Citrus Sinensis ID: 041168


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN
cHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccccccEEEEEccccccEEEEcccccccccccccEEEccccccccccccHHHHccccccccccccccccccccccccccccEEEccccccccccccccHHHHHHccccccEEEcccccccccccccccc
cHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccccccccccEEEEccccccccccccHHHHcHHHHHHHccccccccccHHHHcccccEEEEcccccccccccccccHHHHHccccccEEEcccccccccccHcccc
rsallqfkqsLTVVQCsfddypsaypkvaswsqeeenrdcclwdgikcnednghvirldltssclygsinsssslFQLVHLEWLVlsnnhfnfseipseIKNLsrltalsnpsffgqipaellelsdlesldlsfnnfhlklqgpSLANLAEKLANLKVLHLgqvntastvpyalan
rsallqfkqsltvvqcsfddyPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHlgqvntastvpyalan
RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAellelsdlesldlsFNNFHLKLQGPSlanlaeklanlkvlHLGQVNTASTVPYALAN
*****QFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLY*********FQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVP*****
RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN
RSALLQFKQSLTVVQCSFDDYPSAYPKV**********DCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN
RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTALSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.807 0.168 0.360 3e-14
C0LGF4 591 LRR receptor-like serine/ no no 0.779 0.233 0.329 3e-09
O82318 960 Probably inactive leucine no no 0.785 0.144 0.357 5e-09
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.621 0.109 0.410 6e-09
C0LGH8 664 Probable LRR receptor-lik no no 0.774 0.206 0.304 7e-09
O22938 890 Leucine-rich repeat recep no no 0.581 0.115 0.387 3e-08
Q9SYQ8 980 Receptor protein kinase C no no 0.751 0.135 0.328 3e-08
Q9FK10 601 Probable inactive recepto no no 0.723 0.212 0.310 4e-08
Q93Y06 669 Probable inactive recepto no no 0.604 0.159 0.352 6e-08
O48788 658 Probable inactive recepto no no 0.587 0.158 0.351 7e-08
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 89/169 (52%), Gaps = 26/169 (15%)

Query: 1   RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENR-------DCCLWDGIKCNEDNG 53
           R ALL+F+                +P  ASW    + R       DCCLW+G+ CN+ +G
Sbjct: 39  RDALLEFR--------------GEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSG 84

Query: 54  HVIRLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTA--LSN 111
            VI LD+ ++ L   + ++SSLF+L +L  L L+N +  + EIPS + NLS LT   L  
Sbjct: 85  QVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNL-YGEIPSSLGNLSHLTLVNLYF 143

Query: 112 PSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVL 160
             F G+IPA +  L+ L  L L+ NN        SL NL+ +L NL++ 
Sbjct: 144 NKFVGEIPASIGNLNQLRHLILA-NNVLTGEIPSSLGNLS-RLVNLELF 190




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGF4|FEI1_ARATH LRR receptor-like serine/threonine-protein kinase FEI 1 OS=Arabidopsis thaliana GN=FEI1 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|C0LGH8|Y1634_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g63430 OS=Arabidopsis thaliana GN=At1g63430 PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FK10|Y5332_ARATH Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1 Back     alignment and function description
>sp|Q93Y06|Y5720_ARATH Probable inactive receptor kinase At5g67200 OS=Arabidopsis thaliana GN=At5g67200 PE=1 SV=1 Back     alignment and function description
>sp|O48788|Y2267_ARATH Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
224140511 894 predicted protein [Populus trichocarpa] 0.971 0.192 0.581 3e-45
224140505 993 predicted protein [Populus trichocarpa] 0.971 0.173 0.587 3e-45
147866761 859 hypothetical protein VITISV_021527 [Viti 0.983 0.202 0.566 2e-44
224140509 961 predicted protein [Populus trichocarpa] 0.971 0.178 0.581 2e-44
359485824 973 PREDICTED: receptor-like protein 12-like 0.960 0.174 0.578 2e-43
359490156 886 PREDICTED: receptor-like protein 12-like 0.988 0.197 0.565 3e-43
359485822 993 PREDICTED: receptor-like protein 12-like 0.983 0.175 0.569 2e-42
224140517 979 predicted protein [Populus trichocarpa] 0.971 0.175 0.598 3e-42
224140513 947 predicted protein [Populus trichocarpa] 0.887 0.165 0.598 4e-42
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.960 0.169 0.567 1e-41
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 127/177 (71%), Gaps = 5/177 (2%)

Query: 3   ALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTS 62
           ALLQFK+SL V+  S    PSAYPKVASW  + E  +CC WDG++C+ D+GHVI LDL+S
Sbjct: 43  ALLQFKESL-VINESASYEPSAYPKVASWKADGERGNCCSWDGVECDGDSGHVIGLDLSS 101

Query: 63  SCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTA--LSNPSFFGQIPA 120
           SCLYGSI+S+SSLF LV L  L L++N FN S+IPS I+NLSRL    L+   F GQIPA
Sbjct: 102 SCLYGSIDSNSSLFHLVQLRRLNLADNDFNNSKIPSGIRNLSRLVDLNLTMDGFSGQIPA 161

Query: 121 ELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN 177
           E+LELS+L SLDL  N   LKLQ P L +L E L NL+VLHL  VN ++ +P  + N
Sbjct: 162 EILELSELVSLDLGLN--PLKLQNPGLQHLVEALTNLEVLHLSGVNISAKIPQIMTN 216




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224140505|ref|XP_002323623.1| predicted protein [Populus trichocarpa] gi|222868253|gb|EEF05384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147866761|emb|CAN80989.1| hypothetical protein VITISV_021527 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
TAIR|locus:2055772 983 RLP19 "receptor like protein 1 0.920 0.165 0.379 3.3e-19
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.757 0.142 0.401 9.7e-18
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.638 0.130 0.424 1.4e-17
TAIR|locus:2825762 994 RLP6 "AT1G45616" [Arabidopsis 0.649 0.115 0.417 5.9e-17
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.774 0.188 0.353 3.3e-16
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.559 0.097 0.480 4.3e-16
TAIR|locus:2078102 875 RLP33 "receptor like protein 3 0.745 0.150 0.391 1.9e-15
TAIR|locus:2119430 741 RLP47 "receptor like protein 4 0.598 0.143 0.405 5.2e-15
TAIR|locus:2090754 711 RLP43 "receptor like protein 4 0.661 0.164 0.416 6.2e-15
TAIR|locus:2119445 719 AT4G13820 [Arabidopsis thalian 0.943 0.232 0.307 3.6e-14
TAIR|locus:2055772 RLP19 "receptor like protein 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 3.3e-19, P = 3.3e-19
 Identities = 69/182 (37%), Positives = 91/182 (50%)

Query:     3 ALLQFKQSL-TVVQCSFDDYPSAYP-KVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDL 60
             A+L+FK    T+ +  FD   S  P K  SW+    N DCC WDGIKC+   G VI LDL
Sbjct:    37 AILEFKNEFETLEESCFD---SNIPLKTESWTN---NSDCCYWDGIKCDAKFGDVIELDL 90

Query:    61 TSSCLYGSINSSSSLFQLVHLEWLV---LSNNHFNFSEIPSEIKNLSRLTAL--SNPSFF 115
             + SCL G +NS+SSLF+L  L +L    LSNN F   +IPS ++ LS LT L  S   F 
Sbjct:    91 SFSCLRGQLNSNSSLFRLPQLRFLTTLDLSNNDF-IGQIPSSLETLSNLTTLDLSRNHFS 149

Query:   116 GQIPAXXXXXXXXXXXXXXFNNFHLKLQGPSXXXXXXXXXXXXXXHLGQVNTASTVPYAL 175
             G+IP+               NNF  ++  PS              +L   N +  VP ++
Sbjct:   150 GRIPSSIGNLSHLIFVDFSHNNFSGQI--PSSLGYLSHLTSF---NLSYNNFSGRVPSSI 204

Query:   176 AN 177
              N
Sbjct:   205 GN 206


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.004
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 62.9 bits (153), Expect = 6e-12
 Identities = 58/177 (32%), Positives = 90/177 (50%), Gaps = 27/177 (15%)

Query: 4   LLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSS 63
           LL FK S+        + P  Y  +++W+    + D CLW GI CN ++  V+ +DL+  
Sbjct: 34  LLSFKSSI--------NDPLKY--LSNWNS---SADVCLWQGITCN-NSSRVVSIDLSGK 79

Query: 64  CLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLS---RLTALSNPSFFGQIPA 120
            + G I  SS++F+L +++ + LSNN  +   IP +I   S   R   LSN +F G IP 
Sbjct: 80  NISGKI--SSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR 136

Query: 121 ELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYALAN 177
               + +LE+LDLS N    +     + N     ++LKVL LG       +P +L N
Sbjct: 137 G--SIPNLETLDLSNNMLSGE-----IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN 186


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN03150623 hypothetical protein; Provisional 99.73
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.53
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
KOG0617264 consensus Ras suppressor protein (contains leucine 99.33
PLN03150 623 hypothetical protein; Provisional 99.33
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.16
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.08
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.86
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.73
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.73
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.67
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.64
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.55
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.54
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.54
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.53
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.49
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.47
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.42
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.36
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.19
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.18
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.79
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.72
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.66
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.46
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.4
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.38
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.3
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.18
PRK15386 426 type III secretion protein GogB; Provisional 96.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.82
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.7
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.5
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.28
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.86
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.8
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.37
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.2
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.87
smart0037026 LRR Leucine-rich repeats, outliers. 94.87
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 94.65
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.28
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.94
PRK15386 426 type III secretion protein GogB; Provisional 93.92
KOG0473 326 consensus Leucine-rich repeat protein [Function un 93.85
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.13
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.08
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.64
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.61
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.05
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.43
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.66
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.85  E-value=5.1e-21  Score=170.72  Aligned_cols=153  Identities=34%  Similarity=0.562  Sum_probs=102.4

Q ss_pred             ChHHHHHhhhCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCccceEEEcCCCCcEEEEEccCCccccccCCCcccccCcC
Q 041168            1 RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDLTSSCLYGSINSSSSLFQLVH   80 (177)
Q Consensus         1 ~~~l~~~k~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~C~w~gv~c~~~~~~l~~L~l~~n~l~~~~~~~~~l~~l~~   80 (177)
                      +.||++||+++.++..          .+.+|+   ...+||.|.||.|... ++|+.|++++|.+.+.++.  .+..++.
T Consensus        31 ~~~l~~~~~~~~~~~~----------~~~~w~---~~~~~c~w~gv~c~~~-~~v~~L~L~~~~i~~~~~~--~~~~l~~   94 (968)
T PLN00113         31 LELLLSFKSSINDPLK----------YLSNWN---SSADVCLWQGITCNNS-SRVVSIDLSGKNISGKISS--AIFRLPY   94 (968)
T ss_pred             HHHHHHHHHhCCCCcc----------cCCCCC---CCCCCCcCcceecCCC-CcEEEEEecCCCccccCCh--HHhCCCC
Confidence            3689999999975543          678997   6678999999999753 6899999998888877776  7777888


Q ss_pred             CcEEEccCCCCCCCCCCcccc-CCccccc--cccccCC----------------------CCCChhhhCCCCCCEEeCCC
Q 041168           81 LEWLVLSNNHFNFSEIPSEIK-NLSRLTA--LSNPSFF----------------------GQIPAELLELSDLESLDLSF  135 (177)
Q Consensus        81 L~~L~Ls~n~l~~~~~p~~~~-~l~~L~~--ls~n~l~----------------------~~~p~~~~~l~~L~~L~Ls~  135 (177)
                      |+.|+|++|.+.+. +|..+. .+++|++  +++|++.                      +.+|..++.+++|++|++++
T Consensus        95 L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~  173 (968)
T PLN00113         95 IQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGG  173 (968)
T ss_pred             CCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECcc
Confidence            88888888877765 665433 4555555  4444443                      34455555556666666665


Q ss_pred             CcCCcccCCCchhHHhhcCCCCCEEEeecccCCCCCCccc
Q 041168          136 NNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYAL  175 (177)
Q Consensus       136 N~~~l~~~~~~~p~~~~~l~~L~~L~Ls~N~l~g~~p~~l  175 (177)
                      |  .+   .+.+|..+.++++|++|++++|.+.+.+|..+
T Consensus       174 n--~l---~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l  208 (968)
T PLN00113        174 N--VL---VGKIPNSLTNLTSLEFLTLASNQLVGQIPREL  208 (968)
T ss_pred             C--cc---cccCChhhhhCcCCCeeeccCCCCcCcCChHH
Confidence            5  33   34455555555555555555555555555443



>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-09
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  107 bits (270), Expect = 8e-28
 Identities = 47/181 (25%), Positives = 72/181 (39%), Gaps = 27/181 (14%)

Query: 1   RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCLWDGIKCNEDNGHVIRLDL 60
              L+ FK  L           +    +  WS    N++ C +DG+ C   +  V  +DL
Sbjct: 14  IHQLISFKDVL--------PDKNL---LPDWS---SNKNPCTFDGVTC--RDDKVTSIDL 57

Query: 61  TSSCLYGSINS-SSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRLTAL--SNPSFFGQ 117
           +S  L    ++ SSSL  L  LE L LSN+H N   +    K  + LT+L  S  S  G 
Sbjct: 58  SSKPLNVGFSAVSSSLLSLTGLESLFLSNSHIN-GSVS-GFKCSASLTSLDLSRNSLSGP 115

Query: 118 IPA--ELLELSDLESLDLSFNNFHLKLQGPSLANLAEKLANLKVLHLGQVNTASTVPYAL 175
           +     L   S L+ L++S N      +          L +L+VL L   + +       
Sbjct: 116 VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLK----LNSLEVLDLSANSISGANVVGW 171

Query: 176 A 176
            
Sbjct: 172 V 172


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.86
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.82
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.7
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 99.67
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.65
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.65
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.63
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.62
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.62
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.62
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.58
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.58
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.57
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.57
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.57
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.57
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.56
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.55
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.55
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.55
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.55
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.54
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.54
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.53
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.52
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.52
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.49
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.49
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.48
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.48
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.47
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.47
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.47
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.47
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.47
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.46
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.46
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.45
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.44
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.44
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.44
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.44
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.44
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.42
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.42
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.41
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.4
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.37
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.37
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.37
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.36
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.36
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.35
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.33
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.3
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.27
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.26
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.25
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.25
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.24
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.24
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.2
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.2
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.2
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 99.17
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.16
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.13
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.04
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.01
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.99
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.95
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.93
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.78
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.68
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.56
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.46
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.2
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.83
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.78
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.59
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.87
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.27
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.12
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.71
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.66
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.49
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.44
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.67
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.93  E-value=2.3e-26  Score=180.32  Aligned_cols=154  Identities=31%  Similarity=0.501  Sum_probs=136.2

Q ss_pred             ChHHHHHhhhCccCCCCCCCCCCCCCCCCCCCCCCCCCCCCc--cceEEEcCCC--CcEEEEEccCCcccc--ccCCCcc
Q 041168            1 RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCCL--WDGIKCNEDN--GHVIRLDLTSSCLYG--SINSSSS   74 (177)
Q Consensus         1 ~~~l~~~k~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~C~--w~gv~c~~~~--~~l~~L~l~~n~l~~--~~~~~~~   74 (177)
                      ++||++||+++.++.           .+.+|.   .+.+||.  |.||.|....  ++|+.|++++|.+.+  .+|.  .
T Consensus         8 ~~aL~~~k~~~~~~~-----------~l~~W~---~~~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~--~   71 (313)
T 1ogq_A            8 KQALLQIKKDLGNPT-----------TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS--S   71 (313)
T ss_dssp             HHHHHHHHHHTTCCG-----------GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG--G
T ss_pred             HHHHHHHHHhcCCcc-----------cccCCC---CCCCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccCh--h
Confidence            368999999996543           589997   5678998  9999998644  799999999999998  7888  8


Q ss_pred             cccCcCCcEEEccC-CCCCCCCCCccccCCccccc--cccccCCCCCChhhhCCCCCCEEeCCCCcCCcccCCCchhHHh
Q 041168           75 LFQLVHLEWLVLSN-NHFNFSEIPSEIKNLSRLTA--LSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLA  151 (177)
Q Consensus        75 l~~l~~L~~L~Ls~-n~l~~~~~p~~~~~l~~L~~--ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~~~l~~~~~~~p~~~  151 (177)
                      +..+++|++|++++ |.+.+. +|..+..+++|++  +++|.+.+.+|..+..+++|++|++++|  .+   .+.+|..+
T Consensus        72 l~~l~~L~~L~L~~~n~l~~~-~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N--~l---~~~~p~~~  145 (313)
T 1ogq_A           72 LANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN--AL---SGTLPPSI  145 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS--EE---ESCCCGGG
T ss_pred             HhCCCCCCeeeCCCCCccccc-CChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCC--cc---CCcCChHH
Confidence            99999999999995 999877 8999999999999  9999999889999999999999999999  55   56788889


Q ss_pred             hcCCCCCEEEeecccCCCCCCcccc
Q 041168          152 EKLANLKVLHLGQVNTASTVPYALA  176 (177)
Q Consensus       152 ~~l~~L~~L~Ls~N~l~g~~p~~l~  176 (177)
                      ..+++|++|++++|.+++.+|..++
T Consensus       146 ~~l~~L~~L~L~~N~l~~~~p~~l~  170 (313)
T 1ogq_A          146 SSLPNLVGITFDGNRISGAIPDSYG  170 (313)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGG
T ss_pred             hcCCCCCeEECcCCcccCcCCHHHh
Confidence            9999999999999999988888765



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 18/110 (16%)

Query: 1   RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCC--LWDGIKCNEDNG--HVI 56
           + ALLQ K+ L          P+    ++SW       DCC   W G+ C+ D     V 
Sbjct: 8   KQALLQIKKDLG--------NPTT---LSSWL---PTTDCCNRTWLGVLCDTDTQTYRVN 53

Query: 57  RLDLTSSCLYGSINSSSSLFQLVHLEWLVLSNNHFNFSEIPSEIKNLSRL 106
            LDL+   L       SSL  L +L +L +   +     IP  I  L++L
Sbjct: 54  NLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQL 103


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.5
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.46
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.44
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.41
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.24
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.18
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.07
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.06
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.06
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.01
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.99
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.97
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.89
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.83
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 98.69
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.66
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.73
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.55
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.75
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.94  E-value=3.7e-27  Score=182.51  Aligned_cols=154  Identities=31%  Similarity=0.505  Sum_probs=137.6

Q ss_pred             ChHHHHHhhhCccCCCCCCCCCCCCCCCCCCCCCCCCCCCC--ccceEEEcCC--CCcEEEEEccCCcccc--ccCCCcc
Q 041168            1 RSALLQFKQSLTVVQCSFDDYPSAYPKVASWSQEEENRDCC--LWDGIKCNED--NGHVIRLDLTSSCLYG--SINSSSS   74 (177)
Q Consensus         1 ~~~l~~~k~~~~~~~~~~~~~~~~~~~l~~W~~~~~~~~~C--~w~gv~c~~~--~~~l~~L~l~~n~l~~--~~~~~~~   74 (177)
                      |+||++||+++.++.           .+.+|.   .+++||  .|.||+|+..  ..+|+.|+++++.+.+  .+|.  .
T Consensus         8 ~~aLl~~k~~~~~~~-----------~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~--~   71 (313)
T d1ogqa_           8 KQALLQIKKDLGNPT-----------TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPS--S   71 (313)
T ss_dssp             HHHHHHHHHHTTCCG-----------GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCG--G
T ss_pred             HHHHHHHHHHCCCCC-----------cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCCh--H
Confidence            589999999998764           689998   678999  5999999864  3489999999999987  4677  8


Q ss_pred             cccCcCCcEEEccC-CCCCCCCCCccccCCccccc--cccccCCCCCChhhhCCCCCCEEeCCCCcCCcccCCCchhHHh
Q 041168           75 LFQLVHLEWLVLSN-NHFNFSEIPSEIKNLSRLTA--LSNPSFFGQIPAELLELSDLESLDLSFNNFHLKLQGPSLANLA  151 (177)
Q Consensus        75 l~~l~~L~~L~Ls~-n~l~~~~~p~~~~~l~~L~~--ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~~~l~~~~~~~p~~~  151 (177)
                      +.++++|++|+|++ |.+++. +|..|+.+++|++  |++|++.+..+..+..+..|++++++.|  .+   ...+|..+
T Consensus        72 l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N--~~---~~~~p~~l  145 (313)
T d1ogqa_          72 LANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN--AL---SGTLPPSI  145 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS--EE---ESCCCGGG
T ss_pred             HhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccc--cc---cccCchhh
Confidence            99999999999986 899988 9999999999999  9999999888888999999999999999  55   57788999


Q ss_pred             hcCCCCCEEEeecccCCCCCCcccc
Q 041168          152 EKLANLKVLHLGQVNTASTVPYALA  176 (177)
Q Consensus       152 ~~l~~L~~L~Ls~N~l~g~~p~~l~  176 (177)
                      ..+++|+++++++|.+.|.+|..++
T Consensus       146 ~~l~~L~~l~l~~n~l~~~ip~~~~  170 (313)
T d1ogqa_         146 SSLPNLVGITFDGNRISGAIPDSYG  170 (313)
T ss_dssp             GGCTTCCEEECCSSCCEEECCGGGG
T ss_pred             ccCcccceeeccccccccccccccc
Confidence            9999999999999999999998765



>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure