Citrus Sinensis ID: 041121


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570----
MRKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESAPGPGMTEGRDDADTSEDDMKISL
cccccccccccccccEEEccccccccccccHHHccccccccEEEcccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccHHHHHccccccccEEEccccccccccccEEEccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccHHHHHccccccEEEcccccccccccccccccEEEEcccccEEcccccccccccccEEEcccccccccccHHHHHcccccccccccccEEEEEEEEccccccccccEEEEEEEEEEccccEEcccccccEEEEccccccccccHHHHHccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
cccccHHHcccccccEEEcccccccccccccHHHcccccccEEEcccccccccHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHcHHHHHHccccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccHHHcccccccEEEEccccccccccccccccccHHHHHHcccccEEEcccccccccccHHHccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHHcccccEEEEEEccccccccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccccEEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEcccccccccccccccccccccccccccccccEEEEEc
MRKLLMRSLRLHSLRYLnleennlancSDWFQVIGKLhslktltshscylrplsnissnfvSIDLSfnqlqgsipdssqhMVYLEHLSLMFNELeggipkffgnmlnlsdnKLAIIQNMSSGCLKNSLESLHLEvnhftgpipdlggfssmkrlylsdnllngtinKSIGQIFKLEITCLSQNSLTDLANIqikgklpdlssrfgtsnpgidissnhfegpipplpsnssflnlsknrFSRSISlcsisgsklTYIDLSsnllsgklpdcwwmFDSLVILDlgnnsfsgripdsmGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLksnkfhgktpfQLCQFAFLQVLDLSLnnisgkipkcfnnftamtqerssdptikvyyytfvgppyvhhysfqdkvmptwkgsgreyRSTLGLIKSLelssnklngavpEEIMDLVGLVALnlsrnhltgqnspkigqlksldfldlsrnqlvggipsslsplsVLSVMDLsynnlsgkiptgtqlqsfngsvyagnpelcglplpnkcrdeesapgpgmtegrddadtseddmkisl
MRKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESapgpgmtegrddadtseddmkisl
MrkllmrslrlhslrylnlEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIpplpsnssflnlsknrfsrsislcsisgsKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLqniqtqftqqqfnrrTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIpsslsplsvlsvMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESAPGPGMTEGRDDADTSEDDMKISL
******RSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKL****************************************RFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQ***KIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGL***********************************
*RKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQ**********YYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLP***************************DDMKISL
MRKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRD***************************
MRKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKC***********************D*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKLLMRSLRLHSLRYLNLEENNLANCSDWFQVIGKLHSLKTLTSHSCYLRPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLKNSLESLHLEVNHFTGPIPDLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSSFLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESAPGPGMTEGRDDADTSEDDMKISL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query574 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.890 0.603 0.305 4e-44
O82318 960 Probably inactive leucine no no 0.729 0.436 0.311 4e-38
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.763 0.349 0.305 1e-37
Q9FL28 1173 LRR receptor-like serine/ no no 0.808 0.395 0.304 3e-37
Q8VZG8 1045 Probable LRR receptor-lik no no 0.780 0.428 0.293 3e-37
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.696 0.331 0.322 3e-37
Q9LP24 1120 Probable leucine-rich rep no no 0.853 0.437 0.312 4e-37
Q9LVP0 1102 Probable leucine-rich rep no no 0.848 0.441 0.302 1e-36
Q8L899 1207 Systemin receptor SR160 O N/A no 0.766 0.364 0.303 3e-36
O49318 1124 Probable leucine-rich rep no no 0.890 0.454 0.273 7e-36
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  179 bits (455), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 190/621 (30%), Positives = 281/621 (45%), Gaps = 110/621 (17%)

Query: 34  IGKLHSLKTLTSHSCYL-----RPLSNISSNFVSIDLSFNQLQGSIPDSSQHMVYLEHLS 88
           IG L  L+ L+  S  L       L N+S N V + L+ NQL G +P S  +++ L  +S
Sbjct: 202 IGDLKQLRNLSLASNNLIGEIPSSLGNLS-NLVHLVLTHNQLVGEVPASIGNLIELRVMS 260

Query: 89  LMFNELEGGIPKFFGNMLNLS------DN-------KLAIIQNMS--------------- 120
              N L G IP  F N+  LS      +N        ++I  N+                
Sbjct: 261 FENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPK 320

Query: 121 SGCLKNSLESLHLEVNHFTGPIPDLGGFSSMK--RLYLSDNLLNGTINKSIGQIFKLEIT 178
           S  L  SLES++L+ N FTGPI      SS K   L L  N L+G I +SI ++  LE  
Sbjct: 321 SLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEEL 380

Query: 179 CLSQNSLT----------------DLANIQIKGKLPDLSSRFGTSN-------------- 208
            +S N+ T                DL+   ++G++P    R  T                
Sbjct: 381 DISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQ 440

Query: 209 -----PGIDISSNHFEGPIPPLP---SNSSFLNLSKNRFSRSISLC--SISGSKLTYIDL 258
                  +D++SN F+GPIP +    S+  FL+LS N FS SI  C  + SGS +  ++L
Sbjct: 441 EEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGS-IKELNL 499

Query: 259 SSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQQFNRRTVFIV 318
             N  SG LPD +     LV LD+ +N   G+ P S+  +     +    + N+      
Sbjct: 500 GDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSL--INCKALELVNVESNK------ 551

Query: 319 WELLTTQTFESWEE-----RFVRLKSNKFHGKTPFQLCQFAF--LQVLDLSLNNISGKIP 371
                   F SW E       + L+SNKF+G    +     F  L+++D+S NN SG +P
Sbjct: 552 ----IKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLP 607

Query: 372 KC-FNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDK-VMPTWKGSGREYRSTLGL 429
              F+N+  MT            ++ +    Y H     +K V  +++   R++R+    
Sbjct: 608 PYYFSNWKDMTTLTEEMDQYMTEFWRYADS-YYHEMEMVNKGVDMSFERIRRDFRA---- 662

Query: 430 IKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLV 489
              ++ S NK+NG +PE +  L  L  LNLS N  T      +  L  L+ LD+SRN+L 
Sbjct: 663 ---IDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLS 719

Query: 490 GGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEE 549
           G IP  L+ LS LS M+ S+N L G +P GTQ Q    S +  NP L G  L + CRD  
Sbjct: 720 GQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRD-T 776

Query: 550 SAPGPGMTEGRDDADTSEDDM 570
            A  P  ++  +D   +E++M
Sbjct: 777 GALNP-TSQLPEDLSEAEENM 796




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query574
147855809 1107 hypothetical protein VITISV_029207 [Viti 0.874 0.453 0.417 1e-95
225464712 1021 PREDICTED: receptor-like protein 12-like 0.972 0.546 0.348 7e-91
296084223651 unnamed protein product [Vitis vinifera] 0.846 0.746 0.429 5e-88
359490572 975 PREDICTED: probable LRR receptor-like se 0.949 0.558 0.344 2e-87
147795695 1680 hypothetical protein VITISV_022720 [Viti 0.813 0.277 0.421 4e-87
302143722 750 unnamed protein product [Vitis vinifera] 0.832 0.637 0.416 2e-86
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.878 0.492 0.380 1e-85
359489995 867 PREDICTED: probable LRR receptor-like se 0.851 0.564 0.411 2e-85
302143729641 unnamed protein product [Vitis vinifera] 0.935 0.837 0.393 2e-85
297737340505 unnamed protein product [Vitis vinifera] 0.644 0.732 0.469 7e-85
>gi|147855809|emb|CAN79130.1| hypothetical protein VITISV_029207 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 249/596 (41%), Positives = 330/596 (55%), Gaps = 94/596 (15%)

Query: 63   IDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSG 122
            + LS NQLQG IP S  ++  L+ + L  N L G +P+      N +   L++  N   G
Sbjct: 459  LSLSXNQLQGEIPKSFSNLCNLQEVELDSNNLTGQLPQDLLACANGTLRTLSLSDNRFRG 518

Query: 123  CLKN-----SLESLHLEVNHFTGPIP------------DLGG--------------FSSM 151
             + +      LE L+L+ N   G +P            D+G                S++
Sbjct: 519  LVPHLIGFSFLERLYLDYNQLNGTLPESIGQLAKLTWFDIGSNSLQGVISEAHFFNLSNL 578

Query: 152  KRLYLSDNLLNGTINKSI-----GQIFKLEITCL-----------SQNSLTDL------- 188
             RL LS N L  T N S+      Q+  L++              +Q  LT+L       
Sbjct: 579  YRLDLSYNSL--TFNMSLEWVPPSQLGSLQLASCKLGPRFPSWLQTQKHLTELDLSNSDI 636

Query: 189  --------------------ANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSN 228
                                +N QI+G LP+LSS+FGT  P IDISSN FEG IP LPS 
Sbjct: 637  SDVLPDWFWNLTSNINTLNISNNQIRGVLPNLSSQFGTY-PDIDISSNSFEGSIPQLPST 695

Query: 229  SSFLNLSKNRFSRSISL-CSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSF 287
             + L+LS N+ S SISL C ++ S L Y+DLS+N L+G LP+CW  + SLV+L+L NN F
Sbjct: 696  VTRLDLSNNKLSGSISLLCIVANSYLVYLDLSNNSLTGALPNCWPQWASLVVLNLENNKF 755

Query: 288  SGRIPDSMGFLQNIQT-QFTQQQFNRRTVFIVWELLT-TQTFESW------EERFVRLKS 339
            SG+IP+S+G LQ IQT  F QQQFN R  FI  EL   +     W          + L+S
Sbjct: 756  SGKIPNSLGSLQLIQTLHFAQQQFNWRIAFIFEELYKLSGKIPLWIGGSLPNLTILSLRS 815

Query: 340  NKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVG 399
            N+  G    +LCQ   +Q+LDLS N+ISG IP+C NNFTAMT++ S    +  + Y+F  
Sbjct: 816  NRXSGSICSELCQLKKIQILDLSSNDISGVIPRCLNNFTAMTKKGS---LVVAHNYSFGS 872

Query: 400  PPY-----VHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGL 454
              Y       + S+ D+ +  WKGS  EY++TLGLI+S++LS N L G +P+EI DL+ L
Sbjct: 873  FAYKDPLKFKNESYVDEALIKWKGSEFEYKNTLGLIRSIDLSRNNLLGEIPKEITDLLEL 932

Query: 455  VALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSG 514
            V+LNLSRN+LTG     IGQLKSL+ LDLS+N+L G IP+SLS +S+LSV+DLS NNLSG
Sbjct: 933  VSLNLSRNNLTGLIPTTIGQLKSLEILDLSQNELFGEIPTSLSEISLLSVLDLSNNNLSG 992

Query: 515  KIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESAPGPGMTEGRDDADTSEDDM 570
            KIP GTQLQSFN   Y GNP LCGLPL  KC ++E           D      +DM
Sbjct: 993  KIPKGTQLQSFNSYSYKGNPTLCGLPLLKKCPEDEMKQDSPTRSIEDKIQQDGNDM 1048




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084223|emb|CBI24611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795695|emb|CAN67736.1| hypothetical protein VITISV_022720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143722|emb|CBI22583.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489995|ref|XP_003634011.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143729|emb|CBI22590.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737340|emb|CBI26541.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query574
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.482 0.309 0.295 3.9e-39
TAIR|locus:2096349860 RLP31 "receptor like protein 3 0.848 0.566 0.288 2.6e-38
TAIR|locus:2119535725 RLP48 "receptor like protein 4 0.731 0.579 0.284 3.1e-38
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.536 0.326 0.292 8.9e-38
TAIR|locus:2094603835 RLP37 "receptor like protein 3 0.841 0.578 0.281 2.2e-37
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.862 0.612 0.276 1.5e-36
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.836 0.591 0.278 5.1e-36
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.491 0.322 0.317 1.5e-35
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.487 0.393 0.289 2.1e-35
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.869 0.511 0.284 6e-35
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 278 (102.9 bits), Expect = 3.9e-39, Sum P(2) = 3.9e-39
 Identities = 88/298 (29%), Positives = 138/298 (46%)

Query:   273 MFDSLVILDLGNNSFSGRIPDSMGFLXXXXXXXXXXXXXXXTVFIVWELLTTQTFESWEE 332
             +F+SL  LD+G+N   G++P S+ F                 +F  W L + Q  +    
Sbjct:   564 IFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRIND-MFPFW-LSSLQKLQ---- 617

Query:   333 RFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIP-KCFNNFTAMTQERSSDPTIK 391
               + L+SN FHG  P     F  L+++D+S N+ +G +P + F  ++ M+   + +    
Sbjct:   618 -VLVLRSNAFHG--PINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSN 674

Query:   392 VYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDL 451
             V Y   +G  Y     +QD ++   KG   E    L +  +++ S NK  G +P+ I  L
Sbjct:   675 VNY---LGSGY-----YQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLL 726

Query:   452 VGLVALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIXXXXXXXXXXXXMDLSYNN 511
               L  LNLS N  TG     IG L +L+ LD+S+N+L G I            M+ S+N 
Sbjct:   727 KELHVLNLSNNAFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQ 786

Query:   512 LSGKIPTGTQLQSFNGSVYAGNPELCGLPLPNKCRDEESAPGPGMTEGRDDADTSEDD 569
             L+G +P G Q  +   S + GN  L G  L   CRD  +   P   +  +   T E+D
Sbjct:   787 LTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHT---PASHQQFETPQTEEED 841


GO:0005575 "cellular_component" evidence=ND
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094603 RLP37 "receptor like protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query574
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-15
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  172 bits (437), Expect = 2e-45
 Identities = 177/565 (31%), Positives = 254/565 (44%), Gaps = 113/565 (20%)

Query: 13  SLRYLNLEENNLANCSDWFQVIGKLHSLKTLT-SHSCYLRPLSN---ISSNFVSIDLSFN 68
           SLRYLNL  NN           G + +L+TL  S++     + N     S+   +DL  N
Sbjct: 119 SLRYLNLSNNNFTGSIPR----GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN 174

Query: 69  QLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNMLNLSDNKLAIIQNMSSGCLK--- 125
            L G IP+S  ++  LE L+L  N+L G IP+  G M +L    L    N+S        
Sbjct: 175 VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLG-YNNLSGEIPYEIG 233

Query: 126 --NSLESLHLEVNHFTGPIP-DLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQ 182
              SL  L L  N+ TGPIP  LG   +++ L+L  N L+G I  SI  + KL    LS 
Sbjct: 234 GLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSD 293

Query: 183 NSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIP----PLPSNSSFLNLSKNR 238
           NSL+        G++P+L  +       + + SN+F G IP     LP     L L  N+
Sbjct: 294 NSLS--------GEIPELVIQLQNLEI-LHLFSNNFTGKIPVALTSLP-RLQVLQLWSNK 343

Query: 239 FSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFL 298
           FS  I       + LT +DLS+N L+G++P+      +L  L L +NS  G IP S+G  
Sbjct: 344 FSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGAC 403

Query: 299 QNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQV 358
           +++                               R VRL+ N F G+ P +  +   +  
Sbjct: 404 RSL-------------------------------RRVRLQDNSFSGELPSEFTKLPLVYF 432

Query: 359 LDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKG 418
           LD+S NN+ G+I        +   +  S   + +    F G             +P   G
Sbjct: 433 LDISNNNLQGRI-------NSRKWDMPSLQMLSLARNKFFGG------------LPDSFG 473

Query: 419 SGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQLKSL 478
           S R        +++L+LS N+ +GAVP ++  L  L+ L LS N L+G+   ++   K L
Sbjct: 474 SKR--------LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKL 525

Query: 479 DFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIP--------------------- 517
             LDLS NQL G IP+S S + VLS +DLS N LSG+IP                     
Sbjct: 526 VSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHG 585

Query: 518 ----TGTQLQSFNGSVYAGNPELCG 538
               TG  L + N S  AGN +LCG
Sbjct: 586 SLPSTGAFL-AINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 574
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
PLN03150623 hypothetical protein; Provisional 99.34
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.27
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.01
PLN03150623 hypothetical protein; Provisional 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.94
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.86
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.43
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.42
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.15
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.09
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.03
PRK15386426 type III secretion protein GogB; Provisional 98.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.69
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.45
PRK15386426 type III secretion protein GogB; Provisional 97.43
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.39
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.24
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.12
KOG4341483 consensus F-box protein containing LRR [General fu 96.91
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.39
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.29
KOG4341483 consensus F-box protein containing LRR [General fu 96.17
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.01
KOG4308478 consensus LRR-containing protein [Function unknown 95.16
KOG4308478 consensus LRR-containing protein [Function unknown 94.87
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.55
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.13
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.62
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.5
smart0037026 LRR Leucine-rich repeats, outliers. 91.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.54
smart0037026 LRR Leucine-rich repeats, outliers. 91.54
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.08
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.67
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 87.16
KOG0473 326 consensus Leucine-rich repeat protein [Function un 85.61
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.05
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.8e-53  Score=477.41  Aligned_cols=505  Identities=30%  Similarity=0.429  Sum_probs=427.5

Q ss_pred             hhhhhcCCCCCcEEECCCCCCCC-CCchhhhcCCCCCCcEEEccCCCCCCC--CCcCCcccEEEccCCcCCCCCCccccC
Q 041121            4 LLMRSLRLHSLRYLNLEENNLAN-CSDWFQVIGKLHSLKTLTSHSCYLRPL--SNISSNFVSIDLSFNQLQGSIPDSSQH   80 (574)
Q Consensus         4 l~~~l~~l~~L~~L~Ls~n~i~~-~~~~~~~~~~l~~L~~L~l~~n~l~~~--~~~~~~L~~L~Ls~n~i~~~~~~~~~~   80 (574)
                      ++..|..+++|++|+|++|.++. +|.  ..+..+++|++|++++|++++.  ....++|++|++++|.+++..|..++.
T Consensus        85 ~~~~~~~l~~L~~L~Ls~n~~~~~ip~--~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~  162 (968)
T PLN00113         85 ISSAIFRLPYIQTINLSNNQLSGPIPD--DIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGS  162 (968)
T ss_pred             CChHHhCCCCCCEEECCCCccCCcCCh--HHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhc
Confidence            46778999999999999999985 455  1456999999999999998765  334589999999999999899999999


Q ss_pred             CCCCCEEEccCCcCccCchhhhhccc-----CCCCCcccc-ccccccccccccCcEEEccCCcccccCCC-CCCCCCCCE
Q 041121           81 MVYLEHLSLMFNELEGGIPKFFGNML-----NLSDNKLAI-IQNMSSGCLKNSLESLHLEVNHFTGPIPD-LGGFSSMKR  153 (574)
Q Consensus        81 l~~L~~L~L~~n~l~~~~~~~~~~l~-----~L~~n~l~~-l~~~~~~~l~~~L~~L~L~~n~l~~~~~~-l~~l~~L~~  153 (574)
                      +++|++|++++|.+.+..|..+.++.     +|++|.+++ +|. .+..+++ |++|++++|++.+..+. +.++++|++
T Consensus       163 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~-L~~L~L~~n~l~~~~p~~l~~l~~L~~  240 (968)
T PLN00113        163 FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPR-ELGQMKS-LKWIYLGYNNLSGEIPYEIGGLTSLNH  240 (968)
T ss_pred             CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCCh-HHcCcCC-ccEEECcCCccCCcCChhHhcCCCCCE
Confidence            99999999999999989999888775     778888887 676 8999998 99999999999987777 999999999


Q ss_pred             EEccCcccccccchhhhccCCCCEEEccCCCCCcccCccccccCCchhhcCCCCCCeEeccCCcccCCCCCC---CCCCc
Q 041121          154 LYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPL---PSNSS  230 (574)
Q Consensus       154 L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~N~l~~l~~~~~~~~lp~~~~~~~~~L~~L~l~~n~l~~~~~~~---~~~L~  230 (574)
                      |++++|.+.+..|..|.++++|++|++++|.++        +.+|.. +..+++|+.|++++|.+.+.+|..   +++|+
T Consensus       241 L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~--------~~~p~~-l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~  311 (968)
T PLN00113        241 LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLS--------GPIPPS-IFSLQKLISLDLSDNSLSGEIPELVIQLQNLE  311 (968)
T ss_pred             EECcCceeccccChhHhCCCCCCEEECcCCeee--------ccCchh-HhhccCcCEEECcCCeeccCCChhHcCCCCCc
Confidence            999999999899999999999999999998765        244544 567889999999999999887764   67899


Q ss_pred             EEEcCCCcccccccccccCCCCccEEECCCCCCCCCCCcchhcCCCCcEEEccCcccccCCCcccccccCcccccccc--
Q 041121          231 FLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQFTQQ--  308 (574)
Q Consensus       231 ~L~L~~n~i~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~l~~~~--  308 (574)
                      .|++++|.+.+..+..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++++.++...  
T Consensus       312 ~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~  391 (968)
T PLN00113        312 ILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNS  391 (968)
T ss_pred             EEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCE
Confidence            999999999988888888899999999999999888898899999999999999999988888888777776655322  


Q ss_pred             -------ccccCccceeeeccccccccccccceEEecCceeccCCChhhcCCCCCCEEEccCCcccccCCccccccccCc
Q 041121          309 -------QFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMT  381 (574)
Q Consensus       309 -------~~~~~~~l~~l~~~~~~~~~~~~~~~l~L~~n~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~  381 (574)
                             .+..++++                +.+++++|++.+..|..+..++.|+.|++++|.+++..+..+..+++|+
T Consensus       392 l~~~~p~~~~~~~~L----------------~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~  455 (968)
T PLN00113        392 LEGEIPKSLGACRSL----------------RRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQ  455 (968)
T ss_pred             ecccCCHHHhCCCCC----------------CEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCc
Confidence                   11112222                7788888888888888888888888888888888887777777888888


Q ss_pred             cccCCCCccccccccccCCCccccccccCcccccccCCCcccccccCcccEEEccCCcCCCCCcHhhhhcCCCCEEeCCC
Q 041121          382 QERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSR  461 (574)
Q Consensus       382 ~l~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~  461 (574)
                      .+++++|.+........+...+..+.+.++.+   .+..+..+..+++|+.|++++|.+.+.+|..+..+++|++|+|++
T Consensus       456 ~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l---~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~  532 (968)
T PLN00113        456 MLSLARNKFFGGLPDSFGSKRLENLDLSRNQF---SGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSH  532 (968)
T ss_pred             EEECcCceeeeecCcccccccceEEECcCCcc---CCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCC
Confidence            88888877643222222334455555555433   344556677899999999999999999999999999999999999


Q ss_pred             CcCcccCCccccCCCCCCEEeCCCCcccccCCCCccCCCCCCEEeccCCcCcccCCCcchhcccCcccccCCCCCCCCC
Q 041121          462 NHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLP  540 (574)
Q Consensus       462 N~l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~~l~~~~l~~Np~~c~~~  540 (574)
                      |.+++.+|..|.++++|++|++++|++++.+|..+..+++|+.+++++|++.|.+|...++..+....+.|||.+|+.+
T Consensus       533 N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        533 NQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999888888889999999999855



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query574
3rgx_A768 Structural Insight Into Brassinosteroid Perception 6e-29
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-13
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 125 bits (314), Expect = 6e-29, Method: Compositional matrix adjust. Identities = 145/499 (29%), Positives = 215/499 (43%), Gaps = 84/499 (16%) Query: 68 NQLQGSIP-DSSQHMVYLEHLSLMFNELEGGIPKFFGNM------LNLSDNKLA--IIQN 118 N G +P D+ M L+ L L FNE G +P+ N+ L+LS N + I+ N Sbjct: 328 NNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN 387 Query: 119 MSSGCLKNSLESLHLEVNHFTGPIP-DLGGFSSMKRLYLSDNLLNGTINKSIGQIFKLEI 177 + KN+L+ L+L+ N FTG IP L S + L+LS N L+GTI S+G + KL Sbjct: 388 LCQNP-KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRD 446 Query: 178 TCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIXXXXXXXXXXXXXXX 237 L N L +G++P T I + N G I Sbjct: 447 LKLWLNML--------EGEIPQELMYVKTLETLI-LDFNDLTGEIPSGLSNCT------- 490 Query: 238 XXXXXXXXXXXXXXKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGF 297 L +I LS+N L+G++P ++L IL L NNSFSG IP +G Sbjct: 491 --------------NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGD 536 Query: 298 LXXXXXXXXXXXXXXXTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQ 357 ++W + L +N F+G P + F Q Sbjct: 537 CRS----------------LIW---------------LDLNTNLFNGTIPAAM----FKQ 561 Query: 358 VLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWK 417 ++ N I+GK N M +E + + + ++ S ++ T + Sbjct: 562 SGKIAANFIAGKRYVYIKN-DGMKKECHG--AGNLLEFQGIRSEQLNRLSTRNPCNITSR 618 Query: 418 GSGREYRSTL---GLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQNSPKIGQ 474 G T G + L++S N L+G +P+EI + L LNL N ++G ++G Sbjct: 619 VYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGD 678 Query: 475 LKSLDFLDLSRNQLVGGIXXXXXXXXXXXXMDLSYNNLSGKIPTGTQLQSFNGSVYAGNP 534 L+ L+ LDLS N+L G I +DLS NNLSG IP Q ++F + + NP Sbjct: 679 LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNP 738 Query: 535 ELCGLPLPNKCRDEESAPG 553 LCG PLP +C D +A G Sbjct: 739 GLCGYPLP-RC-DPSNADG 755
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query574
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-99
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-75
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-43
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-41
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-26
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-32
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-28
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-35
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-20
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-20
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-19
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-07
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-07
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  316 bits (811), Expect = 8e-99
 Identities = 152/567 (26%), Positives = 227/567 (40%), Gaps = 91/567 (16%)

Query: 8   SLRLHSLRYLNLEENNLA-NCSDWFQVIGKLHSLKTLTSHSCYL-----RPLSNISSNFV 61
            L L SL+YL+L EN       D+    G   +L  L     +          + S    
Sbjct: 265 PLPLKSLQYLSLAENKFTGEIPDFL--SGACDTLTGLDLSGNHFYGAVPPFFGSCS-LLE 321

Query: 62  SIDLSFNQLQGSIPDSS-QHMVYLEHLSLMFNELEGGIPKFFGNM------LNLSDNKL- 113
           S+ LS N   G +P  +   M  L+ L L FNE  G +P+   N+      L+LS N   
Sbjct: 322 SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 381

Query: 114 -AIIQNMSSGCLKNSLESLHLEVNHFTGPIPD-LGGFSSMKRLYLSDNLLNGTINKSIGQ 171
             I+ N+        L+ L+L+ N FTG IP  L   S +  L+LS N L+GTI  S+G 
Sbjct: 382 GPILPNLCQNPKNT-LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS 440

Query: 172 IFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPGIDISSNHFEGPIPPLPSNSS- 230
           + KL    L  N L         G++P     +  +   + +  N   G IP   SN + 
Sbjct: 441 LSKLRDLKLWLNMLE--------GEIPQ-ELMYVKTLETLILDFNDLTGEIPSGLSNCTN 491

Query: 231 --FLNLSKNRFSRSISLCSISGSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGNNSFS 288
             +++LS NR +  I         L  + LS+N  SG +P       SL+ LDL  N F+
Sbjct: 492 LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN 551

Query: 289 GRIPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPF 348
           G IP +M               N         +   +     +E        +F G    
Sbjct: 552 GTIPAAMFKQSGKI------AANFIAGKRYVYI---KNDGMKKECHGAGNLLEFQGIRSE 602

Query: 349 QLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYYYTFVGPPYVHHYSF 408
           QL + +     +++     G     F+N  +M                            
Sbjct: 603 QLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM--------------------------- 635

Query: 409 QDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNHLTGQN 468
                                   L++S N L+G +P+EI  +  L  LNL  N ++G  
Sbjct: 636 -----------------------FLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI 672

Query: 469 SPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGS 528
             ++G L+ L+ LDLS N+L G IP ++S L++L+ +DLS NNLSG IP   Q ++F  +
Sbjct: 673 PDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPA 732

Query: 529 VYAGNPELCGLPLPNKCRDEESAPGPG 555
            +  NP LCG PLP             
Sbjct: 733 KFLNNPGLCGYPLPRCDPSNADGYAHH 759


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query574
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.97
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.65
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.6
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.22
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.83
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.5
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.1
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-60  Score=524.27  Aligned_cols=542  Identities=28%  Similarity=0.363  Sum_probs=412.6

Q ss_pred             hhcCCCCCcEEECCCCCCCCC-Cc-------------------------hhhhcCCCCCCcEEEccCCCCCCCC--CcCC
Q 041121            7 RSLRLHSLRYLNLEENNLANC-SD-------------------------WFQVIGKLHSLKTLTSHSCYLRPLS--NISS   58 (574)
Q Consensus         7 ~l~~l~~L~~L~Ls~n~i~~~-~~-------------------------~~~~~~~l~~L~~L~l~~n~l~~~~--~~~~   58 (574)
                      .++++++|++|++++|.++.. +.                         ....+.++++|++|++++|.+++..  .-.+
T Consensus       121 ~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~  200 (768)
T 3rgz_A          121 SLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCV  200 (768)
T ss_dssp             GGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCT
T ss_pred             HHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCC
Confidence            666777777777777666544 22                         0001344445555555555444331  2236


Q ss_pred             cccEEEccCCcCCCCCCccccCCCCCCEEEccCCcCccCchhhhhccc-----CCCCCcccc-ccccccccccccCcEEE
Q 041121           59 NFVSIDLSFNQLQGSIPDSSQHMVYLEHLSLMFNELEGGIPKFFGNML-----NLSDNKLAI-IQNMSSGCLKNSLESLH  132 (574)
Q Consensus        59 ~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-----~L~~n~l~~-l~~~~~~~l~~~L~~L~  132 (574)
                      +|++|++++|.+++.+|. +..+++|++|++++|.+++..|..|..+.     ++++|.+++ +|. .  .+++ |++|+
T Consensus       201 ~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~-~--~l~~-L~~L~  275 (768)
T 3rgz_A          201 NLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP-L--PLKS-LQYLS  275 (768)
T ss_dssp             TCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCC-C--CCTT-CCEEE
T ss_pred             cCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCc-c--ccCC-CCEEE
Confidence            888888988888877776 88999999999999999888888888765     777888877 544 2  6777 99999


Q ss_pred             ccCCcccccCCC-CCC-CCCCCEEEccCcccccccchhhhccCCCCEEEccCCCCCcccCccccccCCchhhcCCCCCCe
Q 041121          133 LEVNHFTGPIPD-LGG-FSSMKRLYLSDNLLNGTINKSIGQIFKLEITCLSQNSLTDLANIQIKGKLPDLSSRFGTSNPG  210 (574)
Q Consensus       133 L~~n~l~~~~~~-l~~-l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~N~l~~l~~~~~~~~lp~~~~~~~~~L~~  210 (574)
                      +++|++++..+. +.. +++|++|++++|++++..|..|..+++|++|++++|.++        +.+|...+..+++|++
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~--------~~ip~~~l~~l~~L~~  347 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFS--------GELPMDTLLKMRGLKV  347 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEE--------EECCHHHHTTCTTCCE
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCccc--------CcCCHHHHhcCCCCCE
Confidence            999999877666 555 499999999999999889999999999999999998764        3555544677888888


Q ss_pred             EeccCCcccCCCCCC---C-CCCcEEEcCCCcccccccccccC--CCCccEEECCCCCCCCCCCcchhcCCCCcEEEccC
Q 041121          211 IDISSNHFEGPIPPL---P-SNSSFLNLSKNRFSRSISLCSIS--GSKLTYIDLSSNLLSGKLPDCWWMFDSLVILDLGN  284 (574)
Q Consensus       211 L~l~~n~l~~~~~~~---~-~~L~~L~L~~n~i~~~~~~~~~~--~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~  284 (574)
                      |++++|.+++.+|..   + .+|+.|++++|.+.+..+..+..  +++|++|++++|.+++..|..+..+++|+.|++++
T Consensus       348 L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~  427 (768)
T 3rgz_A          348 LDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSF  427 (768)
T ss_dssp             EECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCS
T ss_pred             EeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcC
Confidence            888888888777765   3 37888888888887766655544  67788888888888877788888888888888888


Q ss_pred             cccccCCCcccccccCcccccccc---------ccccCccceeeec---ccccccccccc-----ceEEecCceeccCCC
Q 041121          285 NSFSGRIPDSMGFLQNIQTQFTQQ---------QFNRRTVFIVWEL---LTTQTFESWEE-----RFVRLKSNKFHGKTP  347 (574)
Q Consensus       285 N~l~~~~~~~~~~l~~L~~l~~~~---------~~~~~~~l~~l~~---~~~~~~~~~~~-----~~l~L~~n~~~~~~~  347 (574)
                      |.+++..|..+..+++|+.++...         .+..++.++.+++   ...+.+|.+..     +.+++++|++.+..|
T Consensus       428 N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p  507 (768)
T 3rgz_A          428 NYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP  507 (768)
T ss_dssp             SEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCC
T ss_pred             CcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCC
Confidence            888888888888888888777332         3455667777777   44455555543     889999999998899


Q ss_pred             hhhcCCCCCCEEEccCCcccccCCccccccccCccccCCCCccc-cccccccCCCcccccccc-----------------
Q 041121          348 FQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIK-VYYYTFVGPPYVHHYSFQ-----------------  409 (574)
Q Consensus       348 ~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~l~l~~~~~~-~~~~~~~~~~~~~~~~~~-----------------  409 (574)
                      ..+..+++|++|++++|++++.+|..+..+++|+.+++++|.+. .++..+..........+.                 
T Consensus       508 ~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  587 (768)
T 3rgz_A          508 KWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC  587 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTC
T ss_pred             hHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccc
Confidence            99999999999999999998888988999999999999888765 222222111111100000                 


Q ss_pred             --------------------------CcccccccCCCcccccccCcccEEEccCCcCCCCCcHhhhhcCCCCEEeCCCCc
Q 041121          410 --------------------------DKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNH  463 (574)
Q Consensus       410 --------------------------~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~  463 (574)
                                                ......+.+..+..+..+++|+.|||++|.+++.+|..|+.+++|++|+|++|+
T Consensus       588 ~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~  667 (768)
T 3rgz_A          588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND  667 (768)
T ss_dssp             CSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCc
Confidence                                      000112334455567788999999999999999999999999999999999999


Q ss_pred             CcccCCccccCCCCCCEEeCCCCcccccCCCCccCCCCCCEEeccCCcCcccCCCcchhcccCcccccCCCCCCCCCCCC
Q 041121          464 LTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPN  543 (574)
Q Consensus       464 l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~~l~~~~l~~Np~~c~~~l~~  543 (574)
                      +++.+|..|+++++|++|||++|++++.+|..+..+++|++|++++|+++|.+|...++.++....+.|||++||.|+. 
T Consensus       668 l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-  746 (768)
T 3rgz_A          668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-  746 (768)
T ss_dssp             CCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-
T ss_pred             cCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999998 


Q ss_pred             CCCCCCCCCCCCCCCCCCC
Q 041121          544 KCRDEESAPGPGMTEGRDD  562 (574)
Q Consensus       544 ~c~~~~~~~~~~~~~~~~~  562 (574)
                      .|..+.+..|+++.+.+..
T Consensus       747 ~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          747 RCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             CCCSCC-------------
T ss_pred             CCCCCccCCCCCCCCcccc
Confidence            8998888888887666543



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 574
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 84.4 bits (207), Expect = 2e-18
 Identities = 61/268 (22%), Positives = 96/268 (35%), Gaps = 11/268 (4%)

Query: 277 LVILDLGNNSFSGR--IPDSMGFLQNIQTQFTQQQFNRRTVFIVWELLTTQTFESWEERF 334
           +  LDL   +      IP S+  L  +   +     N            TQ    +    
Sbjct: 52  VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLY---- 107

Query: 335 VRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAMTQERSSDPTIKVYY 394
             +      G  P  L Q   L  LD S N +SG +P   ++   +         I    
Sbjct: 108 --ITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI---S 162

Query: 395 YTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGL 454
                        F    +   + +G+   +   L  +    S  +       +      
Sbjct: 163 GAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKN 222

Query: 455 VALNLSRNHLTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSG 514
                   +    +  K+G  K+L+ LDL  N++ G +P  L+ L  L  +++S+NNL G
Sbjct: 223 TQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCG 282

Query: 515 KIPTGTQLQSFNGSVYAGNPELCGLPLP 542
           +IP G  LQ F+ S YA N  LCG PLP
Sbjct: 283 EIPQGGNLQRFDVSAYANNKCLCGSPLP 310


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query574
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.44
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=1.1e-29  Score=247.06  Aligned_cols=259  Identities=28%  Similarity=0.433  Sum_probs=196.7

Q ss_pred             CCcEEEcCCCccccc--ccccccCCCCccEEECCC-CCCCCCCCcchhcCCCCcEEEccCcccccCCCcccccccCcccc
Q 041121          228 NSSFLNLSKNRFSRS--ISLCSISGSKLTYIDLSS-NLLSGKLPDCWWMFDSLVILDLGNNSFSGRIPDSMGFLQNIQTQ  304 (574)
Q Consensus       228 ~L~~L~L~~n~i~~~--~~~~~~~~~~L~~L~L~~-n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~l  304 (574)
                      .+++|+|+++.+.+.  .+..+..+++|++|++++ |.+++.+|..+..+++|++|+|++|++.+..+..+..+.+|   
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L---  127 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTL---  127 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTC---
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhh---
Confidence            456666666666553  234566677777777765 66666667777777777777777777776666666666666   


Q ss_pred             ccccccccCccceeeeccccccccccccceEEecCceeccCCChhhcCCCCCCEEEccCCcccccCCccccccccC-ccc
Q 041121          305 FTQQQFNRRTVFIVWELLTTQTFESWEERFVRLKSNKFHGKTPFQLCQFAFLQVLDLSLNNISGKIPKCFNNFTAM-TQE  383 (574)
Q Consensus       305 ~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~l~L~~n~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~l  383 (574)
                                                  +.++++.|.+.+..|..+..++.++.+++++|.+.+.+|..+..+..+ +.+
T Consensus       128 ----------------------------~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l  179 (313)
T d1ogqa_         128 ----------------------------VTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSM  179 (313)
T ss_dssp             ----------------------------CEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEE
T ss_pred             ----------------------------cccccccccccccCchhhccCcccceeecccccccccccccccccccccccc
Confidence                                        667777777777777777777777777777777776666666665554 444


Q ss_pred             cCCCCccccccccccCCCccccccccCcccccccCCCcccccccCcccEEEccCCcCCCCCcHhhhhcCCCCEEeCCCCc
Q 041121          384 RSSDPTIKVYYYTFVGPPYVHHYSFQDKVMPTWKGSGREYRSTLGLIKSLELSSNKLNGAVPEEIMDLVGLVALNLSRNH  463 (574)
Q Consensus       384 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~  463 (574)
                      ..+.|.+...                          .+..+..+. ...++++++.+.+.+|..+..+++|+++++++|.
T Consensus       180 ~~~~n~l~~~--------------------------~~~~~~~l~-~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~  232 (313)
T d1ogqa_         180 TISRNRLTGK--------------------------IPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNS  232 (313)
T ss_dssp             ECCSSEEEEE--------------------------CCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSE
T ss_pred             cccccccccc--------------------------ccccccccc-cccccccccccccccccccccccccccccccccc
Confidence            4555544311                          111122222 3579999999988999999999999999999999


Q ss_pred             CcccCCccccCCCCCCEEeCCCCcccccCCCCccCCCCCCEEeccCCcCcccCCCcchhcccCcccccCCCCCCCCCCCC
Q 041121          464 LTGQNSPKIGQLKSLDFLDLSRNQLVGGIPSSLSPLSVLSVMDLSYNNLSGKIPTGTQLQSFNGSVYAGNPELCGLPLPN  543 (574)
Q Consensus       464 l~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~l~~l~~L~~L~Ls~N~l~~~~p~~~~~~~l~~~~l~~Np~~c~~~l~~  543 (574)
                      +.+.++ .+..+++|+.|++++|++++.+|..|..+++|++|+|++|+|+|.+|....++.++.+++.||+.+||.|++ 
T Consensus       233 l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g~plp-  310 (313)
T d1ogqa_         233 LAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLP-  310 (313)
T ss_dssp             ECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEESTTSS-
T ss_pred             cccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccCCCCC-
Confidence            987655 688899999999999999999999999999999999999999999998888999999999999999999987 


Q ss_pred             CCC
Q 041121          544 KCR  546 (574)
Q Consensus       544 ~c~  546 (574)
                      .|+
T Consensus       311 ~c~  313 (313)
T d1ogqa_         311 ACT  313 (313)
T ss_dssp             CCC
T ss_pred             CCC
Confidence            674



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure