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44 98.24
KOG1391396 consensus Acetyl-CoA acetyltransferase [Lipid tran 98.24
KOG1392 465 consensus Acetyl-CoA acetyltransferase [Lipid tran 97.59
PF08540282 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A s 96.86
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.85
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 96.37
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 95.44
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 95.19
PRK08170426 acetyl-CoA acetyltransferase; Provisional 94.29
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 94.27
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 94.11
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.84
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 93.57
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 93.52
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 93.22
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 93.11
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 92.94
PRK04262347 hypothetical protein; Provisional 92.84
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 92.31
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 92.2
PRK06840339 hypothetical protein; Validated 92.03
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 91.99
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 91.57
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 90.85
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 90.76
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 90.75
PRK06025417 acetyl-CoA acetyltransferase; Provisional 90.73
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 90.39
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 89.64
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 88.57
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 88.49
PRK09268427 acetyl-CoA acetyltransferase; Provisional 87.9
COG1214220 Inactive homolog of metal-dependent proteases, put 86.09
PRK08257498 acetyl-CoA acetyltransferase; Validated 85.79
TIGR01835379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 85.46
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 83.98
PLN03169391 chalcone synthase family protein; Provisional 83.71
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 83.5
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 82.67
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 82.08
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 82.01
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 81.54
PRK06690361 acetyl-CoA acetyltransferase; Provisional 80.89
cd00827324 init_cond_enzymes "initiating" condensing enzymes 80.79
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 80.06
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information 
Probab=100.00  E-value=1e-54  Score=422.27  Aligned_cols=308  Identities=77%  Similarity=1.285  Sum_probs=269.1

Q ss_pred             CCCcccccCcccCCCchhhhHHHHhhcHHHHHHHHHHHHHHHcCCCCCCcCEEEEEecCCCCCCcHHHHHHHHcCCCCCc
Q 041111            1 MGNMAYVAKAMLDKPADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNI   80 (311)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~la~~A~~~aL~~agl~~~dId~ii~~s~~~~~~p~~a~~v~~~lGl~~~~   80 (311)
                      +|.+.|+|+...+.|+. ..+....+...++...|+++||+++|++|+|||.||++|++++..|+++.+|++++|+++++
T Consensus       150 lg~~t~~p~~~~~~~~~-~~~~~~~~Ea~~~~~~Aa~~aL~kaGi~p~DIDiLIv~~S~~~~~PSlaa~I~n~lGlr~~i  228 (511)
T PLN02192        150 LGESTYLPEAVLNVPPN-PCMAEARKEAETVMFGAIDQLLAKTSVKPKDIGILIVNCSLFNPTPSLSAMVINHYKLRGNI  228 (511)
T ss_pred             CCCcccCChhhccCCCC-ccHHHHHHHHHHHHHHHHHHHHHHcCCCHHHCCEEEEECCCCCCCchHHHHHHHHhCCCCCc
Confidence            58899999999999988 68999999999999999999999999999999999999888889999999999999998789


Q ss_pred             ceeeecCCccchHHHHHHHHHHHHhCCCCCeEEEEEeecccccCccCCCccchhhheecccceEEEEEecCCCCCCCCcc
Q 041111           81 LSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSKY  160 (311)
Q Consensus        81 ~~~~i~~~~Cas~~~Al~~A~~~i~ag~~~~vLvv~~e~~s~~~~~~~dr~~~~~~~l~GDGAaA~vLs~~~~~~~~~~~  160 (311)
                      .+|+++++||++++.||.+|.+++++++.+++|||++|.+|.+|+...||.+.++..+|||||+|+||++.+.+...+.|
T Consensus       229 ~afdLsgmGCSggl~aLdlA~~lL~a~~~~~aLVVstE~~S~n~y~g~drs~lv~n~LFgDGAaAvLLs~~~~~~~~~k~  308 (511)
T PLN02192        229 LSYNLGGMGCSAGLISIDLAKHLLQVHPNSYALVISMENITLNWYFGNDRSMLVSNCLFRMGGAAILLSNKRSDRRRSKY  308 (511)
T ss_pred             eEEEcccchhhhHHHHHHHHHHHHHcCCCCeEEEEEEEeccccCCCCCCHHHHhccccccccceEEEEeccccccccccc
Confidence            99999978999999999999999999999999999999999888766788876677999999999999986533323446


Q ss_pred             ceeeeeecccCCCCc-------------------------------------------------ch-----HHHHHHHhh
Q 041111          161 ELVHTLRTHKGGDDR-------------------------------------------------SF-----GRKIFKMKI  186 (311)
Q Consensus       161 ~l~~~~~~~~~~~~~-------------------------------------------------~~-----g~~~~~~a~  186 (311)
                      ++.+..+++.+.++.                                                 .|     |+++|+.++
T Consensus       309 ~L~~~vrt~~~~dd~~~~~v~~~ed~~g~~g~~Lskdl~~vag~al~~ni~~l~p~vlp~~e~~~~~~~m~gr~vfk~~~  388 (511)
T PLN02192        309 QLVHTVRTHKGADDKCFACVTQEEDSAGKIGVSLSKDLMAVAGDALKTNITTLGPLVLPMSEQLLFFATLVGKKLFKMKL  388 (511)
T ss_pred             eeeeeEEEEecCChhhccceecccccccceeeEecchhhhhhhhhhhhhhhhcccccCccchhhceeEEEcChHHHHHHh
Confidence            666543332221100                                                 00     566677666


Q ss_pred             ccchhhHHHhhhhhhccCCChHHHHHHHHHcCCCccccchhHhhHhhcCCcchhhHHHHHHHHHHhCCCCCCCeEEEEee
Q 041111          187 KPYIPNFKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAF  266 (311)
Q Consensus       187 ~~~~~~~~~did~v~~h~~s~~~~~~~~~~lgi~~d~~~~s~~~~~~~Gn~~sas~~~~L~~~~~~g~l~~Gd~vll~~~  266 (311)
                      +.+.+.+..+||+|++||+|+++++.+++.||++++++..++.++++||||+|+|+++.|+++.++|++++||+|++++|
T Consensus       389 ~~~~p~~~~~Idhf~iHqggr~IId~v~k~LgL~~~~~e~sr~tL~rfGNTSSaSI~~aL~~~eakgrik~GDrVl~iaF  468 (511)
T PLN02192        389 KPYIPDFKLAFEHFCIHAGGRAVLDELEKNLQLSDWHMEPSRMTLYRFGNTSSSSLWYELAYSEAKGRIKKGDRTWQIAF  468 (511)
T ss_pred             hhccHHHHHhhceEeeccCCHHHHHHHHHHcCCCchhhhHHHHHHhHcCChHHhHHHHHHHHHHHcCCCCCCCEEEEEEE
Confidence            66677778899999999999999999999999998666666899999999999999999999999999999999999999


Q ss_pred             chhHHHhhheeeEeccCCCCCCCCCcccccccCCCCCCCCCCC
Q 041111          267 GSGFKCNSAVWRALRTINPAHEKNPWMDEIDNFPVHVPKVMPI  309 (311)
Q Consensus       267 G~G~~~~a~llr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  309 (311)
                      |+|++|++++|||.+++++..++|||.|.|+.+|+++|.+..|
T Consensus       469 GsGf~~~sav~~~~~~~~~~~~~~~w~~~i~~yp~~~~~~~~~  511 (511)
T PLN02192        469 GSGFKCNSAVWKALRTVNPAKEKNPWMDEIHEFPVDVPKVSTI  511 (511)
T ss_pred             cchHhhhhhheeeecccCCcccCCCchhhHHhCCCCCCCCCCC
Confidence            9999999999999999977666799999999999999988654

>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>KOG1393 consensus Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PF02797 Chal_sti_synt_C: Chalcone and stilbene synthases, C-terminal domain; InterPro: IPR012328 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1390 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>KOG1389 consensus 3-oxoacyl CoA thiolase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1394 consensus 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1406 consensus Peroxisomal 3-ketoacyl-CoA-thiolase P-44/SCP2 [Lipid transport and metabolism] Back     alignment and domain information
>KOG1391 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1392 consensus Acetyl-CoA acetyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>PF08540 HMG_CoA_synt_C: Hydroxymethylglutaryl-coenzyme A synthase C terminal; InterPro: IPR013746 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
1z1e_A390 Crystal Structure Of Stilbene Synthase From Arachis 7e-10
1cgz_A389 Chalcone Synthase From Alfalfa Complexed With Resve 1e-08
1u0m_A382 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 2e-08
1u0v_A393 An Aldol Switch Discovered In Stilbene Synthases Me 3e-08
1qlv_A402 Pyrone Synthase (Pys) From Gerbera Hybrida Length = 3e-08
1d6i_A388 Chalcone Synthase (H303q Mutant) Length = 388 1e-07
1cml_A389 Chalcone Synthase From Alfalfa Complexed With Malon 1e-07
1chw_A389 Chalcone Synthase From Alfalfa Complexed With Hexan 2e-07
1bi5_A389 Chalcone Synthase From Alfalfa Length = 389 2e-07
1bq6_A388 Chalcone Synthase From Alfalfa With Coenzyme A Leng 2e-07
1i86_A389 Chalcone Synthase, G256a Mutant Length = 389 2e-07
1i88_A389 Chalcone Synthase (G256v) Length = 389 2e-07
1i8b_A389 Chalcone Synthase (g256f) Length = 389 2e-07
1i89_A389 Chalcone Synthase (G256l) Length = 389 2e-07
3ale_A416 A Type Iii Polyketide Synthase That Produces Diaryl 7e-07
1xes_A413 Crystal Structure Of Stilbene Synthase From Pinus S 1e-06
1u0u_A397 An Aldol Switch Discovered In Stilbene Synthases Me 1e-06
1d6h_A387 Chalone Synthase (N336a Mutant Complexed With Coa) 1e-06
3tsy_A979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 1e-06
1jwx_A389 Chalcone Synthase--F215s Mutant Length = 389 2e-06
3oit_A387 Crystal Structure Of Curcuminoid Synthase Cus From 3e-06
3a5s_A387 Benzalacetone Synthase (I207lL208F) Length = 387 4e-04
3fk5_A338 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 4e-04
>pdb|1Z1E|A Chain A, Crystal Structure Of Stilbene Synthase From Arachis Hypogaea Length = 390 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 102/226 (45%), Gaps = 35/226 (15%)
Query: 89  GCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSM--LLTNCLFRLGGAAI 146
           GC AG   + LAK L +   ++  L+V +EN ++ +   ++  M  L+   LF  G AAI
Sbjct: 164 GCFAGGTVLRLAKDLAENNKDARVLIVCSENTSVTFRGPSETDMDSLVGQALFADGAAAI 223
Query: 147 LLXXXXXXXXXXK-YELVHTLR-----THK--GGDDRSFGRKIFKMKIKPYIPNFKL--- 195
           ++            +E+V T +     +H   GG  R  G   +  K  P I +  +   
Sbjct: 224 IIGSDPVPEVENPLFEIVSTDQQLVPNSHGAIGGLLREVGLTFYLNKSVPDIISQNINDA 283
Query: 196 ---AFEHICI----------RTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCL 242
              AF+ + I            GGRA+LD+VE+ + L    M+ +R  L  +GN SS+C+
Sbjct: 284 LSKAFDPLGISDYNSIFWIAHPGGRAILDQVEEKVNLKPEKMKATRDVLSNYGNMSSACV 343
Query: 243 WYKLAYFEAKRRIRKGDRT------WQI--AFGSGFKCNSAVWRAL 280
           ++ +     K+ +  G +T      W +   FG G    + V R++
Sbjct: 344 FFIMDLMR-KKSLEAGLKTTGEGLDWGVLFGFGPGLTIETVVLRSM 388
>pdb|1CGZ|A Chain A, Chalcone Synthase From Alfalfa Complexed With Resveratrol Length = 389 Back     alignment and structure
>pdb|1U0M|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Synthase (Thns) From Streptomyces Coelicolor A3(2): A Bacterial Type Iii Polyketide Synthase (Pks) Provides Insights Into Enzymatic Control Of Reactive Polyketide Intermediates Length = 382 Back     alignment and structure
>pdb|1U0V|A Chain A, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Of Specificity Of Type Iii Polyketide Synthases: 18xchs Structure Length = 393 Back     alignment and structure
>pdb|1QLV|A Chain A, Pyrone Synthase (Pys) From Gerbera Hybrida Length = 402 Back     alignment and structure
>pdb|1D6I|A Chain A, Chalcone Synthase (H303q Mutant) Length = 388 Back     alignment and structure
>pdb|1CML|A Chain A, Chalcone Synthase From Alfalfa Complexed With Malonyl-Coa Length = 389 Back     alignment and structure
>pdb|1CHW|A Chain A, Chalcone Synthase From Alfalfa Complexed With Hexanoyl-Coa Length = 389 Back     alignment and structure
>pdb|1BI5|A Chain A, Chalcone Synthase From Alfalfa Length = 389 Back     alignment and structure
>pdb|1BQ6|A Chain A, Chalcone Synthase From Alfalfa With Coenzyme A Length = 388 Back     alignment and structure
>pdb|1I86|A Chain A, Chalcone Synthase, G256a Mutant Length = 389 Back     alignment and structure
>pdb|1I88|A Chain A, Chalcone Synthase (G256v) Length = 389 Back     alignment and structure
>pdb|1I8B|A Chain A, Chalcone Synthase (g256f) Length = 389 Back     alignment and structure
>pdb|1I89|A Chain A, Chalcone Synthase (G256l) Length = 389 Back     alignment and structure
>pdb|3ALE|A Chain A, A Type Iii Polyketide Synthase That Produces Diarylheptanoid Length = 416 Back     alignment and structure
>pdb|1XES|A Chain A, Crystal Structure Of Stilbene Synthase From Pinus Sylvestris Length = 413 Back     alignment and structure
>pdb|1U0U|A Chain A, An Aldol Switch Discovered In Stilbene Synthases Mediates Cyclization Specificity Of Type Iii Polyketide Synthases: Pine Stilbene Synthase Structure Length = 397 Back     alignment and structure
>pdb|1D6H|A Chain A, Chalone Synthase (N336a Mutant Complexed With Coa) Length = 387 Back     alignment and structure
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure
>pdb|1JWX|A Chain A, Chalcone Synthase--F215s Mutant Length = 389 Back     alignment and structure
>pdb|3OIT|A Chain A, Crystal Structure Of Curcuminoid Synthase Cus From Oryza Sativa Length = 387 Back     alignment and structure
>pdb|3A5S|A Chain A, Benzalacetone Synthase (I207lL208F) Length = 387 Back     alignment and structure
>pdb|3FK5|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Iii, Fabh (Xoo4209) From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 338 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 3e-91
3oit_A387 OS07G0271500 protein; type III polyketide synthase 3e-91
3awk_A402 Chalcone synthase-like polyketide synthase; type I 2e-67
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 2e-66
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 7e-66
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 4e-59
1xes_A413 Dihydropinosylvin synthase; native structure, tran 2e-58
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 1e-56
3v7i_A413 Putative polyketide synthase; type III polyketide 6e-56
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 8e-45
3e1h_A465 PKSIIINC, putative uncharacterized protein; resorc 2e-43
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 7e-40
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 5e-34
1u0m_A382 Putative polyketide synthase; type III polyketide 2e-33
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 2e-31
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 2e-10
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 6e-09
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 8e-09
3sqz_A425 Putative hydroxymethylglutaryl-COA synthase; thiol 4e-08
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 5e-08
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 3e-07
1xpm_A396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 5e-07
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 5e-07
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 1e-06
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 2e-06
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 2e-06
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 3e-06
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 4e-06
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 9e-06
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 2e-05
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 2e-05
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 9e-05
3v4n_A388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 8e-04
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Length = 374 Back     alignment and structure
 Score =  275 bits (705), Expect = 3e-91
 Identities = 47/294 (15%), Positives = 108/294 (36%), Gaps = 30/294 (10%)

Query: 15  PADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHY 74
                   + +K    +   A    L   G    DI  +V  +S    +P ++  +++  
Sbjct: 82  ETITDVNNQFKKVVPDLAQQACLRALKDWGGDKGDITHIVSVTSTGIIIPDVNFKLIDLL 141

Query: 75  KLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLL 134
            L  ++   +   +GC AGL S+  A  L +  P +  LVV TE  ++++   +    ++
Sbjct: 142 GLNKDVERVSLNLMGCLAGLSSLRTAASLAKASPRNRILVVCTEVCSLHFSNTDGGDQMV 201

Query: 135 TNCLFRLGGAAILLSNRSSDRRRSKYELVHTLRTHKGGDDRSFGRKI----FKMKIKPYI 190
            + +F  G AA ++           YE++ ++       + +    +    + + +   I
Sbjct: 202 ASSIFADGSAAYIIGCNPRIEETPLYEVMCSINRSFPNTENAMVWDLEKEGWNLGLDASI 261

Query: 191 P-----NFKLAFE-------------------HICIRTGGRAVLDEVEKHLKLNEWVMEP 226
           P       +   +                      I TGG+++L  +E  L ++    + 
Sbjct: 262 PIVIGSGIEAFVDTLLDKAKLQTSTAISAKDCEFLIHTGGKSILMNIENSLGIDPKQTKN 321

Query: 227 SRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKGDRTWQIAFGSGFKCNSAVWRAL 280
           +    + +GN SS+ + + + +    +       +  +AFG G        + +
Sbjct: 322 TWDVYHAYGNMSSASVIFVMDHARKSK--SLPTYSISLAFGPGLAFEGCFLKNV 373
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Length = 387 Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Length = 387 Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Length = 413 Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Length = 413 Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Length = 465 Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Length = 393 Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Length = 382 Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Length = 393 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Length = 392 Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Length = 309 Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Length = 357 Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Length = 345 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Length = 313 Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Length = 396 Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Length = 365 Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Length = 322 Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Length = 323 Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Length = 333 Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Length = 354 Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Length = 359 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Length = 317 Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Length = 339 Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Length = 321 Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Length = 335 Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 100.0
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 100.0
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 100.0
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 100.0
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 100.0
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 100.0
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 100.0
3oit_A387 OS07G0271500 protein; type III polyketide synthase 100.0
3e1h_A465 PKSIIINC, putative uncharacterized protein; resorc 100.0
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 100.0
3v7i_A413 Putative polyketide synthase; type III polyketide 100.0
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 100.0
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 100.0
3awk_A402 Chalcone synthase-like polyketide synthase; type I 100.0
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 100.0
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 100.0
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 100.0
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 100.0
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 100.0
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 100.0
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 100.0
1u0m_A382 Putative polyketide synthase; type III polyketide 100.0
1xes_A413 Dihydropinosylvin synthase; native structure, tran 100.0
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 100.0
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 100.0
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 100.0
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 100.0
2v4w_A460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 100.0
3v4n_A388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 100.0
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 100.0
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 100.0
3sqz_A425 Putative hydroxymethylglutaryl-COA synthase; thiol 100.0
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 100.0
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 100.0
2f82_A450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 100.0
2p8u_A478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 100.0
1xpm_A396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 100.0
2wya_A460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 100.0
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 99.91
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.85
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 99.85
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 99.84
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 99.81
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 99.81
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.8
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 99.8
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.8
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 99.8
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 99.8
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 99.79
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 99.79
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.79
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 99.78
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 99.77
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 99.77
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.75
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 99.75
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 99.75
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.75
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.75
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 99.74
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 99.74
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 99.73
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.73
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 99.73
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 99.72
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 99.71
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 99.71
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 99.69
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 99.64
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 99.62
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 99.61
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.41
3zen_D3089 Fatty acid synthase; transferase, mycolic acid bio 99.34
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.22
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.75
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.71
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.54
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 94.72
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 94.57
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 94.56
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 94.32
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 94.28
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 93.92
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 93.89
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 93.88
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 93.82
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 93.81
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 93.71
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 93.7
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 93.4
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 93.37
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 93.35
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 93.15
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 92.5
1u0m_A382 Putative polyketide synthase; type III polyketide 92.45
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 89.69
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 89.2
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 88.98
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 88.39
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 87.95
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 87.34
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 86.98
1xpm_A396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 85.91
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 85.88
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 85.07
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 84.0
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 82.75
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 82.38
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 81.81
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 80.85
3sqz_A425 Putative hydroxymethylglutaryl-COA synthase; thiol 80.14
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
Probab=100.00  E-value=5.2e-48  Score=364.01  Aligned_cols=270  Identities=19%  Similarity=0.298  Sum_probs=221.1

Q ss_pred             CCcccccCcccCCCch------------------hhhHHHHhhcHHHHHHHHHHHHHHHcCCCCCCcCEEEEEec-CCCC
Q 041111            2 GNMAYVAKAMLDKPAD------------------KKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSS-LFNP   62 (311)
Q Consensus         2 ~~~~~~~~~~~~~~~~------------------~~~~~~~~e~~~~la~~A~~~aL~~agl~~~dId~ii~~s~-~~~~   62 (311)
                      |.+.|+|++.+++.+.                  +||++..+|+..+|+++|+++||+++|++|+|||+||++|+ +++.
T Consensus        18 g~g~ylP~~~v~n~el~~~~~~~~e~I~~rtGI~~R~~a~~~e~~~~la~~Aa~~aL~~ag~~~~dId~li~~t~t~~~~   97 (350)
T 4ewp_A           18 AVGAYRPANLVPNEDLIGPIDSSDEWIRQRTGIVTRQRATAEETVPVMAVGAAREALERAGLQGSDLDAVIVSTVTFPHA   97 (350)
T ss_dssp             EEEEECCSCEEEHHHHTTTTTCCHHHHHHHHCCSEEECCCSSCCHHHHHHHHHHHHHHHTTCCGGGCSEEEEECSCCSCS
T ss_pred             EEEEEcCCCeEcHHHHHHHhCCCHHHHHhccCceEEEEcCCCCCHHHHHHHHHHHHHHHcCCCHHHCCEEEEEeccCCCC
Confidence            6789999998876542                  25566678999999999999999999999999999999975 6788


Q ss_pred             CCcHHHHHHHHcCCCCCcceeeecCCccchHHHHHHHHHHHHhCCCCCeEEEEEeecccccCccCCCccchhhheecccc
Q 041111           63 MPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLG  142 (311)
Q Consensus        63 ~p~~a~~v~~~lGl~~~~~~~~i~~~~Cas~~~Al~~A~~~i~ag~~~~vLvv~~e~~s~~~~~~~dr~~~~~~~l~GDG  142 (311)
                      .|+.+.+|+++||++ ++++|+++ ++|+|++.||.+|..+|++|+.+++|||++|.+|..+ .+.+|.   +..+||||
T Consensus        98 ~P~~a~~v~~~LGl~-~~~a~di~-~~C~g~~~aL~~A~~~i~~g~~~~~Lvv~~E~~s~~~-d~~~~~---~~~lfgDG  171 (350)
T 4ewp_A           98 TPSAAALVAHEIGAT-PAPAYDVS-AACAGYCYGVAQADALVRSGTARHVLVVGVERLSDVV-DPTDRS---ISFLLGDG  171 (350)
T ss_dssp             SSCHHHHHHHHTTCT-TSCEEEEE-CGGGHHHHHHHHHHHHHHTTSCSEEEEEEEEEGGGGC-CTTCTT---TGGGBCEE
T ss_pred             CCchHHHHHHHhCCC-CceEEEee-cchhhHHHHHHHhhhhhhCCCccceeEeeeeeceecc-cccccc---cccccccc
Confidence            999999999999998 57899999 6999999999999999999999999999999998432 235665   47899999


Q ss_pred             eEEEEEecCCCCCCCC--------ccceeeeeec--c----------cC-------CCCc---ch---HHHHHHHhhccc
Q 041111          143 GAAILLSNRSSDRRRS--------KYELVHTLRT--H----------KG-------GDDR---SF---GRKIFKMKIKPY  189 (311)
Q Consensus       143 AaA~vLs~~~~~~~~~--------~~~l~~~~~~--~----------~~-------~~~~---~~---g~~~~~~a~~~~  189 (311)
                      |+|++|++.+......        .+..+.....  .          .+       .+..   .+   |+++|+.+++. 
T Consensus       172 A~A~vl~~~~~~~~~~~~~~sdg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~v~~~a~~~-  250 (350)
T 4ewp_A          172 AGAVIVAASDEPGISPSVWGSDGERWSTISMTHSQLELRDAVEHARTTGDASAITGAEGMLWPTLRQDGPSVFRWAVWS-  250 (350)
T ss_dssp             EEEEEEEEESSCCBCCCEEEECGGGTTSEEESSCHHHHHHHHHHHHHHSCCTTTTTCSSCSSCCEEECHHHHHHHHHHT-
T ss_pred             hheeeeecccCCCccceeeeecccccceeeecCCccccCcccccccccCCccccccccccccceeEehhHHHHHHHHHh-
Confidence            9999999876532110        0111111000  0          00       0111   11   78888877665 


Q ss_pred             hhhH-----------HHhhhhhhccCCChHHHHHHHHHcCCCccccchhHhhHhhcCCcchhhHHHHHHHHHHhCCCCCC
Q 041111          190 IPNF-----------KLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTLYRFGNTSSSCLWYKLAYFEAKRRIRKG  258 (311)
Q Consensus       190 ~~~~-----------~~did~v~~h~~s~~~~~~~~~~lgi~~d~~~~s~~~~~~~Gn~~sas~~~~L~~~~~~g~l~~G  258 (311)
                      +++.           .+|||+|++||+|.++++.+++.||+|++++.  ..++++||||++||+|++|++++++|++++|
T Consensus       251 ~~~~i~~~L~~~gl~~~did~~v~Hq~~~~i~~~~~~~Lgl~~~~~~--~~~l~~~GNtssasi~~~L~~~~~~g~~~~G  328 (350)
T 4ewp_A          251 MAKVAREALDAAGVEPEDLAAFIPHQANMRIIDEFAKQLKLPESVVV--ARDIADAGNTSAASIPLAMHRLLEENPELSG  328 (350)
T ss_dssp             HHHHHHHHHHHHTCCGGGEEEEEECCSCHHHHHHHHHHTTCCTTSEE--CCTHHHHCBCGGGHHHHHHHHHHHHCGGGTT
T ss_pred             hhHHHHHHHHhhcCChhHhceEEecCCCHHHHHHHHHHcCcChHhEE--ecccccccchHHHHHHHHHHHHHHhCCCCCc
Confidence            3322           47999999999999999999999999999974  4689999999999999999999999999999


Q ss_pred             CeEEEEeechhHHHhhheeeEe
Q 041111          259 DRTWQIAFGSGFKCNSAVWRAL  280 (311)
Q Consensus       259 d~vll~~~G~G~~~~a~llr~~  280 (311)
                      |+|++++||+|++|++++|||+
T Consensus       329 d~vll~~fG~G~t~~~~vlr~P  350 (350)
T 4ewp_A          329 GLALQIGFGAGLVYGAQVVRLP  350 (350)
T ss_dssp             SEEEEEEEETTTEEEEEEEECC
T ss_pred             CEEEEEEEchhhEeEEEEEEeC
Confidence            9999999999999999999985
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>2d3m_A Pentaketide chromone synthase; chalcone synthase, polyketide synthase, transferase; HET: COA; 1.60A {Aloe arborescens} PDB: 2d51_A 2d52_A* Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>3sqz_A Putative hydroxymethylglutaryl-COA synthase; thiolase fold, HMG_COA synthase, transferase; HET: COA; 1.20A {Streptococcus mutans} PDB: 3leh_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1teda_372 c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacte 9e-46
d1u0ma1200 c.95.1.2 (A:2-201) Putative polyketide synthase SC 2e-23
d1bi5a1235 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Med 5e-19
d1ee0a2160 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcon 2e-18
d1u0ua2156 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {S 5e-16
d1bi5a2154 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (M 1e-15
d1u0ma2148 c.95.1.2 (A:202-349) Putative polyketide synthase 2e-13
d1ub7a2149 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (Fa 3e-10
d1u6ea2148 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa 7e-10
d1mzja2153 c.95.1.2 (A:184-336) Priming beta-ketosynthase fro 2e-08
d1hnja2143 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (Fa 9e-08
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 372 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  156 bits (396), Expect = 9e-46
 Identities = 53/293 (18%), Positives = 102/293 (34%), Gaps = 26/293 (8%)

Query: 15  PADKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHY 74
              +  M    +    + +      LA    +  +IG+LV+ +S     P +   +V   
Sbjct: 79  ATIRDRMHLFYEHAVPLAVDVSKRALAGLPYRAAEIGLLVLATSTGFIAPGVDVAIVKEL 138

Query: 75  KLRGNILSYNFGGVGCSAGLISIDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLL 134
            L  +I       +GC+A + ++  A   ++  P   ALVV  E  ++N    +D + ++
Sbjct: 139 GLSPSISRVVVNFMGCAAAMNALGTATNYVRAHPAMKALVVCIELCSVNAVFADDINDVV 198

Query: 135 TNCLFRLGGAAILLSNRSSDRRRSKYELVHT---------------LRTHKGGDDRSFGR 179
            + LF  G AA+++       +    ++V                 L  +  G       
Sbjct: 199 IHSLFGDGCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTEDGIVLGVNHNGITCELSE 258

Query: 180 KIFKMKIK-------PYIPNFKLAFEHI---CIRTGGRAVLDEVEKHLKLNEWVMEPSRM 229
            +               + +  L    I    I  GG  ++++  + L ++  +   S  
Sbjct: 259 NLPGYIFSGVAPVVTEMLWDNGLQISDIDLWAIHPGGPKIIEQSVRSLGISAELAAQSWD 318

Query: 230 TLYRFGNTSSSCLWYKLAYFEAKRRIRKG-DRTWQIAFGSGFKCNSAVWRALR 281
            L RFGN  S  L + L     +    K        AFG G      ++  +R
Sbjct: 319 VLARFGNMLSVSLIFVLETMVQQAESAKAISTGVAFAFGPGVTVEGMLFDIIR 371
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 200 Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 235 Back     information, alignment and structure
>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Length = 160 Back     information, alignment and structure
>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Length = 156 Back     information, alignment and structure
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 154 Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Length = 148 Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Length = 149 Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 148 Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Length = 153 Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Length = 143 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 100.0
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 99.94
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.93
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 99.93
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 99.93
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 99.93
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 99.92
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 99.88
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 99.88
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 99.87
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 99.87
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 99.86
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 99.84
d1ee0a2160 Pyrone synthase (PyS, chalcone synthase 2) {Gerber 99.79
d1u0ua2156 Dihydropinosylvin synthase {Scots pine (Pinus sylv 99.78
d1bi5a2154 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 99.77
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 99.33
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 99.31
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 99.22
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 99.2
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 99.18
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 99.13
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 99.11
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 99.05
d1xpma2221 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 98.76
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 98.64
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 98.62
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 98.56
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 98.5
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 97.62
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 97.08
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 96.95
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 96.75
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 96.54
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 95.95
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 93.48
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 92.35
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 91.69
d1j3na2159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 88.99
d1e5ma2161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 87.79
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 87.76
d1ox0a2158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 85.58
d2gfva2161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 82.54
d2vbaa2151 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 82.06
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 81.48
d1bi5a2154 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 81.35
d1xhoa_112 Chorismate mutase {Clostridium thermocellum [TaxId 80.99
d1u0ua2156 Dihydropinosylvin synthase {Scots pine (Pinus sylv 80.23
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Chalcone synthase-like
domain: Polyketide synthase PKS18
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=5.7e-45  Score=343.88  Aligned_cols=265  Identities=18%  Similarity=0.245  Sum_probs=211.5

Q ss_pred             hhhhHHHHhhcHHHHHHHHHHHHHHHcCCCCCCcCEEEEEecCCCCCCcHHHHHHHHcCCCCCcceeeecCCccchHHHH
Q 041111           17 DKKNMAEARKETESVIIGAIDELLAKTGVKPRDIGILVVNSSLFNPMPSLSAMVVNHYKLRGNILSYNFGGVGCSAGLIS   96 (311)
Q Consensus        17 ~~~~~~~~~e~~~~la~~A~~~aL~~agl~~~dId~ii~~s~~~~~~p~~a~~v~~~lGl~~~~~~~~i~~~~Cas~~~A   96 (311)
                      ..+|++.++|+..+|+++|+++||+++|++|+|||+||++|++++..|+.+.+|+++||+++++..+++.+.||+|++.|
T Consensus        81 ~~~r~~~~~e~~~~la~~Aa~~aL~~ag~~~~dId~lI~~t~t~~~~P~~a~~v~~~LGl~~~~~~~~~~~~gC~g~~~a  160 (372)
T d1teda_          81 IRDRMHLFYEHAVPLAVDVSKRALAGLPYRAAEIGLLVLATSTGFIAPGVDVAIVKELGLSPSISRVVVNFMGCAAAMNA  160 (372)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTCCCCGGGEEEEEEEESSCCCSSCHHHHHHHHHTCCTTCEEEEEESCGGGHHHHH
T ss_pred             HHHHHHHHHhHHHHHHHHHHHHHHHHcCCCHHHCCEEEEeccCCCCCchHHHHHHhhhccCCceeEeeccccCccHHHHH
Confidence            45688888999999999999999999999999999999998888889999999999999997778888875699999999


Q ss_pred             HHHHHHHHhCCCCCeEEEEEeecccccCccCCCccchhhheecccceEEEEEecCCCCCCCCc--cceeeeeecccCC--
Q 041111           97 IDLAKQLLQLPPNSCALVVSTENITMNWYAGNDRSMLLTNCLFRLGGAAILLSNRSSDRRRSK--YELVHTLRTHKGG--  172 (311)
Q Consensus        97 l~~A~~~i~ag~~~~vLvv~~e~~s~~~~~~~dr~~~~~~~l~GDGAaA~vLs~~~~~~~~~~--~~l~~~~~~~~~~--  172 (311)
                      |++|..+|++|+.+++|||++|.++..++...+.....+.++|||||+|+||++.+.......  +.+.+......+.  
T Consensus       161 L~~A~~~l~sg~~~~~LVV~~E~~s~~~~~~d~~~~~~~~~lfGDGAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (372)
T d1teda_         161 LGTATNYVRAHPAMKALVVCIELCSVNAVFADDINDVVIHSLFGDGCAALVIGASQVQEKLEPGKVVVRSSFSQLLDNTE  240 (372)
T ss_dssp             HHHHHHHHHHSTTCEEEEEEEEECGGGCCCCSSHHHHHHHHHBCEEEEEEEEEEECTTSCCCTTCEEEEEEEEEECTTCT
T ss_pred             HHHHHHHHhcCCCccceeeeehhhcccccCCCcchhhhhhhhhcccceeEEeccCCcccccCCceeEEecccccccCCCc
Confidence            999999999999999999999999865543334333445789999999999998776432211  1122211111110  


Q ss_pred             -------CCcch----HHHHH-------HHhhccchhh---HHHhhhhhhccCCChHHHHHHHHHcCCCccccchhHhhH
Q 041111          173 -------DDRSF----GRKIF-------KMKIKPYIPN---FKLAFEHICIRTGGRAVLDEVEKHLKLNEWVMEPSRMTL  231 (311)
Q Consensus       173 -------~~~~~----g~~~~-------~~a~~~~~~~---~~~did~v~~h~~s~~~~~~~~~~lgi~~d~~~~s~~~~  231 (311)
                             .+..+    +++++       ...++.++.+   ..+|||+|++||+|.++++.+++.||++++++..+++++
T Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~L~~~gl~~~did~~i~Hq~~~~i~~~i~~~Lgl~~ek~~~s~~~l  320 (372)
T d1teda_         241 DGIVLGVNHNGITCELSENLPGYIFSGVAPVVTEMLWDNGLQISDIDLWAIHPGGPKIIEQSVRSLGISAELAAQSWDVL  320 (372)
T ss_dssp             TSEEEEEETTEEEEEECTTHHHHHHHHHHHHHHHHHHHTTCCGGGCSCEEECCSCHHHHHHHHHHHTCCGGGGHHHHHHH
T ss_pred             cccccCCCCCcceeechHHHHHHHHHHHHHHHHHHHHhcCCCHHHhhhhhccCccHHHHHHHHHHcCCCHHHhhhhHHHH
Confidence                   00000    22222       2222222222   257999999999999999999999999999997677889


Q ss_pred             hhcCCcchhhHHHHHHHHHHhCCCCCC-CeEEEEeechhHHHhhheeeEec
Q 041111          232 YRFGNTSSSCLWYKLAYFEAKRRIRKG-DRTWQIAFGSGFKCNSAVWRALR  281 (311)
Q Consensus       232 ~~~Gn~~sas~~~~L~~~~~~g~l~~G-d~vll~~~G~G~~~~a~llr~~~  281 (311)
                      ++||||++||+|++|++++++|++.+| |++++++||+|++|+++|||+..
T Consensus       321 ~~~GN~~sasip~~L~~~l~~g~~~~g~d~vll~~fG~G~s~~~~ll~~~~  371 (372)
T d1teda_         321 ARFGNMLSVSLIFVLETMVQQAESAKAISTGVAFAFGPGVTVEGMLFDIIR  371 (372)
T ss_dssp             HHHCBCTHHHHHHHHHHHHHSCSSSSSSEEEEEEEEETTTEEEEEEEEECC
T ss_pred             hccCCcHHHHHHHHHHHHHHhCCCCCCCCEEEEEEEcHHHhHHHHhheeec
Confidence            999999999999999999999988765 89999999999999999999864
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ee0a2 c.95.1.2 (A:236-395) Pyrone synthase (PyS, chalcone synthase 2) {Gerbera hybrid cultivar [TaxId: 18101]} Back     information, alignment and structure
>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Back     information, alignment and structure
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1xhoa_ d.79.1.2 (A:) Chorismate mutase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1u0ua2 c.95.1.2 (A:238-393) Dihydropinosylvin synthase {Scots pine (Pinus sylvestris) [TaxId: 3349]} Back     information, alignment and structure